F407702

General Info

Members Datasets Scaffolds Average Seq Length
325 269 650 277

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100242280|Ga0070694_1002422801
Length 292
Sequence MRNPIRKTKSKSIRPKTTPEEWWSTSIIEMRPGVIRYRGYAIEELIGRIGFAEMVWLMTRGELPKAEQAKLLEAALVAAVDHGPQAPSIAIARMAMTCGVGINNAMASAINVLGDVHGGAGEQCVRFYQRIANRLTGKTPKAQTRQAIVAAVEAEMEGLTKRGVSRVPGFGHRFHPIDPRAPKLLQLADKAAAAGVIPGSFAIIGRTVETTLAKRKGQKIPMNIDGATAVIFAELGFPAPLCRGLFVLSRSVGALAHAWEESQSGKRNKGPIPRHLLWNYLGPKPRRLKRIR

Samples

Sample ID Description Type Environment
1 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
57 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
58 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
59 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
60 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
62 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
67 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
85 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
86 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
87 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
88 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
89 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
90 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
91 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
92 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
93 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
94 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
95 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
96 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
97 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
98 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
99 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
102 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
107 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
108 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
109 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
110 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
111 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
112 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
113 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
114 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
115 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
116 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
117 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
118 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
119 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
120 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
125 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
126 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
127 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
128 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
133 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
136 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
143 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
150 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
151 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
152 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
155 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
156 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
157 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
160 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
170 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
171 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
176 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
177 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
178 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
179 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
180 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
181 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
182 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
183 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
184 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
185 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
188 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
195 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
196 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
197 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
198 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
