F407883

General Info

Members Datasets Scaffolds Average Seq Length
325 187 292 257

Family's Representative Sequence

Representative Sequence 3300026121|Ga0207683_10011409|Ga0207683_100114094
Length 292
Sequence MSQAVQSPITTAPAAGKPILRARGVRKTFRMGDSVIEVLKQIDLTLQPGEFVAIEGRSGSGKSTLLHILAGLDSADAGIVDFDGSDIAPLAAEASRALARSRLPGAELLRLLMLWANAADRRLADIRNTQFGFVFQFYHLLPELNVLENTMLAPMIQHSWLGFRSRSAELRERATSILNDMGLGHRLKHRPNQLSGGERQRVAIARALMNKPKIVFADEPTGNLDTSSGAEVLELFRAAVRNLDQTVVMVTHDPTAASYADAVVFLSDGRVVATLADPTPDGVLDALRGQGA

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
3 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
4 2643221647 Streptomyces sp. Root369 Isolate Unclassified
5 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
6 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
7 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
8 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
9 2808606448 Streptomyces sp. 193411 Isolate Unclassified
10 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
11 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
12 2862574272 Streptomyces sp. AcE210 Isolate Nodule
13 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
14 2867369537 Streptomyces sp. Z26 Isolate Unclassified
15 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
16 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
17 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
18 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
19 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
20 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
21 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
22 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
23 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
24 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
25 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
26 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
27 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
28 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
29 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
30 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
48 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
60 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
61 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
62 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
63 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
64 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
65 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
66 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
67 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
68 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
69 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
70 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
71 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
72 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
75 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
76 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
77 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
78 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
79 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
80 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
81 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
82 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
83 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
84 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
85 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
86 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
87 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
88 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
89 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
90 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
91 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
92 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
93 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
94 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
95 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
96 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
97 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
98 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
99 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
100 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
101 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
102 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
103 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
104 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
105 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
106 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
107 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
108 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
109 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
110 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
111 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
112 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
113 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
114 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
115 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
116 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
117 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
