F407907
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 325 | 217 | 323 | 299 |
Family's Representative Sequence
| Representative Sequence | 3300034816|Ga0373930_0000376|Ga0373930_0000376_3406_4470 |
| Length | 354 |
| Sequence | LWIDFRAGSVDKFPATRKIDPVSGDSLGFSEAGPSTIHTTMKMKIAILMLAGLLAGPFVSHAQIDTNGLDAKELAQLKKIQDLVSHLHYQQGEIDLKGGLAKLTVPKEFRYLGPDDAETVLVKLWGNPPSDEKMLGLLIPAGVTPLDTNCWVVTIDYGEDGYVKDDDAAKINYTDLLKKMQDGIAENNKARVDKGYPSITLVGWAAPPHYDAATHKLYWAKQLKFEGESSDTLNYSIRMLGRHGVLELNAIAGLNQLPEIDRQTPQILGMVDFKEGNRYADFDPKTDKVAEYGIAALVAGGALAVAAKAGLLKGLWLFILAGKKFIILGAIALAAFFKKLFNRSGKSDGGTPTT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 4 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 14 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 15 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 64 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 65 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 77 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 85 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 86 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 128 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 132 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 133 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 134 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 135 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 136 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 137 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 138 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 139 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 140 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 141 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 142 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 143 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 144 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 145 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 146 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 147 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 148 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 149 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 150 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 151 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 152 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 153 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 154 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 155 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 156 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 157 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 158 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 159 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 160 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 161 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 162 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 163 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 201 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 202 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 203 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 204 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 205 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 217 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.77 |
| Metatranscriptomes | 0.62 |
| Isolates | 0.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.85 |
| Nodule | 0 |
| Rhizoplane | 0.62 |
| Rhizosphere | 91.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.85 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1980541 | 2162886007 | Unclassified | 1632 |
| 2 | MBSR1b_contig_2041644 | 2162886012 | Bacteria | 1414 |
| 3 | MBSR1b_contig_3720924 | 2162886012 | Bacteria | 1390 |
| 4 | JGI24740J21852_10034515 | 3300001979 | Bacteria | 1593 |
| 5 | JGI24739J22299_10002634 | 3300001989 | Bacteria | 6912 |
| 6 | JGI24737J22298_10004283 | 3300001990 | Bacteria | 4984 |
| 7 | JGI24735J21928_10045835 | 3300002067 | Bacteria | 1269 |
| 8 | rootH1_10053517 | 3300003316 | Bacteria | 7420 |
| 9 | rootH2_10113637 | 3300003320 | Bacteria | 10379 |
| 10 | rootH2_10296059 | 3300003320 | Bacteria | 1325 |
| 11 | rootL2_10088397 | 3300003322 | Bacteria | 6404 |
| 12 | rootH1_10057846 | 3300003323 | Bacteria | 2780 |
| 13 | rootH1_10200636 | 3300003323 | Bacteria | 3641 |
| 14 | Ga0006562J51391_1081508 | 3300003578 | Bacteria | 12445 |
| 15 | Ga0006562J51391_1081509 | 3300003578 | Bacteria | 9180 |
| 16 | Ga0065165_1001386 | 3300005262 | Bacteria | 26581 |
| 17 | Ga0065704_10122314 | 3300005289 | Bacteria | 1752 |
| 18 | Ga0065704_10185362 | 3300005289 | Bacteria | 1216 |
| 19 | Ga0065715_10102361 | 3300005293 | Bacteria | 3121 |
| 20 | Ga0065707_10093229 | 3300005295 | Bacteria | 3656 |
| 21 | Ga0070658_10002009 | 3300005327 | Bacteria | 17089 |
| 22 | Ga0070690_100012096 | 3300005330 | Bacteria | 5069 |
| 23 | Ga0070690_100028355 | 3300005330 | Bacteria | 3467 |
| 24 | Ga0070670_100000634 | 3300005331 | Bacteria | 27387 |
| 25 | Ga0070677_10010015 | 3300005333 | Bacteria | 3229 |
| 26 | Ga0070677_10066540 | 3300005333 | Unclassified | 1503 |
| 27 | Ga0068869_100002979 | 3300005334 | Bacteria | 10287 |
| 28 | Ga0070666_10000020 | 3300005335 | Bacteria | 177564 |
| 29 | Ga0070689_100001257 | 3300005340 | Bacteria | 16110 |
| 30 | Ga0070689_100008926 | 3300005340 | Bacteria | 7089 |
| 31 | Ga0070689_100180620 | 3300005340 | Bacteria | 1714 |
| 32 | Ga0070689_100518993 | 3300005340 | Bacteria | 1023 |
| 33 | Ga0070687_100020394 | 3300005343 | Bacteria | 3099 |
| 34 | Ga0070687_100029244 | 3300005343 | Bacteria | 2681 |
| 35 | Ga0070661_100024575 | 3300005344 | Bacteria | 4322 |
| 36 | Ga0070661_100059307 | 3300005344 | Bacteria | 2806 |
| 37 | Ga0070692_10069833 | 3300005345 | Bacteria | 1869 |
| 38 | Ga0070668_100017773 | 3300005347 | Bacteria | 5333 |
| 39 | Ga0070668_100042108 | 3300005347 | Bacteria | 3500 |
| 40 | Ga0070669_100001273 | 3300005353 | Bacteria | 18290 |
| 41 | Ga0070669_100022985 | 3300005353 | Bacteria | 4460 |