199 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
200 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
201 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
202 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
203 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
204 2512875024
205 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
206 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
207 2582580736 Prauserella sp. Am3 Isolate Unclassified
208 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
209 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
210 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
211 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
212 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
213 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
214 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
215 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
216 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
217 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
218 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
219 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
220 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
221 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
222 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
223 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
224 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
225 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
226 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
227 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
228 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
229 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
230 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
231 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
232 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
233 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
234 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
235 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
236 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
237 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
238 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
239 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
240 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
241 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
242 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
243 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
244 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
245 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
246 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
247 2952252522 Salinicola sp. DM10 Isolate Unclassified
248 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
249 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
250 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
251 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
252 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
253 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
254 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
255 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
256 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
257 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
258 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
259 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
260 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
261 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
262 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
263 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
264 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
265 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
266 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
267 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
268 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
269 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 79.38
Metatranscriptomes 0
Isolates 20.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.46
Nodule 14.15
Rhizoplane 2.77
Rhizosphere 59.08
Stem 0
Stem Tuber 0
Unclassified 0.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070694_100242280 3300005444 Bacteria 1361
2 JGI25152J39213_1001189 3300002773 Bacteria 11978
3 JGI25151J46595_10009952 3300003187 Bacteria 4459
4 JGI25153J46596_10000338 3300003215 Bacteria 33480
5 rootL2_10010425 3300003322 Bacteria 20457
6 Ga0055542_1000592 3300003762 Bacteria 31197
7 Ga0070676_10003117 3300005328 Bacteria 8563
8 Ga0070670_100429874 3300005331 Bacteria 1168
9 Ga0068869_100298594 3300005334 Bacteria 1300
10 Ga0070669_100219401 3300005353 Bacteria 1503
11 Ga0070688_100275822 3300005365 Bacteria 1206
12 Ga0070703_10012635 3300005406 Bacteria 2393
13 Ga0070709_10049287 3300005434 Bacteria 2632
14 Ga0070678_100080107 3300005456 Bacteria 2472
15 Ga0070698_100423413 3300005471 Bacteria 1266
16 Ga0070699_100000796 3300005518 Bacteria 29104
17 Ga0068853_100048116 3300005539 Bacteria 3661
18 Ga0070665_100463958 3300005548 Bacteria 1277
19 Ga0068857_100147645 3300005577 Bacteria 2128
20 Ga0068856_100083602 3300005614 Bacteria 3170
21 Ga0068856_100139772 3300005614 Bacteria 2429
22 Ga0068852_100318867 3300005616 Bacteria 1509
23 Ga0068860_100174796 3300005843 Bacteria 2075
24 Ga0068862_100036053 3300005844 Bacteria 4190
25 Ga0081455_10000573 3300005937 Bacteria 47963
26 Ga0081540_1003099 3300005983 Bacteria 13317
27 Ga0075365_10008666 3300006038 Bacteria 5791
28 Ga0075365_10106834 3300006038 Bacteria 1921
29 Ga0075365_10216450 3300006038 Bacteria 1343
30 Ga0075368_10007574 3300006042 Bacteria 3831
31 Ga0075363_100077200 3300006048 Bacteria 1817
32 Ga0075364_10014945 3300006051 Bacteria 4806
33 Ga0075364_10153484 3300006051 Bacteria 1552
34 Ga0075432_10004136 3300006058 Bacteria 4949
35 Ga0070715_10118043 3300006163 Bacteria 1261
36 Ga0075362_10012325 3300006177 Bacteria 3394
37 Ga0075362_10226133 3300006177 Bacteria 915
38 Ga0075367_10016817 3300006178 Bacteria 4001
39 Ga0075367_10212994 3300006178 Bacteria 1208
40 Ga0075369_10054435 3300006186 Bacteria 1737
41 Ga0075366_10000452 3300006195 Bacteria 19114
42 Ga0075370_10063234 3300006353 Bacteria 2110
43 Ga0075428_100000726 3300006844 Bacteria 34198
44 Ga0075428_100001150 3300006844 Bacteria 28261
45 Ga0075428_100020845 3300006844 Bacteria 7258
46 Ga0075428_100421332 3300006844 Unclassified 1430
47 Ga0075430_100013539 3300006846 Bacteria 6954
48 Ga0075430_100031837 3300006846 Bacteria 4476
49 Ga0075431_100001045 3300006847 Bacteria 24701
50 Ga0075431_100013946 3300006847 Bacteria 8118
51 Ga0075431_100045644 3300006847 Bacteria 4517
52 Ga0075431_100613322 3300006847 Bacteria 1071
53 Ga0075429_100004042 3300006880 Bacteria 12562
54 Ga0075429_100027490 3300006880 Bacteria 4938
55 Ga0075429_100195742 3300006880 Bacteria 1770
56 Ga0075429_100468530 3300006880 Bacteria 1104
57 Ga0075436_100041827 3300006914 Bacteria 3162
58 Ga0075435_100236915 3300007076 Unclassified 1551
59 Ga0099795_10010153 3300007788 Bacteria 2760
60 Ga0105240_10402384 3300009093 Bacteria 1542
61 Ga0111539_10000725 3300009094 Bacteria 42875
62 Ga0111539_10030973 3300009094 Bacteria 6499
63 Ga0114129_10000227 3300009147 Bacteria 62698
64 Ga0114129_10060421 3300009147 Bacteria 5299
65 Ga0114129_10475773 3300009147 Bacteria 1635
66 Ga0105243_10178917 3300009148 Bacteria 1843
67 Ga0105242_11018458 3300009176 Bacteria 837
68 Ga0105237_10037129 3300009545 Bacteria 4926
69 Ga0105238_10077063 3300009551 Bacteria 3326
70 Ga0105238_10305216 3300009551 Bacteria 1576
71 Ga0099796_10004452 3300010159 Bacteria 3390
72 Ga0157369_10188744 3300013105 Bacteria 2166
73 Ga0157378_10036258 3300013297 Bacteria 4365
74 Ga0163162_10539145 3300013306 Bacteria 1295
75 Ga0182008_10064031 3300014497 Bacteria 1810
76 Ga0182006_1020552 3300015261 Bacteria 2765
77 Ga0182007_10066302 3300015262 Bacteria 1183
78 Ga0183362_10002 3300015683 Bacteria 1432711
79 Ga0207425_1001160 3300025245 Bacteria 11803
80 Ga0209148_1000069 3300025254 Bacteria 334444
81 Ga0209148_1013786 3300025254 Bacteria 1444
82 Ga0209129_1000122 3300025258 Bacteria 135306
83 Ga0209455_1000219 3300025272 Bacteria 79850
84 Ga0209673_1012470 3300025273 Bacteria 3421
85 Ga0209676_1016448 3300025292 Bacteria 2669
86 Ga0209564_1000266 3300025295 Bacteria 110519
87 Ga0209758_1000091 3300025297 Bacteria 242583
88 Ga0209051_1007088 3300025303 Bacteria 6198
89 Ga0207697_10063408 3300025315 Bacteria 1540
90 Ga0207705_10214003 3300025909 Bacteria 1462
91 Ga0207695_10220898 3300025913 Bacteria 1802
92 Ga0207695_10262197 3300025913 Bacteria 1625
93 Ga0207671_10158190 3300025914 Bacteria 1753
94 Ga0207693_10229203 3300025915 Bacteria 1459
95 Ga0207681_10344916 3300025923 Bacteria 1191