118 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
119 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
120 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
121 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
122 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
123 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
124 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
125 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
126 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
127 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
128 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
129 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
130 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
131 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
132 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
133 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
134 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
135 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
136 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
137 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
138 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
162 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
163 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
166 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
169 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
173 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
174 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
175 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
179 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
180 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
181 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
182 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
183 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
184 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
185 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
186 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
187 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.85
Metatranscriptomes 0
Isolates 10.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.54
Nodule 0.31
Rhizoplane 0.62
Rhizosphere 88
Stem 0
Stem Tuber 0
Unclassified 9.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10000303 3300003373 Bacteria 8993
2 Ga0070676_10190764 3300005328 Bacteria 1338
3 Ga0070674_100094595 3300005356 Bacteria 2164
4 Ga0070673_100069023 3300005364 Bacteria 2832
5 Ga0070673_100385240 3300005364 Bacteria 1251
6 Ga0070713_100183012 3300005436 Bacteria 1884
7 Ga0070663_100000056 3300005455 Bacteria 49564
8 Ga0070663_100000655 3300005455 Bacteria 18579
9 Ga0070698_100005027 3300005471 Bacteria 14485
10 Ga0068853_100005003 3300005539 Bacteria 10331
11 Ga0070665_100245538 3300005548 Bacteria 1791
12 Ga0081455_10001431 3300005937 Bacteria 29530
13 Ga0081455_10001651 3300005937 Bacteria 27074
14 Ga0081455_10087115 3300005937 Bacteria 2541
15 Ga0081538_10000236 3300005981 Bacteria 62334
16 Ga0081540_1020956 3300005983 Bacteria 3912
17 Ga0075367_10186666 3300006178 Bacteria 1293
18 Ga0075431_100512865 3300006847 Bacteria 1189
19 Ga0111539_10009996 3300009094 Bacteria 11957
20 Ga0111539_10491261 3300009094 Bacteria 1430
21 Ga0105247_10268843 3300009101 Bacteria 1172
22 Ga0157379_10078782 3300014968 Bacteria 2951
23 Ga0183367_1016 3300015688 Bacteria 290198
24 Ga0207694_10325849 3300025924 Bacteria 1268
25 Ga0207664_10013038 3300025929 Bacteria 5957
26 Ga0207644_10033887 3300025931 Bacteria 3572
27 Ga0207669_10136007 3300025937 Bacteria 1697
28 Ga0207691_10262262 3300025940 Bacteria 1489
29 Ga0207651_10046371 3300025960 Bacteria 2922
30 Ga0207639_10007031 3300026041 Bacteria 7672
31 Ga0207678_10000062 3300026067 Bacteria 84389
32 Ga0207678_10001511 3300026067 Bacteria 21311
33 Ga0207683_10011409 3300026121 Bacteria 7583
34 Ga0207698_10024364 3300026142 Bacteria 4247
35 Ga0207698_10112686 3300026142 Bacteria 2284
36 Ga0268266_10366213 3300028379 Bacteria 1357
37 Ga0307517_10005215 3300028786 Bacteria 19679
38 Ga0307515_10002574 3300028794 Bacteria 39147
39 Ga0307511_10000010 3300030521 Bacteria 146716
40 Ga0307511_10082428 3300030521 Bacteria 2249
41 Ga0307512_10004885 3300030522 Bacteria 14354
42 Ga0307512_10066784 3300030522 Bacteria 2713
43 Ga0307513_10007359 3300031456 Bacteria 14288
44 Ga0307513_10218416 3300031456 Bacteria 1730
45 Ga0307509_10008776 3300031507 Bacteria 12782
46 Ga0307509_10022555 3300031507 Bacteria 7093
47 Ga0307509_10215243 3300031507 Bacteria 1741
48 Ga0307508_10014360 3300031616 Bacteria 7225
49 Ga0307516_10085727 3300031730 Bacteria 2987
50 Ga0307518_10226884 3300031838 Bacteria 1213
51 Ga0307416_100372300 3300032002 Bacteria 1455
52 Ga0307507_10014471 3300033179 Bacteria 9400
53 Ga0307507_10028387 3300033179 Bacteria 5965
54 Ga0307510_10001558 3300033180 Bacteria 25339
55 Ga0307510_10028047 3300033180 Bacteria 6436
56 Ga0307510_10055787 3300033180 Bacteria 4122
57 Ga0373948_0027705 3300034817 Bacteria 1124
58 Ga0373931_0401375 3300035691 Bacteria 868
59 Ga0395900_0402881 3300037418 Bacteria 1332
60 Ga0395898_0428805 3300037466 Bacteria 1260
61 Ga0395901_0361442 3300038443 Bacteria 1497
62 Ga0439448_0005238 3300042005 Bacteria 3693
63 Ga0439454_010223 3300042011 Bacteria 1233
64 Ga0450903_000757 3300042138 Bacteria 6341