| 42 | Ga0070669_100047408 | 3300005353 | Bacteria | 3134 |
| 43 | Ga0070669_100170625 | 3300005353 | Bacteria | 1696 |
| 44 | Ga0070675_100014402 | 3300005354 | Bacteria | 6235 |
| 45 | Ga0070675_100055474 | 3300005354 | Bacteria | 3262 |
| 46 | Ga0070671_100169237 | 3300005355 | Bacteria | 1848 |
| 47 | Ga0070674_100137813 | 3300005356 | Bacteria | 1828 |
| 48 | Ga0070673_100023783 | 3300005364 | Bacteria | 4481 |
| 49 | Ga0070673_100370451 | 3300005364 | Bacteria | 1275 |
| 50 | Ga0070688_100096052 | 3300005365 | Bacteria | 1946 |
| 51 | Ga0070688_100265713 | 3300005365 | Bacteria | 1227 |
| 52 | Ga0070667_100012349 | 3300005367 | Bacteria | 7064 |
| 53 | Ga0070701_10003458 | 3300005438 | Bacteria | 6257 |
| 54 | Ga0070705_100008831 | 3300005440 | Bacteria | 4994 |
| 55 | Ga0070700_100045976 | 3300005441 | Bacteria | 2695 |
| 56 | Ga0070694_100121801 | 3300005444 | Bacteria | 1872 |
| 57 | Ga0070663_100024471 | 3300005455 | Bacteria | 4065 |
| 58 | Ga0070678_100307501 | 3300005456 | Bacteria | 1349 |
| 59 | Ga0070678_100381021 | 3300005456 | Bacteria | 1220 |
| 60 | Ga0070662_100134102 | 3300005457 | Bacteria | 1913 |
| 61 | Ga0068867_100000265 | 3300005459 | Bacteria | 34503 |
| 62 | Ga0068867_100005276 | 3300005459 | Bacteria | 9129 |
| 63 | Ga0070672_100024782 | 3300005543 | Bacteria | 4440 |
| 64 | Ga0070672_100028071 | 3300005543 | Bacteria | 4205 |
| 65 | Ga0070686_100005051 | 3300005544 | Bacteria | 7286 |
| 66 | Ga0070665_100220689 | 3300005548 | Bacteria | 1896 |
| 67 | Ga0070704_100003130 | 3300005549 | Bacteria | 9435 |
| 68 | Ga0068855_100007621 | 3300005563 | Bacteria | 13091 |
| 69 | Ga0070664_100009953 | 3300005564 | Bacteria | 7707 |
| 70 | Ga0068857_100000349 | 3300005577 | Bacteria | 31928 |
| 71 | Ga0068857_100013697 | 3300005577 | Bacteria | 7067 |
| 72 | Ga0068857_100605260 | 3300005577 | Unclassified | 1036 |
| 73 | Ga0068857_100605722 | 3300005577 | Unclassified | 1036 |
| 74 | Ga0068856_100000446 | 3300005614 | Bacteria | 45656 |
| 75 | Ga0070702_100024780 | 3300005615 | Bacteria | 3205 |
| 76 | Ga0068852_100348040 | 3300005616 | Bacteria | 1446 |
| 77 | Ga0068859_100008542 | 3300005617 | Bacteria | 10360 |
| 78 | Ga0068859_100036466 | 3300005617 | Unclassified | 4936 |
| 79 | Ga0068864_100014978 | 3300005618 | Bacteria | 6445 |
| 80 | Ga0068861_100000656 | 3300005719 | Bacteria | 20542 |
| 81 | Ga0068861_100051861 | 3300005719 | Bacteria | 3116 |
| 82 | Ga0068870_10000727 | 3300005840 | Bacteria | 12656 |
| 83 | Ga0068870_10086864 | 3300005840 | Bacteria | 1740 |
| 84 | Ga0068863_100192147 | 3300005841 | Unclassified | 1962 |
| 85 | Ga0068863_100409365 | 3300005841 | Bacteria | 1327 |
| 86 | Ga0068858_100019789 | 3300005842 | Bacteria | 6292 |
| 87 | Ga0068858_100054700 | 3300005842 | Bacteria | 3691 |
| 88 | Ga0068860_100000171 | 3300005843 | Bacteria | 106956 |
| 89 | Ga0068860_100053382 | 3300005843 | Bacteria | 3843 |
| 90 | Ga0068860_100067513 | 3300005843 | Bacteria | 3398 |
| 91 | Ga0068860_100099093 | 3300005843 | Bacteria | 2779 |
| 92 | Ga0068860_100291391 | 3300005843 | Bacteria | 1597 |
| 93 | Ga0068862_100003025 | 3300005844 | Bacteria | 14650 |
| 94 | Ga0068862_100145414 | 3300005844 | Bacteria | 2107 |
| 95 | Ga0068862_100215473 | 3300005844 | Bacteria | 1736 |
| 96 | Ga0068862_100363675 | 3300005844 | Bacteria | 1345 |
| 97 | Ga0075428_100072711 | 3300006844 | Bacteria | 3756 |
| 98 | Ga0075431_100013816 | 3300006847 | Bacteria | 8153 |
| 99 | Ga0075429_100049068 | 3300006880 | Bacteria | 3671 |
| 100 | Ga0075429_100281922 | 3300006880 | Bacteria | 1455 |
| 101 | Ga0068865_100025586 | 3300006881 | Unclassified | 3884 |
| 102 | Ga0068865_100093125 | 3300006881 | Bacteria | 2190 |
| 103 | Ga0097620_100008541 | 3300006931 | Bacteria | 10360 |
| 104 | Ga0097620_100036465 | 3300006931 | Unclassified | 4936 |
| 105 | Ga0105250_10106474 | 3300009092 | Bacteria | 1146 |
| 106 | Ga0105240_10000179 | 3300009093 | Bacteria | 128695 |
| 107 | Ga0105240_10000546 | 3300009093 | Bacteria | 69544 |
| 108 | Ga0105240_10039168 | 3300009093 | Bacteria | 6072 |
| 109 | Ga0111539_10007666 | 3300009094 | Bacteria | 13794 |
| 110 | Ga0111539_10199813 | 3300009094 | Bacteria | 2331 |
| 111 | Ga0105243_10098584 | 3300009148 | Bacteria | 2421 |
| 112 | Ga0105242_10026775 | 3300009176 | Bacteria | 4572 |
| 113 | Ga0105237_10000095 | 3300009545 | Bacteria | 121776 |
| 114 | Ga0105238_10000325 | 3300009551 | Bacteria | 52092 |
| 115 | Ga0105238_10073112 | 3300009551 | Bacteria | 3424 |
| 116 | Ga0105249_10001223 | 3300009553 | Bacteria | 22627 |
| 117 | Ga0105239_10004189 | 3300010375 | Bacteria | 17328 |
| 118 | Ga0105239_10013742 | 3300010375 | Bacteria | 8988 |
| 119 | Ga0157314_1000023 | 3300012500 | Bacteria | 15046 |
| 120 | Ga0163162_10000547 | 3300013306 | Bacteria | 34748 |
| 121 | Ga0163162_10251239 | 3300013306 | Bacteria | 1900 |
| 122 | Ga0163162_10444841 | 3300013306 | Bacteria | 1428 |
| 123 | Ga0157375_10005873 | 3300013308 | Bacteria | 10687 |
| 124 | Ga0163163_10016160 | 3300014325 | Bacteria | 6928 |
| 125 | Ga0163163_10270457 | 3300014325 | Bacteria | 1751 |
| 126 | Ga0157380_10068016 | 3300014326 | Bacteria | 2870 |
| 127 | Ga0157380_10207806 | 3300014326 | Bacteria | 1742 |
| 128 | Ga0157380_10402203 | 3300014326 | Bacteria | 1300 |
| 129 | Ga0157376_10024366 | 3300014969 | Bacteria | 4749 |
| 130 | Ga0209566_101305 | 3300025225 | Bacteria | 8112 |
| 131 | Ga0209672_102099 | 3300025228 | Bacteria | 5357 |
| 132 | Ga0209646_1002605 | 3300025246 | Bacteria | 3889 |
| 133 | Ga0209129_1001730 | 3300025258 | Bacteria | 11757 |
| 134 | Ga0209758_1001867 | 3300025297 | Bacteria | 23104 |
| 135 | Ga0207653_10007964 | 3300025885 | Bacteria | 3302 |
| 136 | Ga0207682_10043273 | 3300025893 | Bacteria | 1843 |
| 137 | Ga0207688_10214171 | 3300025901 | Bacteria | 1158 |
| 138 | Ga0207680_10000001 | 3300025903 | Bacteria | 1091453 |
| 139 | Ga0207647_10010621 | 3300025904 | Bacteria | 6493 |
| 140 | Ga0207647_10091222 | 3300025904 | Bacteria | 1817 |
| 141 | Ga0207645_10016323 | 3300025907 | Bacteria | 4917 |