96 Ga0207709_10158179 3300025935 Bacteria 1577
97 Ga0207640_10184625 3300025981 Bacteria 1567
98 Ga0207639_10064051 3300026041 Bacteria 2849
99 Ga0207678_10070868 3300026067 Bacteria 2989
100 Ga0207678_10590632 3300026067 Bacteria 973
101 Ga0207702_10168905 3300026078 Bacteria 2004
102 Ga0207683_10226290 3300026121 Bacteria 1705
103 Ga0207698_10010993 3300026142 Bacteria 5850
104 Ga0209179_1003425 3300027512 Bacteria 2284
105 Ga0207428_10004757 3300027907 Bacteria 12834
106 Ga0207428_10012395 3300027907 Bacteria 7491
107 Ga0268264_10150652 3300028381 Bacteria 2085
108 Ga0307515_10000014 3300028794 Bacteria 562358
109 Ga0307509_10048412 3300031507 Bacteria 4565
110 Ga0265313_10069203 3300031595 Bacteria 1629
111 Ga0307406_10359904 3300031901 Bacteria 1140
112 Ga0373926_0014814 3300035083 Bacteria 2655
113 Ga0373944_0096845 3300035089 Bacteria 993
114 Ga0373923_0000573 3300035111 Bacteria 9075
115 Ga0373936_0000350 3300035113 Bacteria 15643
116 Ga0373945_0002515 3300035116 Bacteria 5730
117 Ga0373953_0000112 3300035117 Bacteria 19685
118 Ga0373954_0004744 3300035118 Bacteria 5860
119 Ga0373956_0016597 3300035119 Bacteria 3094
120 Ga0373957_0007948 3300035120 Bacteria 3415
121 Ga0373943_0029253 3300035170 Bacteria 2602
122 Ga0373924_0003988 3300035410 Bacteria 5124
123 Ga0373935_0001098 3300035692 Bacteria 14767
124 Ga0373935_0027976 3300035692 Bacteria 3484
125 Ga0373935_0110101 3300035692 Bacteria 1827
126 Ga0373927_0009022 3300035695 Bacteria 6697
127 Ga0373933_0001117 3300035724 Bacteria 15975
128 Ga0373933_0043287 3300035724 Bacteria 2664
129 Ga0373947_0014157 3300035725 Bacteria 4574
130 Ga0373947_0045817 3300035725 Bacteria 2617
131 Ga0373937_0000003 3300036401 Bacteria 235408
132 Ga0373937_0158386 3300036401 Bacteria 2122
133 Ga0373937_0328124 3300036401 Bacteria 1448
134 Ga0373925_0000052 3300037068 Bacteria 127490
135 Ga0373925_0546622 3300037068 Bacteria 952
136 Ga0395905_0111694 3300037471 Bacteria 2566
137 Ga0400483_133289 3300039062 Bacteria 1469
138 Ga0400483_275352 3300039062 Bacteria 3769
139 Ga0439438_047896 3300041405 Bacteria 1094
140 Ga0439439_0004840 3300041406 Bacteria 3050
141 Ga0439447_003720 3300041407 Bacteria 5376
142 Ga0439466_0011189 3300041411 Bacteria 3321
143 Ga0451841_1079422 3300041498 Bacteria 982
144 Ga0439433_0007404 3300041999 Bacteria 2370
145 Ga0439442_015530 3300042002 Bacteria 1569
146 Ga0439452_020009 3300042010 Bacteria 1761
147 Ga0439462_0006843 3300042015 Bacteria 2844
148 Ga0439462_0034153 3300042015 Bacteria 1350
149 Ga0450899_004078 3300042135 Bacteria 1564
150 Ga0439446_0002939 3300042156 Bacteria 4163
151 Ga0450908_006441 3300042184 Bacteria 2229
152 Ga0450893_0015986 3300042532 Bacteria 1268
153 Ga0495592_0000051 3300046454 Bacteria 111216
154 Ga0495629_0017344 3300046459 Bacteria 5161
155 Ga0495651_0000769 3300046462 Bacteria 24801
156 Ga0495651_0015263 3300046462 Bacteria 5938
157 Ga0495653_0000039 3300046463 Bacteria 119840
158 Ga0495662_0001044 3300046476 Bacteria 13601
159 Ga0495664_0000015 3300046477 Bacteria 192569
160 Ga0495583_0052985 3300046506 Bacteria 1843
161 Ga0495608_0000025 3300046511 Bacteria 158132
162 Ga0495618_0000022 3300046514 Bacteria 127582
163 Ga0495628_0000011 3300046516 Bacteria 225267
164 Ga0495630_0000372 3300046517 Bacteria 35516
165 Ga0495652_0000014 3300046529 Bacteria 225484
166 Ga0495640_0000008 3300046533 Bacteria 220320
167 Ga0495586_0086584 3300046535 Bacteria 1727
168 Ga0495587_0000015 3300046536 Bacteria 187415
169 Ga0495621_0014781 3300046539 Bacteria 2478
170 Ga0495597_0102882 3300046542 Bacteria 1203
171 Ga0495645_0000020 3300046543 Bacteria 143867
172 Ga0495667_0000013 3300046559 Bacteria 220294
173 Ga0495634_0000043 3300046642 Bacteria 99897
174 Ga0495625_0060181 3300046660 Bacteria 2691
175 Ga0495635_0000012 3300046663 Bacteria 225271
176 Ga0495635_0277274 3300046663 Bacteria 1127
177 Ga0495657_0000048 3300046675 Bacteria 104278
178 Ga0495599_0000008 3300046678 Bacteria 225534
179 Ga0495623_0000002 3300046679 Bacteria 166669
180 Ga0495646_0000004 3300046680 Bacteria 268993
181 Ga0495658_0125000 3300046683 Bacteria 1560
182 Ga0495613_0011168 3300046689 Bacteria 6668
183 Ga0495624_0006290 3300046690 Bacteria 8446
184 Ga0495600_0000024 3300046809 Bacteria 92414
185 Ga0495581_0050655 3300047315 Bacteria 2398
186 Ga0495604_0000001 3300047317 Bacteria 708627
187 Ga0495636_0003914 3300047318 Bacteria 5812
188 Ga0495674_0000023 3300047319 Bacteria 157443