65 Ga0439458_0001505 3300042157 Bacteria 5848
66 Ga0439440_0037039 3300042993 Bacteria 1176
67 Ga0466969_0074767 3300044656 Bacteria 1625
68 Ga0466972_0117194 3300044658 Bacteria 1257
69 Ga0466965_0009445 3300044683 Bacteria 4534
70 Ga0466959_0009891 3300045049 Bacteria 6798
71 Ga0466967_0750690 3300045976 Bacteria 968
72 Ga0495592_0086809 3300046454 Bacteria 2252
73 Ga0495603_0005550 3300046455 Bacteria 7528
74 Ga0495629_0001822 3300046459 Bacteria 16694
75 Ga0495629_0046095 3300046459 Bacteria 3058
76 Ga0495629_0304774 3300046459 Bacteria 1090
77 Ga0495629_0308851 3300046459 Bacteria 1082
78 Ga0495651_0005523 3300046462 Bacteria 9641
79 Ga0495580_0202575 3300046472 Bacteria 1367
80 Ga0495582_0038056 3300046473 Bacteria 2646
81 Ga0495605_0003175 3300046474 Bacteria 9878
82 Ga0495664_0001064 3300046477 Bacteria 14191
83 Ga0495585_0043875 3300046492 Bacteria 2499
84 Ga0495594_0107777 3300046499 Bacteria 1569
85 Ga0495607_0056230 3300046501 Bacteria 2260
86 Ga0495583_0019577 3300046506 Bacteria 3529
87 Ga0495606_0022998 3300046507 Bacteria 4529
88 Ga0495608_0046175 3300046511 Bacteria 2900
89 Ga0495616_0004699 3300046513 Bacteria 8561
90 Ga0495618_0136772 3300046514 Bacteria 1567
91 Ga0495620_0005210 3300046515 Bacteria 7276
92 Ga0495628_0046415 3300046516 Bacteria 3450
93 Ga0495628_0438015 3300046516 Bacteria 950
94 Ga0495631_0004818 3300046518 Bacteria 7110
95 Ga0495648_0038396 3300046524 Bacteria 3063
96 Ga0495666_0018135 3300046526 Bacteria 3506
97 Ga0495640_0018638 3300046533 Bacteria 5140
98 Ga0495640_0214310 3300046533 Bacteria 1216
99 Ga0495640_0228530 3300046533 Bacteria 1171
100 Ga0495586_0045633 3300046535 Bacteria 2362
101 Ga0495587_0006015 3300046536 Bacteria 7909
102 Ga0495597_0016951 3300046542 Bacteria 3435
103 Ga0495622_0020726 3300046557 Bacteria 3060
104 Ga0495668_0021751 3300046616 Bacteria 3671
105 Ga0495634_0006757 3300046642 Bacteria 8688
106 Ga0495634_0139063 3300046642 Bacteria 1543
107 Ga0495611_0119958 3300046648 Bacteria 1226
108 Ga0495625_0009121 3300046660 Bacteria 8363
109 Ga0495625_0014429 3300046660 Bacteria 6306
110 Ga0495625_0035553 3300046660 Bacteria 3671
111 Ga0495625_0036954 3300046660 Bacteria 3585
112 Ga0495635_0017937 3300046663 Bacteria 4943
113 Ga0495635_0317411 3300046663 Bacteria 1043
114 Ga0495661_0030643 3300046665 Bacteria 3422
115 Ga0495588_0080805 3300046674 Bacteria 1696
116 Ga0495657_0032555 3300046675 Bacteria 3636
117 Ga0495657_0037234 3300046675 Bacteria 3355
118 Ga0495623_0087974 3300046679 Bacteria 1913
119 Ga0495646_0000204 3300046680 Bacteria 29112
120 Ga0495613_0000570 3300046689 Bacteria 30354
121 Ga0495613_0004169 3300046689 Bacteria 10816
122 Ga0495613_0050597 3300046689 Bacteria 3063
123 Ga0495613_0093128 3300046689 Bacteria 2181
124 Ga0495624_0092916 3300046690 Bacteria 1860
125 Ga0495649_0029082 3300046694 Bacteria 3060
126 Ga0495589_0019894 3300046794 Bacteria 3434
127 Ga0495589_0041091 3300046794 Bacteria 2308
128 Ga0495589_0131180 3300046794 Bacteria 1203
129 Ga0495660_0048293 3300046810 Bacteria 2328
130 Ga0495581_0036835 3300047315 Bacteria 2830
131 Ga0495604_0003537 3300047317 Bacteria 12454
132 Ga0495604_0022464 3300047317 Bacteria 5037
133 Ga0495636_0021959 3300047318 Bacteria 2579
134 Ga0495636_0027228 3300047318 Bacteria 2329
135 Ga0495676_0003951 3300047321 Bacteria 13491
136 Ga0495676_0010621 3300047321 Bacteria 8339
137 Ga0495676_0045617 3300047321 Bacteria 3565
138 Ga0495676_0058551 3300047321 Bacteria 3030
139 Ga0495680_0027204 3300047322 Bacteria 4702
140 Ga0495683_0036850 3300047323 Bacteria 2481
141 Ga0495687_002208 3300047443 Bacteria 16078
142 Ga0495687_003152 3300047443 Bacteria 12291
143 Ga0495687_014443 3300047443 Bacteria 4065
144 Ga0495687_014980 3300047443 Bacteria 3961
145 Ga0495685_005975 3300047447 Bacteria 3976
146 Ga0495685_008490 3300047447 Bacteria 3413
147 Ga0495685_023661 3300047447 Bacteria 2115
148 Ga0495681_0003990 3300047470 Bacteria 10156
149 Ga0495684_0290637 3300047471 Bacteria 1177
150 Ga0495686_0107248 3300047472 Bacteria 1678
151 Ga0495593_0055547 3300047673 Bacteria 2083
152 Ga0495593_0086800 3300047673 Bacteria 1613
153 Ga0495602_0210982 3300048088 Bacteria 1474
154 Ga0495614_0012008 3300048089 Bacteria 3804
155 Ga0495614_0081388 3300048089 Bacteria 1403
156 Ga0495614_0177144 3300048089 Bacteria 958
157 Ga0496110_0223701 3300048913 Bacteria 1712
158 Ga0496111_0230498 3300048914 Bacteria 1376
159 Ga0501031_0000360 3300049568 Bacteria 26525
160 Ga0501031_0425687 3300049568 Bacteria 858
161 Ga0501033_0002712 3300049570 Bacteria 14853
162 Ga0501033_0006097 3300049570 Bacteria 9455
163 Ga0501033_0013842 3300049570 Bacteria 6138
164 Ga0501033_0048172 3300049570 Bacteria 3166
165 Ga0501034_0232705 3300049571 Bacteria 1791
166 Ga0501036_0000811 3300049572 Bacteria 23196
167 Ga0501036_0002196 3300049572 Bacteria 15246
168 Ga0501036_0089563 3300049572 Bacteria 2600
169 Ga0501036_0115372 3300049572 Bacteria 2269
170 Ga0501036_0234314 3300049572 Bacteria 1540
171 Ga0501037_0012669 3300049573 Bacteria 6214
172 Ga0501037_0099496 3300049573 Bacteria 2100
173 Ga0501037_0275637 3300049573 Bacteria 1173
174 Ga0501037_0378616 3300049573 Bacteria 973
175 Ga0501038_0000183 3300049574 Bacteria 53678
176 Ga0501038_0005901 3300049574 Bacteria 11320
177 Ga0501038_0024535 3300049574 Bacteria 5379
178 Ga0501038_0026155 3300049574 Bacteria 5199
179 Ga0501038_0383935 3300049574 Bacteria 1089
180 Ga0501039_0000197 3300049575 Bacteria 43481