| 142 | Ga0207643_10002234 | 3300025908 | Bacteria | 10559 |
| 143 | Ga0207643_10019622 | 3300025908 | Bacteria | 3706 |
| 144 | Ga0207695_10000265 | 3300025913 | Bacteria | 132524 |
| 145 | Ga0207695_10000640 | 3300025913 | Bacteria | 69743 |
| 146 | Ga0207695_10005609 | 3300025913 | Bacteria | 16578 |
| 147 | Ga0207695_10016318 | 3300025913 | Bacteria | 8695 |
| 148 | Ga0207671_10000026 | 3300025914 | Bacteria | 268845 |
| 149 | Ga0207662_10004201 | 3300025918 | Bacteria | 7548 |
| 150 | Ga0207662_10035446 | 3300025918 | Bacteria | 2914 |
| 151 | Ga0207649_10023933 | 3300025920 | Bacteria | 3543 |
| 152 | Ga0207681_10003910 | 3300025923 | Bacteria | 9243 |
| 153 | Ga0207681_10187190 | 3300025923 | Bacteria | 1581 |
| 154 | Ga0207694_10000598 | 3300025924 | Bacteria | 32619 |
| 155 | Ga0207694_10013222 | 3300025924 | Bacteria | 6214 |
| 156 | Ga0207694_10014836 | 3300025924 | Bacteria | 5875 |
| 157 | Ga0207650_10006089 | 3300025925 | Bacteria | 8225 |
| 158 | Ga0207659_10039592 | 3300025926 | Bacteria | 3289 |
| 159 | Ga0207659_10064254 | 3300025926 | Bacteria | 2655 |
| 160 | Ga0207644_10034868 | 3300025931 | Bacteria | 3522 |
| 161 | Ga0207686_10015941 | 3300025934 | Bacteria | 4211 |
| 162 | Ga0207709_10027259 | 3300025935 | Bacteria | 3289 |
| 163 | Ga0207670_10001058 | 3300025936 | Bacteria | 14511 |
| 164 | Ga0207670_10281922 | 3300025936 | Bacteria | 1295 |
| 165 | Ga0207670_10444641 | 3300025936 | Bacteria | 1044 |
| 166 | Ga0207704_10060441 | 3300025938 | Bacteria | 2344 |
| 167 | Ga0207704_10153631 | 3300025938 | Bacteria | 1628 |
| 168 | Ga0207691_10037243 | 3300025940 | Bacteria | 4506 |
| 169 | Ga0207691_10144868 | 3300025940 | Bacteria | 2092 |
| 170 | Ga0207691_10153037 | 3300025940 | Bacteria | 2027 |
| 171 | Ga0207689_10014592 | 3300025942 | Bacteria | 6679 |
| 172 | Ga0207679_10009936 | 3300025945 | Bacteria | 6111 |
| 173 | Ga0207679_10030502 | 3300025945 | Bacteria | 3766 |
| 174 | Ga0207667_10001558 | 3300025949 | Bacteria | 28860 |
| 175 | Ga0207667_10002239 | 3300025949 | Bacteria | 24309 |
| 176 | Ga0207667_10028073 | 3300025949 | Bacteria | 6114 |
| 177 | Ga0207651_10057029 | 3300025960 | Bacteria | 2691 |
| 178 | Ga0207651_10391354 | 3300025960 | Bacteria | 1180 |
| 179 | Ga0207712_10003831 | 3300025961 | Bacteria | 9497 |
| 180 | Ga0207668_10028362 | 3300025972 | Bacteria | 3660 |
| 181 | Ga0207668_10058755 | 3300025972 | Bacteria | 2690 |
| 182 | Ga0207640_10000025 | 3300025981 | Bacteria | 143903 |
| 183 | Ga0207640_10230155 | 3300025981 | Bacteria | 1425 |
| 184 | Ga0207677_10370578 | 3300026023 | Bacteria | 1206 |
| 185 | Ga0207703_10026790 | 3300026035 | Bacteria | 4541 |
| 186 | Ga0207703_10152401 | 3300026035 | Unclassified | 2017 |
| 187 | Ga0207703_10381128 | 3300026035 | Bacteria | 1304 |
| 188 | Ga0207678_10050791 | 3300026067 | Bacteria | 3582 |
| 189 | Ga0207678_10109774 | 3300026067 | Bacteria | 2353 |
| 190 | Ga0207708_10016480 | 3300026075 | Bacteria | 5557 |
| 191 | Ga0207708_10054421 | 3300026075 | Bacteria | 3051 |
| 192 | Ga0207708_10129726 | 3300026075 | Bacteria | 1970 |
| 193 | Ga0207702_10016155 | 3300026078 | Bacteria | 6180 |
| 194 | Ga0207702_10089044 | 3300026078 | Bacteria | 2698 |
| 195 | Ga0207641_10173035 | 3300026088 | Unclassified | 1972 |
| 196 | Ga0207648_10000844 | 3300026089 | Bacteria | 34567 |
| 197 | Ga0207648_10012977 | 3300026089 | Bacteria | 7776 |
| 198 | Ga0207676_10101193 | 3300026095 | Bacteria | 2389 |
| 199 | Ga0207676_10173578 | 3300026095 | Bacteria | 1880 |
| 200 | Ga0207674_10000553 | 3300026116 | Bacteria | 48913 |
| 201 | Ga0207674_10020527 | 3300026116 | Bacteria | 7135 |
| 202 | Ga0207675_100002554 | 3300026118 | Bacteria | 18027 |
| 203 | Ga0207675_100040789 | 3300026118 | Bacteria | 4335 |
| 204 | Ga0207683_10041693 | 3300026121 | Bacteria | 4009 |
| 205 | Ga0207683_10137042 | 3300026121 | Bacteria | 2203 |
| 206 | Ga0207683_10156914 | 3300026121 | Bacteria | 2056 |
| 207 | Ga0207683_10427415 | 3300026121 | Bacteria | 1220 |
| 208 | Ga0207698_10068136 | 3300026142 | Bacteria | 2809 |
| 209 | Ga0207428_10000562 | 3300027907 | Bacteria | 43846 |
| 210 | Ga0268266_10000067 | 3300028379 | Bacteria | 241577 |
| 211 | Ga0268265_10000103 | 3300028380 | Bacteria | 106177 |
| 212 | Ga0268264_10000453 | 3300028381 | Bacteria | 55983 |
| 213 | Ga0268264_10127722 | 3300028381 | Bacteria | 2249 |
| 214 | Ga0268264_10163511 | 3300028381 | Bacteria | 2007 |
| 215 | Ga0268264_10172816 | 3300028381 | Bacteria | 1955 |
| 216 | Ga0265319_1039809 | 3300028563 | Bacteria | 1591 |
| 217 | Ga0307517_10135965 | 3300028786 | Bacteria | 1748 |
| 218 | Ga0265338_10000263 | 3300028800 | Bacteria | 95638 |
| 219 | Ga0265338_10044743 | 3300028800 | Unclassified | 4081 |
| 220 | Ga0265338_10097315 | 3300028800 | Bacteria | 2411 |
| 221 | Ga0265324_10016114 | 3300029957 | Bacteria | 2736 |
| 222 | Ga0265324_10069619 | 3300029957 | Unclassified | 1199 |
| 223 | Ga0265320_10000375 | 3300031240 | Bacteria | 36376 |
| 224 | Ga0265320_10003450 | 3300031240 | Bacteria | 10630 |
| 225 | Ga0265320_10056655 | 3300031240 | Bacteria | 1882 |
| 226 | Ga0265325_10094599 | 3300031241 | Bacteria | 1469 |
| 227 | Ga0265327_10000571 | 3300031251 | Bacteria | 62622 |
| 228 | Ga0265316_10066465 | 3300031344 | Bacteria | 2790 |
| 229 | Ga0265316_10148092 | 3300031344 | Bacteria | 1760 |
| 230 | Ga0265342_10084631 | 3300031712 | Bacteria | 1826 |
| 231 | Ga0307510_10004025 | 3300033180 | Bacteria | 17232 |
| 232 | Ga0373930_0000376 | 3300034816 | Bacteria | 5849 |
| 233 | Ga0373928_0000122 | 3300035084 | Bacteria | 14457 |
| 234 | Ga0373929_0003661 | 3300035085 | Bacteria | 2757 |
| 235 | Ga0373940_0018929 | 3300035088 | Bacteria | 1733 |
| 236 | Ga0373944_0000161 | 3300035089 | Bacteria | 13384 |
| 237 | Ga0373951_0002331 | 3300035091 | Bacteria | 4817 |
| 238 | Ga0373932_0000001 | 3300035112 | Bacteria | 1459067 |
| 239 | Ga0373945_0025362 | 3300035116 | Bacteria | 2059 |
| 240 | Ga0373962_0000013 | 3300035242 | Bacteria | 49373 |
| 241 | Ga0373931_0000002 | 3300035691 | Bacteria | 599830 |