189 Ga0495680_0000233 3300047322 Bacteria 60821
190 Ga0495687_057567 3300047443 Bacteria 1616
191 Ga0495675_0000392 3300047444 Bacteria 30250
192 Ga0495681_0096177 3300047470 Bacteria 1301
193 Ga0495684_0000007 3300047471 Bacteria 225614
194 Ga0495593_0000722 3300047673 Bacteria 19167
195 Ga0495602_0000045 3300048088 Bacteria 118132
196 Ga0496101_0439257 3300048904 Bacteria 1029
197 Ga0496102_0735549 3300048905 Bacteria 909
198 Ga0496105_0482420 3300048908 Bacteria 975
199 Ga0496107_0571973 3300048910 Bacteria 836
200 Ga0496108_0433444 3300048911 Bacteria 1148
201 Ga0496109_0481317 3300048912 Bacteria 1172
202 Ga0496110_0295839 3300048913 Bacteria 1475
203 Ga0496111_0092405 3300048914 Bacteria 2218
204 Ga0496111_0152566 3300048914 Bacteria 1714
205 Ga0496119_0065122 3300048922 Bacteria 2160
206 Ga0496119_0146458 3300048922 Bacteria 1270
207 Ga0496122_0116109 3300048925 Bacteria 1742
208 Ga0496124_0117418 3300048927 Bacteria 2131
209 Ga0496124_0269832 3300048927 Bacteria 1247
210 Ga0496126_0128267 3300048929 Bacteria 2194
211 Ga0496126_0174708 3300048929 Bacteria 1828
212 Ga0501039_0075682 3300049575 Bacteria 2617
213 Ga0501076_0217486 3300049592 Bacteria 1562
214 Ga0501198_000083 3300049649 Bacteria 22402
215 Ga0501222_000098 3300049662 Bacteria 22783
216 Ga0501262_004673 3300049759 Bacteria 1596
217 Ga0501265_000212 3300049762 Bacteria 5754
218 nmdc:mga03683_10104_c1 3300050489 Bacteria 3377
219 nmdc:mga03n38_127481_c1 3300050490 Bacteria 1258
220 nmdc:mga0yw44_201_c1 3300050492 Bacteria 21091
221 nmdc:mga0yw44_211870_c1 3300050492 Bacteria 1282
222 nmdc:mga0k408_130001_c1 3300050493 Bacteria 1495
223 nmdc:mga0k408_2295_c1 3300050493 Bacteria 10200
224 nmdc:mga0k408_26706_c1 3300050493 Bacteria 3275
225 nmdc:mga06z11_14088_c1 3300050494 Bacteria 3531
226 nmdc:mga06z11_32819_c1 3300050494 Bacteria 2535
227 nmdc:mga06z11_52123_c1 3300050494 Bacteria 2098
228 nmdc:mga04h51_83041_c1 3300050495 Bacteria 1141
229 nmdc:mga07m45_138396_c1 3300050496 Bacteria 1410
230 nmdc:mga07m45_16391_c1 3300050496 Bacteria 3968
231 nmdc:mga07m45_63859_c1 3300050496 Bacteria 2089
232 nmdc:mga07m45_97320_c1 3300050496 Bacteria 1689
233 nmdc:mga05p37_1146319_c1 3300050507 Bacteria 809
234 nmdc:mga05p37_1568_c1 3300050507 Bacteria 26557
235 nmdc:mga05p37_78717_c1 3300050507 Bacteria 4059
236 nmdc:mga09592_1386_c1 3300050508 Bacteria 19389
237 nmdc:mga09592_25461_c1 3300050508 Bacteria 4897
238 nmdc:mga0qj67_30398_c1 3300050509 Bacteria 4204
239 nmdc:mga0qj67_3364_c1 3300050509 Bacteria 11534
240 nmdc:mga06r32_134_c1 3300050510 Bacteria 54737
241 nmdc:mga06r32_256772_c1 3300050510 Bacteria 1735
242 nmdc:mga06r32_313924_c1 3300050510 Bacteria 1553
243 nmdc:mga06r32_72667_c1 3300050510 Bacteria 3330
244 nmdc:mga06r32_98905_c1 3300050510 Bacteria 2861
245 nmdc:mga08y16_25677_c1 3300050511 Bacteria 6216
246 nmdc:mga08y16_961_c1 3300050511 Bacteria 28000
247 nmdc:mga0rr50_22598_c1 3300050513 Bacteria 4321
248 nmdc:mga08x19_9568_c1 3300050514 Bacteria 5801
249 nmdc:mga0a205_264457_c1 3300050515 Bacteria 1597
250 Ga0495601_0000014 3300053077 Bacteria 220318
251 Ga0495612_0000014 3300053078 Bacteria 187444
252 Ga0495595_0000038 3300053084 Bacteria 70955
253 Ga0495619_0000006 3300053085 Bacteria 384835
254 Ga0500595_018028 3300053119 Bacteria 2590
255 Ga0500642_0019079 3300053130 Bacteria 2667
256 Ga0500568_0074311 3300053139 Bacteria 1297
257 Ga0500619_000194 3300053154 Bacteria 14268
258 Ga0530510_0242009 3300061734 Bacteria 1343
259 2509394759 2509276022 Bacteria 6200534
260 2512960758 2512875024 Bacteria 7195110
261 2513956125 2513237150 Bacteria 6553639
262 2514040505 2513237165 Bacteria 6771773
263 2583148636 2582580736 Bacteria 5325865
264 2588518786 2588253730 Bacteria 6881675
265 2643776698 2643221551 Bacteria 3750538
266 2643795146 2643221555 Bacteria 3749717
267 2643987478 2643221595 Bacteria 6565519
268 2644158003 2643221627 Bacteria 6761570
269 2756671170 2756170246 Bacteria 7451806
270 2792748149 2791355123 Bacteria 8049106
271 2812350874 2811994878 Bacteria 5992952
272 2816507800 2816332139 Bacteria 9138787
273 2834643227 2834641062 Bacteria 5559922
274 2844008836 2844002411 Bacteria 7168230
275 2847674839 2847670302 Bacteria 6165597
276 2848863921 2848858292 Bacteria 7391279
277 2856317276 2856314179 Bacteria 6477897
278 2856322940 2856320880 Bacteria 7263508
279 2869282492 2869278585 Bacteria 7077053
280 2871470645 2871466892 Bacteria 6923287
281 2874142147 2874139085 Bacteria 7021506