181 Ga0501039_0000328 3300049575 Bacteria 33856
182 Ga0501040_0000209 3300049576 Bacteria 34062
183 Ga0501040_0000816 3300049576 Bacteria 19445
184 Ga0501040_0003477 3300049576 Bacteria 10163
185 Ga0501040_0353648 3300049576 Bacteria 1052
186 Ga0501041_0000263 3300049577 Bacteria 24851
187 Ga0501041_0001603 3300049577 Bacteria 12627
188 Ga0501041_0228556 3300049577 Bacteria 1168
189 Ga0501042_0000007 3300049578 Bacteria 63673
190 Ga0501042_0000908 3300049578 Bacteria 16559
191 Ga0501042_0060313 3300049578 Bacteria 2709
192 Ga0501043_0255805 3300049579 Bacteria 1348
193 Ga0501043_0376812 3300049579 Bacteria 1075
194 Ga0501046_0005961 3300049580 Bacteria 10844
195 Ga0501047_0065928 3300049581 Bacteria 3490
196 Ga0501047_0074450 3300049581 Bacteria 3269
197 Ga0501047_0091792 3300049581 Bacteria 2915
198 Ga0501047_0498910 3300049581 Bacteria 1044
199 Ga0501047_0561590 3300049581 Bacteria 965
200 Ga0501048_0000421 3300049582 Bacteria 29745
201 Ga0501048_0028392 3300049582 Bacteria 4060
202 Ga0501068_0001751 3300049584 Bacteria 11542
203 Ga0501068_0047275 3300049584 Bacteria 2596
204 Ga0501068_0074568 3300049584 Bacteria 2074
205 Ga0501070_0008104 3300049586 Bacteria 8892
206 Ga0501070_0027544 3300049586 Bacteria 4767
207 Ga0501070_0054729 3300049586 Bacteria 3309
208 Ga0501071_0000182 3300049587 Bacteria 27901
209 Ga0501071_0002018 3300049587 Bacteria 12145
210 Ga0501071_0029608 3300049587 Bacteria 3866
211 Ga0501071_0104741 3300049587 Bacteria 2088
212 Ga0501072_0000195 3300049588 Bacteria 44197
213 Ga0501072_0001730 3300049588 Bacteria 16273
214 Ga0501072_0002484 3300049588 Bacteria 13811
215 Ga0501072_0026474 3300049588 Bacteria 4522
216 Ga0501072_0118420 3300049588 Bacteria 2110
217 Ga0501072_0138571 3300049588 Bacteria 1940
218 Ga0501072_0159062 3300049588 Bacteria 1802
219 Ga0501073_0006581 3300049589 Bacteria 8646
220 Ga0501073_0014647 3300049589 Bacteria 5697
221 Ga0501073_0072722 3300049589 Bacteria 2395
222 Ga0501074_0003472 3300049590 Bacteria 11187
223 Ga0501074_0012682 3300049590 Bacteria 6128
224 Ga0501074_0062705 3300049590 Bacteria 2677
225 Ga0501074_0094112 3300049590 Bacteria 2146
226 Ga0501075_0000497 3300049591 Bacteria 23584
227 Ga0501075_0002302 3300049591 Bacteria 12679
228 Ga0501075_0065496 3300049591 Bacteria 2742
229 Ga0501075_0082949 3300049591 Bacteria 2428
230 Ga0501075_0138902 3300049591 Bacteria 1851
231 Ga0501076_0000217 3300049592 Bacteria 34870
232 Ga0501076_0005472 3300049592 Bacteria 9143
233 Ga0501076_0032781 3300049592 Bacteria 4056
234 Ga0501076_0068290 3300049592 Bacteria 2839
235 Ga0501077_0001573 3300049593 Bacteria 13752
236 Ga0501077_0004838 3300049593 Bacteria 8182
237 Ga0501077_0008551 3300049593 Bacteria 6343
238 Ga0501077_0018020 3300049593 Bacteria 4463
239 Ga0501077_0033732 3300049593 Bacteria 3258
240 Ga0501077_0125744 3300049593 Bacteria 1625
241 Ga0501079_0000200 3300049741 Bacteria 34694
242 Ga0501079_0003311 3300049741 Bacteria 11812
243 Ga0501079_0005749 3300049741 Bacteria 9271
244 Ga0501079_0177515 3300049741 Bacteria 1661
245 Ga0501080_0012876 3300049742 Bacteria 7675
246 Ga0501080_0015709 3300049742 Bacteria 6981
247 Ga0501080_0338670 3300049742 Bacteria 1359
248 Ga0501081_0000172 3300049743 Bacteria 30389
249 Ga0501081_0001415 3300049743 Bacteria 14670
250 Ga0501081_0041065 3300049743 Bacteria 3167
251 Ga0501081_0141525 3300049743 Bacteria 1724
252 Ga0501083_0016451 3300049744 Bacteria 5177
253 Ga0501083_0105277 3300049744 Bacteria 1858
254 Ga0501035_0015789 3300049822 Bacteria 6971
255 Ga0501035_0023342 3300049822 Bacteria 5673
256 Ga0501035_0033724 3300049822 Bacteria 4654
257 Ga0501035_0148496 3300049822 Bacteria 2035
258 Ga0501035_0215940 3300049822 Bacteria 1639
259 Ga0501035_0252491 3300049822 Bacteria 1497
260 Ga0501035_0492869 3300049822 Bacteria 1009
261 Ga0501035_0679821 3300049822 Bacteria 832
262 Ga0501044_0059178 3300049823 Bacteria 3926
263 Ga0501044_0093162 3300049823 Bacteria 3038
264 Ga0501044_0345858 3300049823 Bacteria 1407
265 Ga0501044_0472772 3300049823 Bacteria 1157
266 Ga0501045_0000015 3300049824 Bacteria 72669
267 Ga0501045_0001961 3300049824 Bacteria 13893
268 Ga0501045_0005230 3300049824 Bacteria 8976
269 Ga0501045_0029608 3300049824 Bacteria 3959
270 nmdc:mga06z11_110047_c1 3300050494 Bacteria 1524
271 nmdc:mga0qj67_155897_c1 3300050509 Bacteria 1853
272 nmdc:mga06r32_608420_c1 3300050510 Bacteria 1063
273 nmdc:mga06r32_800783_c1 3300050510 Bacteria 903
274 nmdc:mga08y16_173859_c1 3300050511 Bacteria 2236
275 Ga0495619_0043725 3300053085 Bacteria 2938
276 Ga0500553_109758 3300053101 Bacteria 1164
277 Ga0500560_003112 3300053107 Bacteria 3301
278 Ga0500600_0131747 3300053149 Bacteria 1272
279 Ga0501084_0000331 3300054114 Bacteria 36157
280 Ga0501084_0000576 3300054114 Bacteria 28065
281 Ga0501084_0001561 3300054114 Bacteria 18181
282 Ga0501084_0019726 3300054114 Bacteria 5618
283 Ga0501082_0000373 3300060353 Bacteria 39570
284 Ga0501082_0004138 3300060353 Bacteria 12673
285 Ga0501082_0008985 3300060353 Bacteria 8624
286 Ga0501082_0026411 3300060353 Bacteria 5004
287 Ga0501082_0118497 3300060353 Bacteria 2293
288 Ga0530510_0001025 3300061734 Bacteria 18494
289 Ga0530510_0001360 3300061734 Bacteria 16343
290 Ga0530510_0002633 3300061734 Bacteria 12332
291 Ga0530510_0104293 3300061734 Bacteria 2074
292 Ga0530510_0145425 3300061734 Bacteria 1749

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049568 Ga0501031_0425687 Ga0501031_0425687_220_828 202