| 242 | Ga0373927_0019194 | 3300035695 | Bacteria | 4483 |
| 243 | Ga0373925_0003063 | 3300037068 | Bacteria | 13135 |
| 244 | Ga0373925_0011613 | 3300037068 | Bacteria | 6372 |
| 245 | Ga0395905_0148856 | 3300037471 | Bacteria | 2202 |
| 246 | Ga0466972_0040418 | 3300044658 | Bacteria | 2272 |
| 247 | Ga0466982_0000015 | 3300044672 | Bacteria | 131281 |
| 248 | Ga0466964_0002947 | 3300044706 | Bacteria | 6148 |
| 249 | Ga0466971_0002321 | 3300044719 | Bacteria | 8054 |
| 250 | Ga0466968_0051288 | 3300044735 | Bacteria | 1762 |
| 251 | Ga0466970_0026887 | 3300044765 | Bacteria | 3016 |
| 252 | Ga0466957_0048535 | 3300044842 | Bacteria | 2581 |
| 253 | Ga0466960_0014798 | 3300044901 | Bacteria | 3350 |
| 254 | Ga0451576_0469011 | 3300045051 | Unclassified | 1322 |
| 255 | Ga0495603_0006732 | 3300046455 | Bacteria | 6899 |
| 256 | Ga0495638_0001562 | 3300046460 | Bacteria | 20538 |
| 257 | Ga0495638_0001917 | 3300046460 | Bacteria | 17910 |
| 258 | Ga0495653_0014584 | 3300046463 | Bacteria | 6414 |
| 259 | Ga0495650_0000092 | 3300046471 | Bacteria | 224681 |
| 260 | Ga0495650_0000743 | 3300046471 | Bacteria | 40889 |
| 261 | Ga0495582_0223760 | 3300046473 | Bacteria | 1077 |
| 262 | Ga0495584_0001206 | 3300046491 | Bacteria | 15841 |
| 263 | Ga0495585_0000808 | 3300046492 | Bacteria | 27257 |
| 264 | Ga0495585_0001739 | 3300046492 | Bacteria | 16585 |
| 265 | Ga0495585_0002267 | 3300046492 | Bacteria | 13909 |
| 266 | Ga0495594_0105830 | 3300046499 | Bacteria | 1584 |
| 267 | Ga0495596_0003672 | 3300046500 | Bacteria | 7679 |
| 268 | Ga0495606_0000633 | 3300046507 | Bacteria | 55270 |
| 269 | Ga0495606_0001530 | 3300046507 | Bacteria | 30598 |
| 270 | Ga0495606_0065604 | 3300046507 | Bacteria | 2306 |
| 271 | Ga0495616_0005219 | 3300046513 | Bacteria | 8031 |
| 272 | Ga0495628_0050720 | 3300046516 | Unclassified | 3282 |
| 273 | Ga0495630_0024462 | 3300046517 | Unclassified | 4465 |
| 274 | Ga0495652_0038393 | 3300046529 | Bacteria | 4149 |
| 275 | Ga0495640_0020001 | 3300046533 | Unclassified | 4934 |
| 276 | Ga0495609_0007429 | 3300046538 | Bacteria | 5476 |
| 277 | Ga0495597_0125535 | 3300046542 | Bacteria | 1067 |
| 278 | Ga0495645_0009099 | 3300046543 | Bacteria | 6939 |
| 279 | Ga0495633_0001748 | 3300046558 | Bacteria | 16146 |
| 280 | Ga0495633_0010254 | 3300046558 | Bacteria | 5126 |
| 281 | Ga0495667_0018009 | 3300046559 | Unclassified | 4771 |
| 282 | Ga0495634_0136056 | 3300046642 | Unclassified | 1563 |
| 283 | Ga0495634_0190206 | 3300046642 | Bacteria | 1280 |
| 284 | Ga0495625_0018703 | 3300046660 | Bacteria | 5398 |
| 285 | Ga0495625_0023244 | 3300046660 | Bacteria | 4737 |
| 286 | Ga0495625_0078474 | 3300046660 | Bacteria | 2305 |
| 287 | Ga0495635_0034203 | 3300046663 | Unclassified | 3525 |
| 288 | Ga0495659_0012154 | 3300046664 | Bacteria | 2784 |
| 289 | Ga0495661_0000028 | 3300046665 | Bacteria | 182191 |
| 290 | Ga0495661_0019633 | 3300046665 | Bacteria | 4425 |
| 291 | Ga0495657_0143165 | 3300046675 | Unclassified | 1489 |
| 292 | Ga0495599_0010322 | 3300046678 | Bacteria | 5713 |
| 293 | Ga0495613_0075375 | 3300046689 | Bacteria | 2456 |
| 294 | Ga0495670_0008351 | 3300046691 | Bacteria | 5090 |
| 295 | Ga0495649_0039701 | 3300046694 | Bacteria | 2580 |
| 296 | Ga0495636_0026873 | 3300047318 | Bacteria | 2343 |
| 297 | Ga0495674_0040403 | 3300047319 | Unclassified | 4172 |
| 298 | Ga0495680_0027727 | 3300047322 | Unclassified | 4648 |
| 299 | Ga0495683_0000224 | 3300047323 | Bacteria | 53121 |
| 300 | Ga0495675_0016723 | 3300047444 | Unclassified | 4639 |
| 301 | Ga0495684_0016969 | 3300047471 | Bacteria | 5609 |
| 302 | Ga0495602_0008316 | 3300048088 | Bacteria | 10845 |
| 303 | Ga0496115_0001179 | 3300048918 | Bacteria | 18754 |
| 304 | Ga0496115_0015051 | 3300048918 | Bacteria | 5863 |
| 305 | Ga0496118_0204858 | 3300048921 | Unclassified | 1164 |
| 306 | Ga0496121_0245959 | 3300048924 | Bacteria | 1243 |
| 307 | Ga0496125_0001992 | 3300048928 | Bacteria | 27698 |
| 308 | Ga0496125_0024842 | 3300048928 | Bacteria | 5499 |
| 309 | Ga0496126_0067684 | 3300048929 | Bacteria | 3190 |
| 310 | Ga0496126_0073960 | 3300048929 | Bacteria | 3027 |
| 311 | Ga0495678_024373 | 3300049459 | Bacteria | 2613 |
| 312 | Ga0495682_0018715 | 3300049460 | Bacteria | 2609 |
| 313 | Ga0501031_0000149 | 3300049568 | Bacteria | 39446 |
| 314 | Ga0501032_0029030 | 3300049569 | Bacteria | 3799 |
| 315 | Ga0501033_0004956 | 3300049570 | Bacteria | 10589 |
| 316 | Ga0501037_0077925 | 3300049573 | Unclassified | 2405 |
| 317 | Ga0501044_0000281 | 3300049823 | Bacteria | 64762 |
| 318 | nmdc:mga09592_51954_c1 | 3300050508 | Bacteria | 3458 |
| 319 | nmdc:mga0qj67_37187_c1 | 3300050509 | Unclassified | 3812 |
| 320 | nmdc:mga06r32_66430_c1 | 3300050510 | Bacteria | 3480 |
| 321 | nmdc:mga08y16_1714_c1 | 3300050511 | Bacteria | 22252 |
| 322 | Ga0500559_0009906 | 3300053136 | Bacteria | 4106 |
| 323 | Ga0466962_0007938 | 3300061719 | Bacteria | 5089 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025228 | Ga0209672_102099 | Ga0209672_1020993 | 264 |
| 2 | 3300009551 | Ga0105238_10073112 | Ga0105238_100731122 | 273 |
| 3 | 3300031240 | Ga0265320_10000375 | Ga0265320_1000037523 | 274 |
| 4 | 3300046460 | Ga0495638_0001562 | Ga0495638_0001562_7855_8766 | 275 |
| 5 | 3300005340 | Ga0070689_100008926 | Ga0070689_1000089266 | 276 |
| 6 | 3300005344 | Ga0070661_100059307 | Ga0070661_1000593072 | 276 |
| 7 | 3300005843 | Ga0068860_100053382 | Ga0068860_1000533823 | 276 |
| 8 | 3300005844 | Ga0068862_100215473 | Ga0068862_1002154731 | 276 |
| 9 | 3300013306 | Ga0163162_10444841 | Ga0163162_104448412 | 276 |
| 10 | 3300014969 | Ga0157376_10024366 | Ga0157376_100243663 | 276 |
| 11 | 3300025225 | Ga0209566_101305 | Ga0209566_10130510 | 276 |
| 12 | 3300025246 | Ga0209646_1002605 | Ga0209646_10026051 | 276 |
| 13 | 3300025936 | Ga0207670_10001058 | Ga0207670_1000105812 | 276 |
| 14 | 3300026067 | Ga0207678_10109774 | Ga0207678_101097741 | 276 |
| 15 | 3300046460 | Ga0495638_0001917 | Ga0495638_0001917_5956_6867 | 276 |
| 16 | 3300046471 | Ga0495650_0000092 | Ga0495650_0000092_151656_152567 | 276 |