282 2874174936 2874168670 Bacteria 8062617
283 2876397846 2876392853 Bacteria 6660880
284 2878038314 2878035449 Bacteria 6555736
285 2878744667 2878738818 Bacteria 7136951
286 2881166607 2881161766 Bacteria 7127907
287 2881858303 2881853255 Bacteria 6698367
288 2885308087 2885305155 Bacteria 7348390
289 2885333634 2885326080 Bacteria 7134805
290 2885339098 2885334103 Bacteria 7216818
291 2885348927 2885342637 Bacteria 7011821
292 2888338172 2888337043 Bacteria 6629336
293 2901306694 2901300506 Bacteria 8463898
294 2904664497 2904659560 Bacteria 6685615
295 2906417339 2906414383 Bacteria 6580790
296 2924721985 2924718760 Bacteria 6331356
297 2924765196 2924762789 Bacteria 6561353
298 2924782698 2924776078 Bacteria 7492003
299 2928119799 2928115317 Bacteria 6477646
300 2937822414 2937822353 Bacteria 7290551
301 2937881342 2937877337 Bacteria 7246526
302 2937977434 2937972304 Bacteria 7532020
303 2952254187 2952252522 Bacteria 4171745
304 2958039274 2958034702 Bacteria 6989922
305 2958053096 2958041894 Bacteria 13082850
306 2958088101 2958084443 Bacteria 7312792
307 2958092396 2958092219 Bacteria 6861151
308 2958152035 2958144490 Bacteria 6677056
309 2961119496 2961114664 Bacteria 6680456
310 2968020599 2968016561 Bacteria 7022047
311 2968115751 2968110612 Bacteria 6814636
312 2970473896 2970469710 Bacteria 6969209
313 2970597101 2970593180 Bacteria 7073582
314 2977865007 2977864932 Bacteria 7534097
315 2977988631 2977986579 Bacteria 6581278
316 2987669689 2987666974 Bacteria 6509233
317 2995396865 2995392953 Bacteria 4539380
318 2996352783 2996348954 Bacteria 7239054
319 3000139483 3000135777 Bacteria 6891109
320 3004274071 3004268573 Bacteria 7043476
321 3004279465 3004275668 Bacteria 7114440
322 3004291677 3004289098 Bacteria 6135450
323 644751886 644736347 Bacteria 6476522
324 8003402457 8003400568 Bacteria 5535898
325 8045866049 8045864390 Bacteria 5043873
326 Ga0070694_100242280
327 JGI25152J39213_1001189
328 JGI25151J46595_10009952
329 JGI25153J46596_10000338
330 rootL2_10010425
331 Ga0055542_1000592
332 Ga0070676_10003117
333 Ga0070670_100429874
334 Ga0068869_100298594
335 Ga0070669_100219401
336 Ga0070688_100275822
337 Ga0070703_10012635
338 Ga0070709_10049287
339 Ga0070678_100080107
340 Ga0070698_100423413
341 Ga0070699_100000796
342 Ga0068853_100048116
343 Ga0070665_100463958
344 Ga0068857_100147645
345 Ga0068856_100083602
346 Ga0068856_100139772
347 Ga0068852_100318867
348 Ga0068860_100174796
349 Ga0068862_100036053
350 Ga0081455_10000573
351 Ga0081540_1003099
352 Ga0075365_10008666
353 Ga0075365_10106834
354 Ga0075365_10216450
355 Ga0075368_10007574
356 Ga0075363_100077200
357 Ga0075364_10014945
358 Ga0075364_10153484
359 Ga0075432_10004136
360 Ga0070715_10118043
361 Ga0075362_10012325
362 Ga0075362_10226133
363 Ga0075367_10016817
364 Ga0075367_10212994
365 Ga0075369_10054435
366 Ga0075366_10000452
367 Ga0075370_10063234
368 Ga0075428_100000726
369 Ga0075428_100001150
370 Ga0075428_100020845
371 Ga0075428_100421332
372 Ga0075430_100013539
373 Ga0075430_100031837
374 Ga0075431_100001045
375 Ga0075431_100013946
376 Ga0075431_100045644
377 Ga0075431_100613322
378 Ga0075429_100004042
379 Ga0075429_100027490
380 Ga0075429_100195742
381 Ga0075429_100468530
382 Ga0075436_100041827
383 Ga0075435_100236915
384 Ga0099795_10010153
385 Ga0105240_10402384
386 Ga0111539_10000725
387 Ga0111539_10030973
388 Ga0114129_10000227
389 Ga0114129_10060421
390 Ga0114129_10475773
391 Ga0105243_10178917
392 Ga0105242_11018458
393 Ga0105237_10037129
394 Ga0105238_10077063
395 Ga0105238_10305216
396 Ga0099796_10004452
397 Ga0157369_10188744
398 Ga0157378_10036258
399 Ga0163162_10539145
400 Ga0182008_10064031
401 Ga0182006_1020552
402 Ga0182007_10066302
403 Ga0183362_10002
404 Ga0207425_1001160
405 Ga0209148_1000069
406 Ga0209148_1013786
407 Ga0209129_1000122
408 Ga0209455_1000219
409 Ga0209673_1012470
410 Ga0209676_1016448
411 Ga0209564_1000266
412 Ga0209758_1000091
413 Ga0209051_1007088
414 Ga0207697_10063408
415 Ga0207705_10214003
416 Ga0207695_10220898
417 Ga0207695_10262197
418 Ga0207671_10158190
419 Ga0207693_10229203
420 Ga0207681_10344916
421 Ga0207709_10158179
422 Ga0207640_10184625
423 Ga0207639_10064051
424 Ga0207678_10070868
425 Ga0207678_10590632
426 Ga0207702_10168905
427 Ga0207683_10226290
428 Ga0207698_10010993
429 Ga0209179_1003425
430 Ga0207428_10004757
431 Ga0207428_10012395
432 Ga0268264_10150652
433 Ga0307515_10000014
434 Ga0307509_10048412