2 3300005937 Ga0081455_10087115 Ga0081455_100871152 212
3 3300046794 Ga0495589_0041091 Ga0495589_0041091_1599_2282 221
4 3300005328 Ga0070676_10190764 Ga0070676_101907642 230
5 3300005356 Ga0070674_100094595 Ga0070674_1000945951 230
6 3300005364 Ga0070673_100385240 Ga0070673_1003852402 230
7 3300025937 Ga0207669_10136007 Ga0207669_101360071 230
8 3300025940 Ga0207691_10262262 Ga0207691_102622622 230
9 iso_pu_bacteria 2867369537 2867375046 230
10 iso_pu_bacteria 2947224130 2947228593 232
11 3300005364 Ga0070673_100069023 Ga0070673_1000690232 233
12 3300025931 Ga0207644_10033887 Ga0207644_100338872 233
13 3300025960 Ga0207651_10046371 Ga0207651_100463712 233
14 3300026142 Ga0207698_10112686 Ga0207698_101126863 233
15 3300049823 Ga0501044_0472772 Ga0501044_0472772_358_1125 233
16 3300049822 Ga0501035_0023342 Ga0501035_0023342_1963_2685 235
17 3300049574 Ga0501038_0383935 Ga0501038_0383935_181_981 236
18 3300049581 Ga0501047_0561590 Ga0501047_0561590_154_954 236
19 3300049822 Ga0501035_0679821 Ga0501035_0679821_44_757 237
20 iso_pu_bacteria 2866612099 2866617912 237
21 3300005548 Ga0070665_100245538 Ga0070665_1002455382 238
22 3300005983 Ga0081540_1020956 Ga0081540_10209563 238
23 3300028379 Ga0268266_10366213 Ga0268266_103662132 238
24 3300049588 Ga0501072_0159062 Ga0501072_0159062_843_1562 239
25 3300049591 Ga0501075_0065496 Ga0501075_0065496_1470_2189 239
26 3300049592 Ga0501076_0068290 Ga0501076_0068290_1639_2358 239
27 3300006178 Ga0075367_10186666 Ga0075367_101866662 240
28 3300049588 Ga0501072_0138571 Ga0501072_0138571_822_1601 240
29 3300050494 nmdc:mga06z11_110047_c1 nmdc:mga06z11_110047_c1_287_1042 240
30 3300044683 Ga0466965_0009445 Ga0466965_0009445_1056_1784 241
31 3300047321 Ga0495676_0058551 Ga0495676_0058551_1573_2373 241
32 3300049568 Ga0501031_0000360 Ga0501031_0000360_15396_16145 241
33 3300049570 Ga0501033_0013842 Ga0501033_0013842_2281_3030 241
34 3300049572 Ga0501036_0000811 Ga0501036_0000811_13369_14118 241
35 3300049573 Ga0501037_0012669 Ga0501037_0012669_3292_4041 241
36 3300049574 Ga0501038_0005901 Ga0501038_0005901_7724_8473 241
37 3300049575 Ga0501039_0000197 Ga0501039_0000197_12907_13656 241
38 3300049576 Ga0501040_0000209 Ga0501040_0000209_15389_16138 241
39 3300049577 Ga0501041_0001603 Ga0501041_0001603_5569_6318 241
40 3300049578 Ga0501042_0000908 Ga0501042_0000908_187_936 241
41 3300049580 Ga0501046_0005961 Ga0501046_0005961_1353_2102 241
42 3300049582 Ga0501048_0000421 Ga0501048_0000421_27898_28647 241
43 3300049586 Ga0501070_0054729 Ga0501070_0054729_1784_2533 241
44 3300049587 Ga0501071_0000182 Ga0501071_0000182_94_843 241
45 3300049588 Ga0501072_0000195 Ga0501072_0000195_39459_40208 241
46 3300049591 Ga0501075_0002302 Ga0501075_0002302_5820_6569 241
47 3300049592 Ga0501076_0000217 Ga0501076_0000217_7307_8056 241
48 3300049593 Ga0501077_0001573 Ga0501077_0001573_6902_7651 241
49 3300049741 Ga0501079_0000200 Ga0501079_0000200_7232_7981 241
50 3300049742 Ga0501080_0012876 Ga0501080_0012876_4718_5467 241
51 3300049743 Ga0501081_0001415 Ga0501081_0001415_13017_13766 241
52 3300049822 Ga0501035_0015789 Ga0501035_0015789_5051_5800 241
53 3300049824 Ga0501045_0005230 Ga0501045_0005230_1257_2006 241
54 3300054114 Ga0501084_0000576 Ga0501084_0000576_11860_12609 241
55 3300060353 Ga0501082_0004138 Ga0501082_0004138_4349_5098 241
56 3300061734 Ga0530510_0001025 Ga0530510_0001025_7071_7820 241
57 3300049581 Ga0501047_0065928 Ga0501047_0065928_2581_3318 242
58 3300037418 Ga0395900_0402881 Ga0395900_0402881_133_951 243
59 3300049571 Ga0501034_0232705 Ga0501034_0232705_752_1486 243
60 3300049572 Ga0501036_0089563 Ga0501036_0089563_1365_2099 243
61 3300049579 Ga0501043_0376812 Ga0501043_0376812_54_788 243
62 3300049581 Ga0501047_0498910 Ga0501047_0498910_10_744 243
63 3300049584 Ga0501068_0001751 Ga0501068_0001751_7692_8426 243
64 3300049586 Ga0501070_0008104 Ga0501070_0008104_1382_2116 243
65 3300049587 Ga0501071_0104741 Ga0501071_0104741_303_1037 243
66 3300049588 Ga0501072_0026474 Ga0501072_0026474_3113_3847 243
67 3300049589 Ga0501073_0006581 Ga0501073_0006581_4001_4735 243
68 3300049589 Ga0501073_0014647 Ga0501073_0014647_3789_4523 243
69 3300049590 Ga0501074_0003472 Ga0501074_0003472_3994_4728 243
70 3300049590 Ga0501074_0012682 Ga0501074_0012682_917_1651 243
71 3300049593 Ga0501077_0004838 Ga0501077_0004838_3871_4605 243
72 3300049742 Ga0501080_0015709 Ga0501080_0015709_2641_3375 243
73 3300049744 Ga0501083_0016451 Ga0501083_0016451_902_1636 243
74 3300060353 Ga0501082_0008985 Ga0501082_0008985_3671_4405 243
75 3300005539 Ga0068853_100005003 Ga0068853_1000050032 245
76 3300025924 Ga0207694_10325849 Ga0207694_103258492 245
77 3300026041 Ga0207639_10007031 Ga0207639_100070312 245
78 3300026142 Ga0207698_10024364 Ga0207698_100243642 245
79 3300049570 Ga0501033_0006097 Ga0501033_0006097_5394_6140 245
80 3300049572 Ga0501036_0002196 Ga0501036_0002196_13495_14241 245
81 3300049574 Ga0501038_0026155 Ga0501038_0026155_1129_1875 245
82 3300049575 Ga0501039_0000328 Ga0501039_0000328_22937_23683 245
83 3300049576 Ga0501040_0000816 Ga0501040_0000816_13380_14126 245
84 3300049577 Ga0501041_0000263 Ga0501041_0000263_9160_9906 245
85 3300049578 Ga0501042_0000007 Ga0501042_0000007_27957_28703 245
86 3300049584 Ga0501068_0074568 Ga0501068_0074568_278_1024 245
87 3300049587 Ga0501071_0002018 Ga0501071_0002018_11322_12068 245