| 17 | 3300046507 | Ga0495606_0001530 | Ga0495606_0001530_13065_13976 | 276 |
| 18 | 3300046542 | Ga0495597_0125535 | Ga0495597_0125535_56_967 | 276 |
| 19 | 3300046660 | Ga0495625_0018703 | Ga0495625_0018703_4368_5279 | 276 |
| 20 | 3300046660 | Ga0495625_0078474 | Ga0495625_0078474_465_1376 | 276 |
| 21 | 3300046694 | Ga0495649_0039701 | Ga0495649_0039701_543_1454 | 276 |
| 22 | 3300048918 | Ga0496115_0001179 | Ga0496115_0001179_12082_12993 | 276 |
| 23 | 3300048918 | Ga0496115_0015051 | Ga0496115_0015051_4045_4956 | 276 |
| 24 | 3300048924 | Ga0496121_0245959 | Ga0496121_0245959_38_949 | 276 |
| 25 | 3300048929 | Ga0496126_0067684 | Ga0496126_0067684_1705_2616 | 276 |
| 26 | 3300001979 | JGI24740J21852_10034515 | JGI24740J21852_100345151 | 277 |
| 27 | 3300001989 | JGI24739J22299_10002634 | JGI24739J22299_100026345 | 277 |
| 28 | 3300001990 | JGI24737J22298_10004283 | JGI24737J22298_100042835 | 277 |
| 29 | 3300002067 | JGI24735J21928_10045835 | JGI24735J21928_100458352 | 277 |
| 30 | 3300003578 | Ga0006562J51391_1081508 | Ga0006562J51391_10815089 | 277 |
| 31 | 3300003578 | Ga0006562J51391_1081509 | Ga0006562J51391_10815094 | 277 |
| 32 | 3300005455 | Ga0070663_100024471 | Ga0070663_1000244712 | 277 |
| 33 | 3300005577 | Ga0068857_100000349 | Ga0068857_10000034926 | 277 |
| 34 | 3300005616 | Ga0068852_100348040 | Ga0068852_1003480401 | 277 |
| 35 | 3300005842 | Ga0068858_100019789 | Ga0068858_1000197895 | 277 |
| 36 | 3300009093 | Ga0105240_10039168 | Ga0105240_100391684 | 277 |
| 37 | 3300009545 | Ga0105237_10000095 | Ga0105237_1000009585 | 277 |
| 38 | 3300010375 | Ga0105239_10004189 | Ga0105239_1000418914 | 277 |
| 39 | 3300012500 | Ga0157314_1000023 | Ga0157314_100002311 | 277 |
| 40 | 3300025258 | Ga0209129_1001730 | Ga0209129_10017301 | 277 |
| 41 | 3300025297 | Ga0209758_1001867 | Ga0209758_100186711 | 277 |
| 42 | 3300025904 | Ga0207647_10010621 | Ga0207647_100106215 | 277 |
| 43 | 3300025913 | Ga0207695_10005609 | Ga0207695_100056093 | 277 |
| 44 | 3300025914 | Ga0207671_10000026 | Ga0207671_1000002636 | 277 |
| 45 | 3300025945 | Ga0207679_10030502 | Ga0207679_100305022 | 277 |
| 46 | 3300025949 | Ga0207667_10001558 | Ga0207667_100015587 | 277 |
| 47 | 3300026035 | Ga0207703_10381128 | Ga0207703_103811282 | 277 |
| 48 | 3300026116 | Ga0207674_10000553 | Ga0207674_1000055336 | 277 |
| 49 | 3300026142 | Ga0207698_10068136 | Ga0207698_100681362 | 277 |
| 50 | 3300048928 | Ga0496125_0001992 | Ga0496125_0001992_23514_24440 | 277 |
| 51 | 3300003323 | rootH1_10057846 | rootH1_100578463 | 280 |
| 52 | 3300025913 | Ga0207695_10016318 | Ga0207695_100163184 | 280 |
| 53 | 3300025949 | Ga0207667_10002239 | Ga0207667_100022397 | 280 |
| 54 | 3300025981 | Ga0207640_10000025 | Ga0207640_1000002585 | 280 |
| 55 | 3300028786 | Ga0307517_10135965 | Ga0307517_101359652 | 281 |
| 56 | 3300005617 | Ga0068859_100036466 | Ga0068859_1000364662 | 282 |
| 57 | 3300005842 | Ga0068858_100054700 | Ga0068858_1000547002 | 282 |
| 58 | 3300006931 | Ga0097620_100036465 | Ga0097620_1000364655 | 282 |
| 59 | 3300014325 | Ga0163163_10016160 | Ga0163163_100161603 | 282 |
| 60 | 3300026035 | Ga0207703_10026790 | Ga0207703_100267902 | 283 |
| 61 | 3300031241 | Ga0265325_10094599 | Ga0265325_100945991 | 283 |
| 62 | 3300035695 | Ga0373927_0019194 | Ga0373927_0019194_627_1544 | 285 |
| 63 | 3300037068 | Ga0373925_0011613 | Ga0373925_0011613_781_1698 | 285 |
| 64 | 3300006847 | Ga0075431_100013816 | Ga0075431_1000138164 | 287 |
| 65 | 3300031344 | Ga0265316_10066465 | Ga0265316_100664654 | 287 |
| 66 | 3300031712 | Ga0265342_10084631 | Ga0265342_100846312 | 287 |
| 67 | 3300050509 | nmdc:mga0qj67_37187_c1 | nmdc:mga0qj67_37187_c1_702_1604 | 287 |
| 68 | 3300050510 | nmdc:mga06r32_66430_c1 | nmdc:mga06r32_66430_c1_1188_2090 | 287 |
| 69 | iso_pu_bacteria | 2739367700 | 2739732734 | 288 |
| 70 | iso_pu_bacteria | 2884411467 | 2884412941 | 289 |
| 71 | 3300005327 | Ga0070658_10002009 | Ga0070658_1000200912 | 291 |
| 72 | 3300005335 | Ga0070666_10000020 | Ga0070666_1000002076 | 291 |
| 73 | 3300005344 | Ga0070661_100024575 | Ga0070661_1000245752 | 291 |
| 74 | 3300005347 | Ga0070668_100017773 | Ga0070668_1000177732 | 291 |
| 75 | 3300005367 | Ga0070667_100012349 | Ga0070667_1000123494 | 291 |
| 76 | 3300005456 | Ga0070678_100307501 | Ga0070678_1003075012 | 291 |
| 77 | 3300005577 | Ga0068857_100605260 | Ga0068857_1006052601 | 291 |
| 78 | 3300005841 | Ga0068863_100409365 | Ga0068863_1004093652 | 291 |
| 79 | 3300005843 | Ga0068860_100067513 | Ga0068860_1000675132 | 291 |
| 80 | 3300005844 | Ga0068862_100363675 | Ga0068862_1003636751 | 291 |
| 81 | 3300009092 | Ga0105250_10106474 | Ga0105250_101064742 | 291 |
| 82 | 3300009551 | Ga0105238_10000325 | Ga0105238_1000032549 | 291 |
| 83 | 3300013306 | Ga0163162_10000547 | Ga0163162_1000054712 | 291 |
| 84 | 3300025903 | Ga0207680_10000001 | Ga0207680_10000001880 | 291 |
| 85 | 3300025920 | Ga0207649_10023933 | Ga0207649_100239332 | 291 |
| 86 | 3300025924 | Ga0207694_10000598 | Ga0207694_1000059832 | 291 |
| 87 | 3300025972 | Ga0207668_10028362 | Ga0207668_100283622 | 291 |
| 88 | 3300026121 | Ga0207683_10156914 | Ga0207683_101569142 | 291 |
| 89 | 3300028379 | Ga0268266_10000067 | Ga0268266_10000067146 | 291 |
| 90 | 3300028381 | Ga0268264_10172816 | Ga0268264_101728162 | 291 |
| 91 | 3300033180 | Ga0307510_10004025 | Ga0307510_1000402511 | 291 |
| 92 | 3300046471 | Ga0495650_0000743 | Ga0495650_0000743_22757_23653 | 291 |
| 93 | 3300046492 | Ga0495585_0000808 | Ga0495585_0000808_2441_3325 | 291 |
| 94 | 3300046507 | Ga0495606_0065604 | Ga0495606_0065604_133_1029 | 291 |
| 95 | 3300046660 | Ga0495625_0023244 | Ga0495625_0023244_2897_3793 | 291 |
| 96 | 3300046665 | Ga0495661_0000028 | Ga0495661_0000028_141760_142644 | 291 |
| 97 | 3300048928 | Ga0496125_0024842 | Ga0496125_0024842_2976_3872 | 291 |
| 98 | 3300048929 | Ga0496126_0073960 | Ga0496126_0073960_1551_2447 | 291 |
| 99 | 3300046463 | Ga0495653_0014584 | Ga0495653_0014584_1719_2606 | 292 |
| 100 | 3300046507 | Ga0495606_0000633 | Ga0495606_0000633_1707_2594 | 292 |