435 Ga0265313_10069203
436 Ga0307406_10359904
437 Ga0373926_0014814
438 Ga0373944_0096845
439 Ga0373923_0000573
440 Ga0373936_0000350
441 Ga0373945_0002515
442 Ga0373953_0000112
443 Ga0373954_0004744
444 Ga0373956_0016597
445 Ga0373957_0007948
446 Ga0373943_0029253
447 Ga0373924_0003988
448 Ga0373935_0001098
449 Ga0373935_0027976
450 Ga0373935_0110101
451 Ga0373927_0009022
452 Ga0373933_0001117
453 Ga0373933_0043287
454 Ga0373947_0014157
455 Ga0373947_0045817
456 Ga0373937_0000003
457 Ga0373937_0158386
458 Ga0373937_0328124
459 Ga0373925_0000052
460 Ga0373925_0546622
461 Ga0395905_0111694
462 Ga0400483_133289
463 Ga0400483_275352
464 Ga0439438_047896
465 Ga0439439_0004840
466 Ga0439447_003720
467 Ga0439466_0011189
468 Ga0451841_1079422
469 Ga0439433_0007404
470 Ga0439442_015530
471 Ga0439452_020009
472 Ga0439462_0006843
473 Ga0439462_0034153
474 Ga0450899_004078
475 Ga0439446_0002939
476 Ga0450908_006441
477 Ga0450893_0015986
478 Ga0495592_0000051
479 Ga0495629_0017344
480 Ga0495651_0000769
481 Ga0495651_0015263
482 Ga0495653_0000039
483 Ga0495662_0001044
484 Ga0495664_0000015
485 Ga0495583_0052985
486 Ga0495608_0000025
487 Ga0495618_0000022
488 Ga0495628_0000011
489 Ga0495630_0000372
490 Ga0495652_0000014
491 Ga0495640_0000008
492 Ga0495586_0086584
493 Ga0495587_0000015
494 Ga0495621_0014781
495 Ga0495597_0102882
496 Ga0495645_0000020
497 Ga0495667_0000013
498 Ga0495634_0000043
499 Ga0495625_0060181
500 Ga0495635_0000012
501 Ga0495635_0277274
502 Ga0495657_0000048
503 Ga0495599_0000008
504 Ga0495623_0000002
505 Ga0495646_0000004
506 Ga0495658_0125000
507 Ga0495613_0011168
508 Ga0495624_0006290
509 Ga0495600_0000024
510 Ga0495581_0050655
511 Ga0495604_0000001
512 Ga0495636_0003914
513 Ga0495674_0000023
514 Ga0495680_0000233
515 Ga0495687_057567
516 Ga0495675_0000392
517 Ga0495681_0096177
518 Ga0495684_0000007
519 Ga0495593_0000722
520 Ga0495602_0000045
521 Ga0496101_0439257
522 Ga0496102_0735549
523 Ga0496105_0482420
524 Ga0496107_0571973
525 Ga0496108_0433444
526 Ga0496109_0481317
527 Ga0496110_0295839
528 Ga0496111_0092405
529 Ga0496111_0152566
530 Ga0496119_0065122
531 Ga0496119_0146458
532 Ga0496122_0116109
533 Ga0496124_0117418
534 Ga0496124_0269832
535 Ga0496126_0128267
536 Ga0496126_0174708
537 Ga0501039_0075682
538 Ga0501076_0217486
539 Ga0501198_000083
540 Ga0501222_000098
541 Ga0501262_004673
542 Ga0501265_000212
543 nmdc:mga03683_10104_c1
544 nmdc:mga03n38_127481_c1
545 nmdc:mga0yw44_201_c1
546 nmdc:mga0yw44_211870_c1
547 nmdc:mga0k408_130001_c1
548 nmdc:mga0k408_2295_c1
549 nmdc:mga0k408_26706_c1
550 nmdc:mga06z11_14088_c1
551 nmdc:mga06z11_32819_c1
552 nmdc:mga06z11_52123_c1
553 nmdc:mga04h51_83041_c1
554 nmdc:mga07m45_138396_c1
555 nmdc:mga07m45_16391_c1
556 nmdc:mga07m45_63859_c1
557 nmdc:mga07m45_97320_c1
558 nmdc:mga05p37_1146319_c1
559 nmdc:mga05p37_1568_c1
560 nmdc:mga05p37_78717_c1
561 nmdc:mga09592_1386_c1
562 nmdc:mga09592_25461_c1
563 nmdc:mga0qj67_30398_c1
564 nmdc:mga0qj67_3364_c1
565 nmdc:mga06r32_134_c1
566 nmdc:mga06r32_256772_c1
567 nmdc:mga06r32_313924_c1
568 nmdc:mga06r32_72667_c1
569 nmdc:mga06r32_98905_c1
570 nmdc:mga08y16_25677_c1
571 nmdc:mga08y16_961_c1
572 nmdc:mga0rr50_22598_c1
573 nmdc:mga08x19_9568_c1
574 nmdc:mga0a205_264457_c1
575 Ga0495601_0000014
576 Ga0495612_0000014
577 Ga0495595_0000038
578 Ga0495619_0000006
579 Ga0500595_018028
580 Ga0500642_0019079
581 Ga0500568_0074311
582 Ga0500619_000194
583 Ga0530510_0242009
584 2509394759
585 2512960758
586 2513956125
587 2514040505
588 2583148636
589 2588518786
590 2643776698
591 2643795146
592 2643987478
593 2644158003
594 2756671170
595 2792748149
596 2812350874
597 2816507800
598 2834643227
599 2844008836
600 2847674839
601 2848863921
602 2856317276
603 2856322940
604 2869282492
605 2871470645
606 2874142147
607 2874174936
608 2876397846
609 2878038314
610 2878744667
611 2881166607
612 2881858303
613 2885308087
614 2885333634
615 2885339098
616 2885348927
617 2888338172
618 2901306694
619 2904664497
620 2906417339
621 2924721985
622 2924765196
623 2924782698
624 2928119799
625 2937822414
626 2937881342
627 2937977434
628 2952254187
629 2958039274
630 2958053096
631 2958088101
632 2958092396
633 2958152035
634 2961119496
635 2968020599
636 2968115751
637 2970473896
638 2970597101
639 2977865007
640 2977988631
641 2987669689
642 2995396865
643 2996352783
644 3000139483
645 3004274071
646 3004279465
647 3004291677
648 644751886
649 8003402457
650 8045866049