88 3300049588 Ga0501072_0002484 Ga0501072_0002484_11771_12517 245
89 3300049590 Ga0501074_0062705 Ga0501074_0062705_1629_2375 245
90 3300049591 Ga0501075_0000497 Ga0501075_0000497_7753_8499 245
91 3300049592 Ga0501076_0005472 Ga0501076_0005472_1279_2025 245
92 3300049593 Ga0501077_0018020 Ga0501077_0018020_2087_2833 245
93 3300049741 Ga0501079_0003311 Ga0501079_0003311_9541_10287 245
94 3300049743 Ga0501081_0000172 Ga0501081_0000172_1033_1779 245
95 3300049824 Ga0501045_0000015 Ga0501045_0000015_7871_8617 245
96 3300054114 Ga0501084_0000331 Ga0501084_0000331_24794_25540 245
97 3300060353 Ga0501082_0000373 Ga0501082_0000373_9752_10498 245
98 3300061734 Ga0530510_0104293 Ga0530510_0104293_1117_1863 245
99 3300005455 Ga0070663_100000655 Ga0070663_1000006557 246
100 3300026067 Ga0207678_10001511 Ga0207678_100015118 246
101 3300026121 Ga0207683_10011409 Ga0207683_100114094 246
102 3300031456 Ga0307513_10007359 Ga0307513_100073593 246
103 3300032002 Ga0307416_100372300 Ga0307416_1003723002 246
104 3300044656 Ga0466969_0074767 Ga0466969_0074767_264_1253 246
105 3300045976 Ga0466967_0750690 Ga0466967_0750690_47_853 246
106 3300049579 Ga0501043_0255805 Ga0501043_0255805_372_1130 246
107 3300049822 Ga0501035_0492869 Ga0501035_0492869_220_978 246
108 3300049823 Ga0501044_0345858 Ga0501044_0345858_124_882 246
109 3300025929 Ga0207664_10013038 Ga0207664_100130383 247
110 3300044658 Ga0466972_0117194 Ga0466972_0117194_104_847 247
111 3300045049 Ga0466959_0009891 Ga0466959_0009891_874_1617 247
112 3300049570 Ga0501033_0002712 Ga0501033_0002712_13711_14559 247
113 3300049573 Ga0501037_0378616 Ga0501037_0378616_23_802 247
114 3300049576 Ga0501040_0003477 Ga0501040_0003477_8138_8986 247
115 3300049578 Ga0501042_0060313 Ga0501042_0060313_33_881 247
116 3300049582 Ga0501048_0028392 Ga0501048_0028392_165_1013 247
117 3300049587 Ga0501071_0029608 Ga0501071_0029608_1115_1963 247
118 3300049588 Ga0501072_0001730 Ga0501072_0001730_5836_6684 247
119 3300049589 Ga0501073_0072722 Ga0501073_0072722_1130_1978 247
120 3300049593 Ga0501077_0008551 Ga0501077_0008551_295_1143 247
121 3300049741 Ga0501079_0005749 Ga0501079_0005749_4069_4917 247
122 3300049743 Ga0501081_0041065 Ga0501081_0041065_1268_2116 247
123 3300049822 Ga0501035_0033724 Ga0501035_0033724_2733_3581 247
124 3300054114 Ga0501084_0001561 Ga0501084_0001561_1793_2641 247
125 3300061734 Ga0530510_0001360 Ga0530510_0001360_501_1349 247
126 iso_pu_bacteria 2912757875 2912760720 247
127 iso_pu_bacteria 8025530807 8025534647 247
128 3300014968 Ga0157379_10078782 Ga0157379_100787822 248
129 iso_pu_bacteria 2675903059 2676484139 248
130 3300028786 Ga0307517_10005215 Ga0307517_1000521514 249
131 3300028794 Ga0307515_10002574 Ga0307515_100025748 249
132 3300030521 Ga0307511_10000010 Ga0307511_1000001014 249
133 3300030521 Ga0307511_10082428 Ga0307511_100824282 249
134 3300031507 Ga0307509_10008776 Ga0307509_1000877610 249
135 3300031507 Ga0307509_10022555 Ga0307509_100225553 249
136 3300031507 Ga0307509_10215243 Ga0307509_102152432 249
137 3300031730 Ga0307516_10085727 Ga0307516_100857274 249
138 3300031838 Ga0307518_10226884 Ga0307518_102268842 249
139 3300033179 Ga0307507_10014471 Ga0307507_100144714 249
140 3300033179 Ga0307507_10028387 Ga0307507_100283875 249
141 3300033180 Ga0307510_10001558 Ga0307510_1000155810 249
142 3300033180 Ga0307510_10028047 Ga0307510_100280475 249
143 3300033180 Ga0307510_10055787 Ga0307510_100557874 249
144 3300046459 Ga0495629_0001822 Ga0495629_0001822_10737_11519 249
145 3300046660 Ga0495625_0014429 Ga0495625_0014429_4772_5554 249
146 3300046674 Ga0495588_0080805 Ga0495588_0080805_319_1101 249
147 3300047470 Ga0495681_0003990 Ga0495681_0003990_3530_4312 249
148 3300047472 Ga0495686_0107248 Ga0495686_0107248_739_1521 249
149 3300048089 Ga0495614_0012008 Ga0495614_0012008_2180_2962 249
150 3300048913 Ga0496110_0223701 Ga0496110_0223701_805_1557 249
151 3300053107 Ga0500560_003112 Ga0500560_003112_2333_3115 249
152 iso_pu_bacteria 2547132111 2547409283 249
153 iso_pu_bacteria 2582581313 2585303363 249
154 iso_pu_bacteria 2616644814 2616696177 249
155 iso_pu_bacteria 2643221647 2644266688 249
156 iso_pu_bacteria 2784132148 2784592240 249
157 iso_pu_bacteria 2784746768 2785374196 249
158 iso_pu_bacteria 2786546132 2786674432 249
159 iso_pu_bacteria 2808606448 2809235886 249
160 iso_pu_bacteria 2811994917 2812483023 249
161 iso_pu_bacteria 2862281513 2862282806 249
162 iso_pu_bacteria 2862574272 2862576897 249
163 iso_pu_bacteria 2946064051 2946071729 249
164 iso_pu_bacteria 2954380949 2954382097 249
165 iso_pu_bacteria 2954673503 2954680974 249
166 iso_pu_bacteria 2954682443 2954683183 249
167 iso_pu_bacteria 2954691527 2954692911 249
168 iso_pu_bacteria 2954701450 2954707984 249
169 iso_pu_bacteria 2954711539 2954712538 249
170 iso_pu_bacteria 2954721474 2954722493 249
171 iso_pu_bacteria 2954731030 2954739365 249
172 iso_pu_bacteria 2954749733 2954758193 249
173 iso_pu_bacteria 2954759201 2954760388 249
174 iso_pu_bacteria 3002998708 3003007142 249
175 iso_pu_bacteria 8023623736 8023625911 249
176 iso_pu_bacteria 8033684223 8033688934 249
177 3300005455 Ga0070663_100000056 Ga0070663_1000000566 250
178 3300009094 Ga0111539_10009996 Ga0111539_100099969 250
179 3300015688 Ga0183367_1016 Ga0183367_1016151 250
180 3300026067 Ga0207678_10000062 Ga0207678_1000006223 250
181 3300030522 Ga0307512_10004885 Ga0307512_1000488513 250
182 3300030522 Ga0307512_10066784 Ga0307512_100667842 250