| 101 | 3300049459 | Ga0495678_024373 | Ga0495678_024373_557_1444 | 292 |
| 102 | 3300005330 | Ga0070690_100028355 | Ga0070690_1000283553 | 293 |
| 103 | 3300005331 | Ga0070670_100000634 | Ga0070670_10000063421 | 293 |
| 104 | 3300005333 | Ga0070677_10010015 | Ga0070677_100100151 | 293 |
| 105 | 3300005333 | Ga0070677_10066540 | Ga0070677_100665402 | 293 |
| 106 | 3300005334 | Ga0068869_100002979 | Ga0068869_1000029794 | 293 |
| 107 | 3300005340 | Ga0070689_100518993 | Ga0070689_1005189931 | 293 |
| 108 | 3300005343 | Ga0070687_100020394 | Ga0070687_1000203943 | 293 |
| 109 | 3300005353 | Ga0070669_100047408 | Ga0070669_1000474082 | 293 |
| 110 | 3300005355 | Ga0070671_100169237 | Ga0070671_1001692372 | 293 |
| 111 | 3300005356 | Ga0070674_100137813 | Ga0070674_1001378132 | 293 |
| 112 | 3300005364 | Ga0070673_100023783 | Ga0070673_1000237832 | 293 |
| 113 | 3300005365 | Ga0070688_100265713 | Ga0070688_1002657131 | 293 |
| 114 | 3300005459 | Ga0068867_100005276 | Ga0068867_1000052764 | 293 |
| 115 | 3300005543 | Ga0070672_100028071 | Ga0070672_1000280714 | 293 |
| 116 | 3300005564 | Ga0070664_100009953 | Ga0070664_1000099533 | 293 |
| 117 | 3300005615 | Ga0070702_100024780 | Ga0070702_1000247803 | 293 |
| 118 | 3300005719 | Ga0068861_100051861 | Ga0068861_1000518613 | 293 |
| 119 | 3300005840 | Ga0068870_10086864 | Ga0068870_100868642 | 293 |
| 120 | 3300005843 | Ga0068860_100000171 | Ga0068860_10000017140 | 293 |
| 121 | 3300005843 | Ga0068860_100099093 | Ga0068860_1000990932 | 293 |
| 122 | 3300006881 | Ga0068865_100093125 | Ga0068865_1000931252 | 293 |
| 123 | 3300009148 | Ga0105243_10098584 | Ga0105243_100985842 | 293 |
| 124 | 3300009176 | Ga0105242_10026775 | Ga0105242_100267754 | 293 |
| 125 | 3300014326 | Ga0157380_10068016 | Ga0157380_100680162 | 293 |
| 126 | 3300014326 | Ga0157380_10207806 | Ga0157380_102078062 | 293 |
| 127 | 3300025893 | Ga0207682_10043273 | Ga0207682_100432732 | 293 |
| 128 | 3300025901 | Ga0207688_10214171 | Ga0207688_102141712 | 293 |
| 129 | 3300025907 | Ga0207645_10016323 | Ga0207645_100163233 | 293 |
| 130 | 3300025918 | Ga0207662_10035446 | Ga0207662_100354462 | 293 |
| 131 | 3300025925 | Ga0207650_10006089 | Ga0207650_100060899 | 293 |
| 132 | 3300025931 | Ga0207644_10034868 | Ga0207644_100348684 | 293 |
| 133 | 3300025934 | Ga0207686_10015941 | Ga0207686_100159412 | 293 |
| 134 | 3300025935 | Ga0207709_10027259 | Ga0207709_100272593 | 293 |
| 135 | 3300025936 | Ga0207670_10444641 | Ga0207670_104446411 | 293 |
| 136 | 3300025938 | Ga0207704_10060441 | Ga0207704_100604412 | 293 |
| 137 | 3300025940 | Ga0207691_10144868 | Ga0207691_101448682 | 293 |
| 138 | 3300025942 | Ga0207689_10014592 | Ga0207689_100145924 | 293 |
| 139 | 3300025945 | Ga0207679_10009936 | Ga0207679_100099367 | 293 |
| 140 | 3300025960 | Ga0207651_10057029 | Ga0207651_100570293 | 293 |
| 141 | 3300025981 | Ga0207640_10230155 | Ga0207640_102301552 | 293 |
| 142 | 3300026075 | Ga0207708_10016480 | Ga0207708_100164803 | 293 |
| 143 | 3300026089 | Ga0207648_10012977 | Ga0207648_100129776 | 293 |
| 144 | 3300026095 | Ga0207676_10101193 | Ga0207676_101011932 | 293 |
| 145 | 3300026118 | Ga0207675_100040789 | Ga0207675_1000407893 | 293 |
| 146 | 3300026121 | Ga0207683_10041693 | Ga0207683_100416931 | 293 |
| 147 | 3300026121 | Ga0207683_10137042 | Ga0207683_101370421 | 293 |
| 148 | 3300028381 | Ga0268264_10000453 | Ga0268264_1000045340 | 293 |
| 149 | 3300028381 | Ga0268264_10163511 | Ga0268264_101635112 | 293 |
| 150 | 3300005340 | Ga0070689_100180620 | Ga0070689_1001806202 | 294 |
| 151 | 3300005353 | Ga0070669_100170625 | Ga0070669_1001706252 | 294 |
| 152 | 3300005354 | Ga0070675_100014402 | Ga0070675_1000144023 | 294 |
| 153 | 3300005364 | Ga0070673_100370451 | Ga0070673_1003704511 | 294 |
| 154 | 3300005548 | Ga0070665_100220689 | Ga0070665_1002206892 | 294 |
| 155 | 3300005844 | Ga0068862_100145414 | Ga0068862_1001454142 | 294 |
| 156 | 3300009094 | Ga0111539_10199813 | Ga0111539_101998133 | 294 |
| 157 | 3300014325 | Ga0163163_10270457 | Ga0163163_102704572 | 294 |
| 158 | 3300014326 | Ga0157380_10402203 | Ga0157380_104022032 | 294 |
| 159 | 3300025908 | Ga0207643_10019622 | Ga0207643_100196223 | 294 |
| 160 | 3300025923 | Ga0207681_10187190 | Ga0207681_101871902 | 294 |
| 161 | 3300025926 | Ga0207659_10064254 | Ga0207659_100642543 | 294 |
| 162 | 3300025936 | Ga0207670_10281922 | Ga0207670_102819222 | 294 |
| 163 | 3300025940 | Ga0207691_10037243 | Ga0207691_100372432 | 294 |
| 164 | 3300025960 | Ga0207651_10391354 | Ga0207651_103913542 | 294 |
| 165 | 3300026035 | Ga0207703_10152401 | Ga0207703_101524012 | 294 |
| 166 | 3300005353 | Ga0070669_100022985 | Ga0070669_1000229855 | 295 |
| 167 | 3300005841 | Ga0068863_100192147 | Ga0068863_1001921472 | 295 |
| 168 | 3300006880 | Ga0075429_100281922 | Ga0075429_1002819222 | 295 |
| 169 | 3300026067 | Ga0207678_10050791 | Ga0207678_100507911 | 295 |
| 170 | 3300026088 | Ga0207641_10173035 | Ga0207641_101730352 | 295 |
| 171 | 3300031344 | Ga0265316_10148092 | Ga0265316_101480922 | 295 |
| 172 | 3300046491 | Ga0495584_0001206 | Ga0495584_0001206_4579_5514 | 295 |
| 173 | 3300046492 | Ga0495585_0001739 | Ga0495585_0001739_10753_11688 | 295 |
| 174 | 3300046492 | Ga0495585_0002267 | Ga0495585_0002267_5222_6157 | 295 |
| 175 | 3300046500 | Ga0495596_0003672 | Ga0495596_0003672_4883_5818 | 295 |
| 176 | 3300046513 | Ga0495616_0005219 | Ga0495616_0005219_3519_4454 | 295 |
| 177 | 3300046538 | Ga0495609_0007429 | Ga0495609_0007429_2015_2950 | 295 |
| 178 | 3300046558 | Ga0495633_0001748 | Ga0495633_0001748_10759_11694 | 295 |
| 179 | 3300046558 | Ga0495633_0010254 | Ga0495633_0010254_3496_4431 | 295 |
| 180 | 3300046642 | Ga0495634_0190206 | Ga0495634_0190206_301_1212 | 295 |
| 181 | 3300046665 | Ga0495661_0019633 | Ga0495661_0019633_1779_2714 | 295 |
| 182 | 3300046691 | Ga0495670_0008351 | Ga0495670_0008351_1911_2846 | 295 |
| 183 | 3300047323 | Ga0495683_0000224 | Ga0495683_0000224_33736_34671 | 295 |
| 184 | 3300049460 | Ga0495682_0018715 | Ga0495682_0018715_999_1934 | 295 |