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00285

Citrate_synt

Citrate synthase, C-terminal domain

64

274

0.89

PF00285

Citrate_synt

Citrate synthase, C-terminal domain

16

70

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hxo-assembly1.cif.gz_E structure of the citryl-coa lyase core module of chlorobium limicola atp citrate lyase (space group p21) 0.8821 20 279
6hxp-assembly1.cif.gz_A structure of citryl-coa lyase from hydrogenobacter thermophilus 0.8643 19 277
6nzy-assembly1.cif.gz_C structural determination of the carboxy-terminal portion of atp-citrate lyase 0.8549 20 274
3o8j-assembly5.cif.gz_J crystal structure of 2-methylcitrate synthase (prpc) from salmonella typhimurium 0.8514 47 278
6hxp-assembly1.cif.gz_A structure of citryl-coa lyase from hydrogenobacter thermophilus 0.8396 19 277
ID Description Score Start End Superfamily
1a59A02 Mainly Alpha;Orthogonal Bundle;Cytochrome p450-Terp; domain 2;Cytochrome P450-Terp, domain 2 0.7785 117 223 1.10.230.10
3o8jA02 Mainly Alpha;Orthogonal Bundle;Cytochrome p450-Terp; domain 2;Cytochrome P450-Terp, domain 2 0.7783 117 224 1.10.230.10
3o8jA02 Mainly Alpha;Orthogonal Bundle;Cytochrome p450-Terp; domain 2;Cytochrome P450-Terp, domain 2 0.7579 117 224 1.10.230.10
1a59A02 Mainly Alpha;Orthogonal Bundle;Cytochrome p450-Terp; domain 2;Cytochrome P450-Terp, domain 2 0.7537 117 223 1.10.230.10
3hwkA02 Mainly Alpha;Orthogonal Bundle;Cytochrome p450-Terp; domain 2;Cytochrome P450-Terp, domain 2 0.7516 118 223 1.10.230.10
ID Description Score Start End GO Terms
AF-F8GX99-F1-model_v4 citrate synthase (unknown stereospecificity) (EC 2.3.3.16) 0.9711 11 279 GO:0004108
GO:0005829
GO:0005975
GO:0006099
AF-A0A2J6MW18-F1-model_v4 citrate synthase (unknown stereospecificity) (EC 2.3.3.16) 0.9638 6 278 GO:0004108
GO:0005829
GO:0005975
GO:0006099
GO:0016829
AF-A0A2R8A9B4-F1-model_v4 citrate synthase (unknown stereospecificity) (EC 2.3.3.16) 0.9619 6 273 GO:0004108
GO:0005829
GO:0005975
GO:0006099
GO:0050440
AF-A0A101JMJ1-F1-model_v4 citrate synthase (unknown stereospecificity) (EC 2.3.3.16) 0.9596 13 272 GO:0004108
GO:0005829
GO:0005975
GO:0006099
AF-A0A285K8T6-F1-model_v4 citrate synthase (unknown stereospecificity) (EC 2.3.3.16) 0.959 13 274 GO:0004108
GO:0005829
GO:0005975
GO:0006099

Map