183 3300031456 Ga0307513_10218416 Ga0307513_102184161 250
184 3300031616 Ga0307508_10014360 Ga0307508_100143602 250
185 3300034817 Ga0373948_0027705 Ga0373948_0027705_259_1035 250
186 3300035691 Ga0373931_0401375 Ga0373931_0401375_35_811 250
187 3300042005 Ga0439448_0005238 Ga0439448_0005238_1921_2706 250
188 3300042011 Ga0439454_010223 Ga0439454_010223_112_897 250
189 3300042138 Ga0450903_000757 Ga0450903_000757_2138_2923 250
190 3300042157 Ga0439458_0001505 Ga0439458_0001505_1794_2579 250
191 3300046516 Ga0495628_0046415 Ga0495628_0046415_1931_2716 250
192 3300046660 Ga0495625_0035553 Ga0495625_0035553_259_1044 250
193 3300047321 Ga0495676_0045617 Ga0495676_0045617_1236_2036 250
194 3300047447 Ga0495685_008490 Ga0495685_008490_1258_2043 250
195 3300048089 Ga0495614_0081388 Ga0495614_0081388_44_844 250
196 3300048914 Ga0496111_0230498 Ga0496111_0230498_331_1086 250
197 3300049572 Ga0501036_0234314 Ga0501036_0234314_307_1092 250
198 3300049573 Ga0501037_0099496 Ga0501037_0099496_1032_1817 250
199 3300049574 Ga0501038_0000183 Ga0501038_0000183_892_1677 250
200 3300049581 Ga0501047_0091792 Ga0501047_0091792_642_1421 250
201 3300049822 Ga0501035_0215940 Ga0501035_0215940_124_909 250
202 iso_pu_bacteria 3006493962 3006495740 250
203 3300046459 Ga0495629_0304774 Ga0495629_0304774_261_1049 251
204 3300046462 Ga0495651_0005523 Ga0495651_0005523_839_1627 251
205 3300046473 Ga0495582_0038056 Ga0495582_0038056_72_860 251
206 3300046477 Ga0495664_0001064 Ga0495664_0001064_9335_10123 251
207 3300046533 Ga0495640_0228530 Ga0495640_0228530_295_1083 251
208 3300046535 Ga0495586_0045633 Ga0495586_0045633_319_1107 251
209 3300046536 Ga0495587_0006015 Ga0495587_0006015_3245_4033 251
210 3300046642 Ga0495634_0006757 Ga0495634_0006757_6349_7137 251
211 3300046663 Ga0495635_0017937 Ga0495635_0017937_3245_4033 251
212 3300046680 Ga0495646_0000204 Ga0495646_0000204_13060_13848 251
213 3300046689 Ga0495613_0000570 Ga0495613_0000570_16448_17236 251
214 3300046794 Ga0495589_0019894 Ga0495589_0019894_788_1576 251
215 3300046794 Ga0495589_0131180 Ga0495589_0131180_226_1014 251
216 3300047315 Ga0495581_0036835 Ga0495581_0036835_984_1772 251
217 3300047317 Ga0495604_0003537 Ga0495604_0003537_167_955 251
218 3300047318 Ga0495636_0021959 Ga0495636_0021959_1189_1977 251
219 3300047318 Ga0495636_0027228 Ga0495636_0027228_971_1759 251
220 3300047321 Ga0495676_0010621 Ga0495676_0010621_5416_6204 251
221 3300047443 Ga0495687_002208 Ga0495687_002208_4670_5458 251
222 3300047443 Ga0495687_003152 Ga0495687_003152_8174_8962 251
223 3300047447 Ga0495685_023661 Ga0495685_023661_1297_2085 251
224 3300047471 Ga0495684_0290637 Ga0495684_0290637_85_873 251
225 3300047673 Ga0495593_0086800 Ga0495593_0086800_469_1257 251
226 3300048088 Ga0495602_0210982 Ga0495602_0210982_172_960 251
227 3300053085 Ga0495619_0043725 Ga0495619_0043725_1292_2080 251
228 3300053101 Ga0500553_109758 Ga0500553_109758_172_960 251
229 3300046454 Ga0495592_0086809 Ga0495592_0086809_101_892 252
230 3300046455 Ga0495603_0005550 Ga0495603_0005550_3331_4122 252
231 3300046459 Ga0495629_0046095 Ga0495629_0046095_1257_2048 252
232 3300046459 Ga0495629_0308851 Ga0495629_0308851_174_965 252
233 3300046472 Ga0495580_0202575 Ga0495580_0202575_482_1273 252
234 3300046474 Ga0495605_0003175 Ga0495605_0003175_1895_2686 252
235 3300046492 Ga0495585_0043875 Ga0495585_0043875_226_1017 252
236 3300046499 Ga0495594_0107777 Ga0495594_0107777_206_997 252
237 3300046501 Ga0495607_0056230 Ga0495607_0056230_151_942 252
238 3300046506 Ga0495583_0019577 Ga0495583_0019577_1234_2025 252
239 3300046507 Ga0495606_0022998 Ga0495606_0022998_204_995 252
240 3300046511 Ga0495608_0046175 Ga0495608_0046175_1570_2361 252
241 3300046513 Ga0495616_0004699 Ga0495616_0004699_5766_6557 252
242 3300046514 Ga0495618_0136772 Ga0495618_0136772_249_1040 252
243 3300046515 Ga0495620_0005210 Ga0495620_0005210_429_1220 252
244 3300046516 Ga0495628_0438015 Ga0495628_0438015_76_867 252
245 3300046518 Ga0495631_0004818 Ga0495631_0004818_2077_2868 252
246 3300046524 Ga0495648_0038396 Ga0495648_0038396_91_882 252
247 3300046526 Ga0495666_0018135 Ga0495666_0018135_1089_1880 252
248 3300046533 Ga0495640_0018638 Ga0495640_0018638_1187_1978 252
249 3300046533 Ga0495640_0214310 Ga0495640_0214310_150_941 252
250 3300046542 Ga0495597_0016951 Ga0495597_0016951_221_1012 252
251 3300046557 Ga0495622_0020726 Ga0495622_0020726_178_969 252
252 3300046616 Ga0495668_0021751 Ga0495668_0021751_914_1705 252
253 3300046642 Ga0495634_0139063 Ga0495634_0139063_700_1491 252
254 3300046648 Ga0495611_0119958 Ga0495611_0119958_95_886 252
255 3300046660 Ga0495625_0009121 Ga0495625_0009121_1232_2029 252
256 3300046660 Ga0495625_0036954 Ga0495625_0036954_688_1479 252
257 3300046663 Ga0495635_0317411 Ga0495635_0317411_101_892 252
258 3300046665 Ga0495661_0030643 Ga0495661_0030643_2010_2801 252
259 3300046675 Ga0495657_0032555 Ga0495657_0032555_60_851 252
260 3300046675 Ga0495657_0037234 Ga0495657_0037234_906_1697 252
261 3300046679 Ga0495623_0087974 Ga0495623_0087974_867_1658 252
262 3300046689 Ga0495613_0004169 Ga0495613_0004169_94_885 252
263 3300046689 Ga0495613_0050597 Ga0495613_0050597_277_1068 252
264 3300046689 Ga0495613_0093128 Ga0495613_0093128_94_885 252
265 3300046690 Ga0495624_0092916 Ga0495624_0092916_153_944 252
266 3300046694 Ga0495649_0029082 Ga0495649_0029082_2163_2954 252
267 3300046810 Ga0495660_0048293 Ga0495660_0048293_439_1230 252