| 185 | 3300049568 | Ga0501031_0000149 | Ga0501031_0000149_13647_14588 | 295 |
| 186 | 3300049569 | Ga0501032_0029030 | Ga0501032_0029030_1347_2288 | 295 |
| 187 | 3300049570 | Ga0501033_0004956 | Ga0501033_0004956_779_1720 | 295 |
| 188 | 3300049573 | Ga0501037_0077925 | Ga0501037_0077925_1263_2204 | 295 |
| 189 | 3300049823 | Ga0501044_0000281 | Ga0501044_0000281_16230_17171 | 295 |
| 190 | 3300003320 | rootH2_10113637 | rootH2_1011363710 | 296 |
| 191 | 3300005456 | Ga0070678_100381021 | Ga0070678_1003810211 | 296 |
| 192 | 3300025924 | Ga0207694_10013222 | Ga0207694_100132225 | 296 |
| 193 | 3300026023 | Ga0207677_10370578 | Ga0207677_103705781 | 296 |
| 194 | 3300026078 | Ga0207702_10089044 | Ga0207702_100890442 | 296 |
| 195 | 3300026121 | Ga0207683_10427415 | Ga0207683_104274151 | 296 |
| 196 | 3300028563 | Ga0265319_1039809 | Ga0265319_10398092 | 296 |
| 197 | 3300028800 | Ga0265338_10097315 | Ga0265338_100973152 | 296 |
| 198 | 3300031240 | Ga0265320_10056655 | Ga0265320_100566555 | 296 |
| 199 | 3300003316 | rootH1_10053517 | rootH1_100535173 | 297 |
| 200 | 3300003322 | rootL2_10088397 | rootL2_100883978 | 297 |
| 201 | 3300003323 | rootH1_10200636 | rootH1_102006362 | 297 |
| 202 | 3300005262 | Ga0065165_1001386 | Ga0065165_10013862 | 297 |
| 203 | 3300009093 | Ga0105240_10000179 | Ga0105240_1000017955 | 297 |
| 204 | 3300025913 | Ga0207695_10000265 | Ga0207695_1000026570 | 297 |
| 205 | 3300037471 | Ga0395905_0148856 | Ga0395905_0148856_1134_2069 | 297 |
| 206 | 3300044658 | Ga0466972_0040418 | Ga0466972_0040418_706_1632 | 297 |
| 207 | 3300044672 | Ga0466982_0000015 | Ga0466982_0000015_29467_30393 | 297 |
| 208 | 3300044706 | Ga0466964_0002947 | Ga0466964_0002947_1515_2441 | 297 |
| 209 | 3300044719 | Ga0466971_0002321 | Ga0466971_0002321_5670_6596 | 297 |
| 210 | 3300044735 | Ga0466968_0051288 | Ga0466968_0051288_585_1511 | 297 |
| 211 | 3300044765 | Ga0466970_0026887 | Ga0466970_0026887_2080_3006 | 297 |
| 212 | 3300044842 | Ga0466957_0048535 | Ga0466957_0048535_188_1114 | 297 |
| 213 | 3300044901 | Ga0466960_0014798 | Ga0466960_0014798_1284_2210 | 297 |
| 214 | 3300048921 | Ga0496118_0204858 | Ga0496118_0204858_210_1133 | 297 |
| 215 | 3300061719 | Ga0466962_0007938 | Ga0466962_0007938_3665_4591 | 297 |
| 216 | 3300006844 | Ga0075428_100072711 | Ga0075428_1000727114 | 298 |
| 217 | 3300046664 | Ga0495659_0012154 | Ga0495659_0012154_1426_2322 | 298 |
| 218 | 3300047318 | Ga0495636_0026873 | Ga0495636_0026873_976_1872 | 298 |
| 219 | 3300005544 | Ga0070686_100005051 | Ga0070686_1000050513 | 299 |
| 220 | 3300025924 | Ga0207694_10014836 | Ga0207694_100148367 | 299 |
| 221 | 3300028800 | Ga0265338_10000263 | Ga0265338_1000026323 | 299 |
| 222 | 3300028800 | Ga0265338_10044743 | Ga0265338_100447433 | 299 |
| 223 | 3300029957 | Ga0265324_10069619 | Ga0265324_100696191 | 299 |
| 224 | 3300031240 | Ga0265320_10003450 | Ga0265320_100034504 | 299 |
| 225 | 3300003320 | rootH2_10296059 | rootH2_102960591 | 300 |
| 226 | 3300005289 | Ga0065704_10185362 | Ga0065704_101853622 | 300 |
| 227 | 3300005295 | Ga0065707_10093229 | Ga0065707_100932294 | 300 |
| 228 | 3300005330 | Ga0070690_100012096 | Ga0070690_1000120965 | 300 |
| 229 | 3300005340 | Ga0070689_100001257 | Ga0070689_1000012577 | 300 |
| 230 | 3300005343 | Ga0070687_100029244 | Ga0070687_1000292443 | 300 |
| 231 | 3300005345 | Ga0070692_10069833 | Ga0070692_100698332 | 300 |
| 232 | 3300005347 | Ga0070668_100042108 | Ga0070668_1000421082 | 300 |
| 233 | 3300005353 | Ga0070669_100001273 | Ga0070669_10000127310 | 300 |
| 234 | 3300005354 | Ga0070675_100055474 | Ga0070675_1000554742 | 300 |
| 235 | 3300005365 | Ga0070688_100096052 | Ga0070688_1000960522 | 300 |
| 236 | 3300005438 | Ga0070701_10003458 | Ga0070701_100034585 | 300 |
| 237 | 3300005440 | Ga0070705_100008831 | Ga0070705_1000088314 | 300 |
| 238 | 3300005441 | Ga0070700_100045976 | Ga0070700_1000459762 | 300 |
| 239 | 3300005444 | Ga0070694_100121801 | Ga0070694_1001218012 | 300 |
| 240 | 3300005457 | Ga0070662_100134102 | Ga0070662_1001341023 | 300 |
| 241 | 3300005459 | Ga0068867_100000265 | Ga0068867_10000026527 | 300 |
| 242 | 3300005543 | Ga0070672_100024782 | Ga0070672_1000247824 | 300 |
| 243 | 3300005549 | Ga0070704_100003130 | Ga0070704_1000031304 | 300 |
| 244 | 3300005577 | Ga0068857_100013697 | Ga0068857_1000136972 | 300 |
| 245 | 3300005617 | Ga0068859_100008542 | Ga0068859_1000085425 | 300 |
| 246 | 3300005618 | Ga0068864_100014978 | Ga0068864_1000149783 | 300 |
| 247 | 3300005719 | Ga0068861_100000656 | Ga0068861_10000065610 | 300 |
| 248 | 3300005840 | Ga0068870_10000727 | Ga0068870_100007276 | 300 |
| 249 | 3300005843 | Ga0068860_100291391 | Ga0068860_1002913911 | 300 |
| 250 | 3300005844 | Ga0068862_100003025 | Ga0068862_10000302510 | 300 |
| 251 | 3300006880 | Ga0075429_100049068 | Ga0075429_1000490682 | 300 |
| 252 | 3300006881 | Ga0068865_100025586 | Ga0068865_1000255865 | 300 |
| 253 | 3300006931 | Ga0097620_100008541 | Ga0097620_1000085417 | 300 |
| 254 | 3300009094 | Ga0111539_10007666 | Ga0111539_1000766613 | 300 |
| 255 | 3300009553 | Ga0105249_10001223 | Ga0105249_1000122319 | 300 |
| 256 | 3300013306 | Ga0163162_10251239 | Ga0163162_102512392 | 300 |
| 257 | 3300013308 | Ga0157375_10005873 | Ga0157375_100058735 | 300 |
| 258 | 3300025885 | Ga0207653_10007964 | Ga0207653_100079641 | 300 |
| 259 | 3300025904 | Ga0207647_10091222 | Ga0207647_100912223 | 300 |
| 260 | 3300025908 | Ga0207643_10002234 | Ga0207643_100022345 | 300 |
| 261 | 3300025918 | Ga0207662_10004201 | Ga0207662_100042017 | 300 |
| 262 | 3300025923 | Ga0207681_10003910 | Ga0207681_100039107 | 300 |
| 263 | 3300025926 | Ga0207659_10039592 | Ga0207659_100395922 | 300 |
| 264 | 3300025938 | Ga0207704_10153631 | Ga0207704_101536313 | 300 |
| 265 | 3300025940 | Ga0207691_10153037 | Ga0207691_101530372 | 300 |
| 266 | 3300025961 | Ga0207712_10003831 | Ga0207712_100038313 | 300 |
| 267 | 3300025972 | Ga0207668_10058755 | Ga0207668_100587553 | 300 |
| 268 | 3300026075 | Ga0207708_10054421 | Ga0207708_100544212 | 300 |
| 269 | 3300026089 | Ga0207648_10000844 | Ga0207648_1000084426 | 300 |