268 3300047317 Ga0495604_0022464 Ga0495604_0022464_417_1208 252
269 3300047321 Ga0495676_0003951 Ga0495676_0003951_12128_12919 252
270 3300047322 Ga0495680_0027204 Ga0495680_0027204_2015_2806 252
271 3300047323 Ga0495683_0036850 Ga0495683_0036850_1315_2106 252
272 3300047443 Ga0495687_014443 Ga0495687_014443_389_1180 252
273 3300047443 Ga0495687_014980 Ga0495687_014980_2810_3601 252
274 3300047447 Ga0495685_005975 Ga0495685_005975_2810_3601 252
275 3300047673 Ga0495593_0055547 Ga0495593_0055547_1156_1947 252
276 3300048089 Ga0495614_0177144 Ga0495614_0177144_58_849 252
277 3300049581 Ga0501047_0074450 Ga0501047_0074450_1469_2260 252
278 3300049586 Ga0501070_0027544 Ga0501070_0027544_1605_2396 252
279 3300049742 Ga0501080_0338670 Ga0501080_0338670_367_1158 252
280 3300049822 Ga0501035_0148496 Ga0501035_0148496_307_1098 252
281 3300049823 Ga0501044_0059178 Ga0501044_0059178_2494_3285 252
282 3300049823 Ga0501044_0093162 Ga0501044_0093162_973_1764 252
283 3300053149 Ga0500600_0131747 Ga0500600_0131747_218_1015 252
284 3300005436 Ga0070713_100183012 Ga0070713_1001830122 253
285 3300005471 Ga0070698_100005027 Ga0070698_1000050274 253
286 3300009094 Ga0111539_10491261 Ga0111539_104912612 253
287 3300009101 Ga0105247_10268843 Ga0105247_102688432 253
288 3300049570 Ga0501033_0048172 Ga0501033_0048172_2184_2963 253
289 3300049573 Ga0501037_0275637 Ga0501037_0275637_237_1016 253
290 3300049574 Ga0501038_0024535 Ga0501038_0024535_2123_2902 253
291 3300049576 Ga0501040_0353648 Ga0501040_0353648_135_914 253
292 3300049584 Ga0501068_0047275 Ga0501068_0047275_1713_2492 253
293 3300049588 Ga0501072_0118420 Ga0501072_0118420_389_1168 253
294 3300049591 Ga0501075_0138902 Ga0501075_0138902_443_1222 253
295 3300049592 Ga0501076_0032781 Ga0501076_0032781_2083_2862 253
296 3300049593 Ga0501077_0125744 Ga0501077_0125744_185_964 253
297 3300049744 Ga0501083_0105277 Ga0501083_0105277_208_987 253
298 3300049822 Ga0501035_0252491 Ga0501035_0252491_635_1414 253
299 3300049824 Ga0501045_0001961 Ga0501045_0001961_8564_9343 253
300 3300050511 nmdc:mga08y16_173859_c1 nmdc:mga08y16_173859_c1_132_908 253
301 3300054114 Ga0501084_0019726 Ga0501084_0019726_2542_3321 253
302 3300060353 Ga0501082_0118497 Ga0501082_0118497_1336_2115 253
303 3300061734 Ga0530510_0145425 Ga0530510_0145425_220_999 253
304 3300037466 Ga0395898_0428805 Ga0395898_0428805_223_1026 257
305 3300038443 Ga0395901_0361442 Ga0395901_0361442_78_881 257
306 3300005937 Ga0081455_10001431 Ga0081455_1000143115 259
307 3300005937 Ga0081455_10001651 Ga0081455_100016512 259
308 3300006847 Ga0075431_100512865 Ga0075431_1005128652 259
309 3300042993 Ga0439440_0037039 Ga0439440_0037039_289_1068 259
310 3300049572 Ga0501036_0115372 Ga0501036_0115372_961_1740 259
311 3300049577 Ga0501041_0228556 Ga0501041_0228556_145_924 259
312 3300049590 Ga0501074_0094112 Ga0501074_0094112_362_1141 259
313 3300049591 Ga0501075_0082949 Ga0501075_0082949_89_868 259
314 3300049593 Ga0501077_0033732 Ga0501077_0033732_1994_2773 259
315 3300049741 Ga0501079_0177515 Ga0501079_0177515_288_1067 259
316 3300049743 Ga0501081_0141525 Ga0501081_0141525_288_1067 259
317 3300049824 Ga0501045_0029608 Ga0501045_0029608_589_1368 259
318 3300050509 nmdc:mga0qj67_155897_c1 nmdc:mga0qj67_155897_c1_141_920 259
319 3300050510 nmdc:mga06r32_608420_c1 nmdc:mga06r32_608420_c1_81_875 259
320 3300050510 nmdc:mga06r32_800783_c1 nmdc:mga06r32_800783_c1_50_829 259
321 3300060353 Ga0501082_0026411 Ga0501082_0026411_207_1055 259
322 3300061734 Ga0530510_0002633 Ga0530510_0002633_10444_11223 259
323 iso_pu_bacteria 8053945823 8053950236 264
324 3300003373 JGI25407J50210_10000303 JGI25407J50210_100003032 267
325 3300005981 Ga0081538_10000236 Ga0081538_1000023611 267

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

39

222

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9476 29 249
7w7a-assembly2.cif.gz_E heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data 0.9474 30 245
5xu1-assembly1.cif.gz_B structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9467 29 249
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.9464 30 251
7w7b-assembly2.cif.gz_G heme exporter hrtba in complex with protoporphyrin ix containing manganese(iii), high resolution data 0.9456 29 251
ID Description Score Start End Superfamily
af_Q2FUZ1_1_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9693 30 263 3.40.50.300
af_Q2G0D8_1_227_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9642 29 251 3.40.50.300
af_Q2G167_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9498 31 248 3.40.50.300
af_P75957_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9498 27 247 3.40.50.300
5xu1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9476 29 249 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A5C4JFU2-F1-model_v4 ABC transporter ATP-binding protein 0.9942 33 267 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A6B1PVR4-F1-model_v4 deleted 0.987 170 266
AF-A0A5C4JFU2-F1-model_v4 ABC transporter ATP-binding protein 0.9858 33 267 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A0G3GLA2-F1-model_v4 ABC-type antimicrobial peptide transport system, ATPase component 0.9849 29 248 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A328A705-F1-model_v4 ABC transporter ATP-binding protein 0.9722 30 266 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
87.74 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map