| 270 | 3300026095 | Ga0207676_10173578 | Ga0207676_101735782 | 300 |
| 271 | 3300026116 | Ga0207674_10020527 | Ga0207674_100205276 | 300 |
| 272 | 3300026118 | Ga0207675_100002554 | Ga0207675_1000025547 | 300 |
| 273 | 3300027907 | Ga0207428_10000562 | Ga0207428_1000056224 | 300 |
| 274 | 3300028380 | Ga0268265_10000103 | Ga0268265_1000010398 | 300 |
| 275 | 3300028381 | Ga0268264_10127722 | Ga0268264_101277223 | 300 |
| 276 | 3300029957 | Ga0265324_10016114 | Ga0265324_100161143 | 300 |
| 277 | 3300046455 | Ga0495603_0006732 | Ga0495603_0006732_335_1261 | 300 |
| 278 | 3300046473 | Ga0495582_0223760 | Ga0495582_0223760_115_1041 | 300 |
| 279 | 3300046499 | Ga0495594_0105830 | Ga0495594_0105830_565_1491 | 300 |
| 280 | 3300046516 | Ga0495628_0050720 | Ga0495628_0050720_102_1028 | 300 |
| 281 | 3300046517 | Ga0495630_0024462 | Ga0495630_0024462_1222_2148 | 300 |
| 282 | 3300046529 | Ga0495652_0038393 | Ga0495652_0038393_805_1731 | 300 |
| 283 | 3300046533 | Ga0495640_0020001 | Ga0495640_0020001_1683_2609 | 300 |
| 284 | 3300046543 | Ga0495645_0009099 | Ga0495645_0009099_1555_2481 | 300 |
| 285 | 3300046559 | Ga0495667_0018009 | Ga0495667_0018009_1447_2373 | 300 |
| 286 | 3300046642 | Ga0495634_0136056 | Ga0495634_0136056_398_1324 | 300 |
| 287 | 3300046663 | Ga0495635_0034203 | Ga0495635_0034203_1802_2728 | 300 |
| 288 | 3300046675 | Ga0495657_0143165 | Ga0495657_0143165_378_1304 | 300 |
| 289 | 3300046678 | Ga0495599_0010322 | Ga0495599_0010322_241_1167 | 300 |
| 290 | 3300046689 | Ga0495613_0075375 | Ga0495613_0075375_685_1611 | 300 |
| 291 | 3300047319 | Ga0495674_0040403 | Ga0495674_0040403_2258_3184 | 300 |
| 292 | 3300047322 | Ga0495680_0027727 | Ga0495680_0027727_2346_3272 | 300 |
| 293 | 3300047444 | Ga0495675_0016723 | Ga0495675_0016723_2172_3098 | 300 |
| 294 | 3300047471 | Ga0495684_0016969 | Ga0495684_0016969_102_1028 | 300 |
| 295 | 3300048088 | Ga0495602_0008316 | Ga0495602_0008316_5677_6603 | 300 |
| 296 | 3300050508 | nmdc:mga09592_51954_c1 | nmdc:mga09592_51954_c1_859_1776 | 300 |
| 297 | 3300050511 | nmdc:mga08y16_1714_c1 | nmdc:mga08y16_1714_c1_12425_13342 | 300 |
| 298 | 2162886012 | MBSR1b_contig_2041644 | MBSR1b_0660.00003580 | 302 |
| 299 | 2162886012 | MBSR1b_contig_3720924 | MBSR1b_0915.00001500 | 302 |
| 300 | 3300005293 | Ga0065715_10102361 | Ga0065715_101023612 | 302 |
| 301 | 3300009093 | Ga0105240_10000546 | Ga0105240_1000054639 | 302 |
| 302 | 3300010375 | Ga0105239_10013742 | Ga0105239_100137423 | 302 |
| 303 | 3300025913 | Ga0207695_10000640 | Ga0207695_1000064040 | 302 |
| 304 | 3300005563 | Ga0068855_100007621 | Ga0068855_1000076212 | 303 |
| 305 | 3300005577 | Ga0068857_100605722 | Ga0068857_1006057221 | 303 |
| 306 | 3300005614 | Ga0068856_100000446 | Ga0068856_10000044618 | 303 |
| 307 | 3300025949 | Ga0207667_10028073 | Ga0207667_100280733 | 303 |
| 308 | 3300026078 | Ga0207702_10016155 | Ga0207702_100161553 | 303 |
| 309 | 3300035088 | Ga0373940_0018929 | Ga0373940_0018929_24_968 | 303 |
| 310 | 3300026075 | Ga0207708_10129726 | Ga0207708_101297261 | 304 |
| 311 | 3300031251 | Ga0265327_10000571 | Ga0265327_1000057137 | 304 |
| 312 | 3300005289 | Ga0065704_10122314 | Ga0065704_101223142 | 305 |
| 313 | 3300045051 | Ga0451576_0469011 | Ga0451576_0469011_294_1211 | 305 |
| 314 | 3300053136 | Ga0500559_0009906 | Ga0500559_0009906_3050_4009 | 305 |
| 315 | 3300034816 | Ga0373930_0000376 | Ga0373930_0000376_3406_4470 | 328 |
| 316 | 3300035084 | Ga0373928_0000122 | Ga0373928_0000122_2831_3895 | 328 |
| 317 | 3300035085 | Ga0373929_0003661 | Ga0373929_0003661_412_1476 | 328 |
| 318 | 3300035089 | Ga0373944_0000161 | Ga0373944_0000161_9704_10768 | 328 |
| 319 | 3300035091 | Ga0373951_0002331 | Ga0373951_0002331_2561_3625 | 328 |
| 320 | 3300035112 | Ga0373932_0000001 | Ga0373932_0000001_1257805_1258869 | 328 |
| 321 | 3300035116 | Ga0373945_0025362 | Ga0373945_0025362_481_1545 | 328 |
| 322 | 3300035242 | Ga0373962_0000013 | Ga0373962_0000013_13119_14183 | 328 |
| 323 | 3300035691 | Ga0373931_0000002 | Ga0373931_0000002_236529_237593 | 328 |
| 324 | 3300037068 | Ga0373925_0003063 | Ga0373925_0003063_8115_9179 | 328 |
| 325 | 2162886007 | SwRhRL2b_contig_1980541 | SwRhRL2b_0422.00002660 | 349 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5tsh-assembly1.cif.gz_E | pilb from geobacter metallireducens bound to amp-pnp | 0.6981 | 209 | 255 |
| 4n7s-assembly2.cif.gz_D | crystal structure of tse3-tsi3 complex with zinc ion | 0.6731 | 90 | 272 |
| 3g0k-assembly1.cif.gz_A-2 | crystal structure of a protein of unknown function with a cystatin-like fold (saro_2880) from novosphingobium aromaticivorans dsm at 1.30 a resolution | 0.6719 | 187 | 251 |
| 4luq-assembly2.cif.gz_D | crystal structure of virulence effector tse3 in complex with neutralizer tsi3 | 0.6691 | 84 | 272 |
| 7onx-assembly1.cif.gz_A | crystal structure of pbp3 from p. aeruginosa | 0.6675 | 213 | 251 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4I937_6_264_3.70.10.10 | Alpha Beta;Box;Proliferating Cell Nuclear Antigen; | 0.7678 | 214 | 251 | 3.70.10.10 |
| af_P45759_80_213_3.30.450.90 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase; | 0.7365 | 209 | 249 | 3.30.450.90 |
| af_Q21351_28_147_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.7099 | 195 | 255 | 3.10.450.50 |
| af_F1QX66_321_559_2.120.10.30 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.707 | 199 | 247 | 2.120.10.30 |
| 3g0kA00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.6872 | 187 | 252 | 3.10.450.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6M6BE11-F1-model_v4 | DUF2167 domain-containing protein | 0.9494 | 81 | 237 |
|
| AF-A0A4Q6DQC4-F1-model_v4 | deleted | 0.9473 | 62 | 290 |
|
| AF-A0A6M6BE11-F1-model_v4 | DUF2167 domain-containing protein | 0.9318 | 81 | 237 |
|
| AF-A0A379K4J8-F1-model_v4 | Uncharacterized membrane-anchored protein conserved in bacteria | 0.9074 | 61 | 274 |
|
| AF-A0A7C9I017-F1-model_v4 | DUF2167 domain-containing protein | 0.8984 | 85 | 319 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar