F407907

General Info

Members Datasets Scaffolds Average Seq Length
325 217 323 299

Family's Representative Sequence

Representative Sequence 3300034816|Ga0373930_0000376|Ga0373930_0000376_3406_4470
Length 354
Sequence LWIDFRAGSVDKFPATRKIDPVSGDSLGFSEAGPSTIHTTMKMKIAILMLAGLLAGPFVSHAQIDTNGLDAKELAQLKKIQDLVSHLHYQQGEIDLKGGLAKLTVPKEFRYLGPDDAETVLVKLWGNPPSDEKMLGLLIPAGVTPLDTNCWVVTIDYGEDGYVKDDDAAKINYTDLLKKMQDGIAENNKARVDKGYPSITLVGWAAPPHYDAATHKLYWAKQLKFEGESSDTLNYSIRMLGRHGVLELNAIAGLNQLPEIDRQTPQILGMVDFKEGNRYADFDPKTDKVAEYGIAALVAGGALAVAAKAGLLKGLWLFILAGKKFIILGAIALAAFFKKLFNRSGKSDGGTPTT

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2739367700 Dyella sp. YR388 Isolate Unclassified
4 2884411467 Dyella sp. AD56 Isolate Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
85 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
86 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
87 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
132 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
135 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
136 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
141 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
142 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
143 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
144 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
145 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
146 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
147 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
148 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
149 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
155 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
156 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
157 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
158 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
159 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
164 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
169 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
170 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
171 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
172 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
173 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
174 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
177 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
178 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
179 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
180 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
181 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
182 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
183 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
184 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
185 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
186 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
187 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
188 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
189 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
190 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
191 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
192 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
193 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
197 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
202 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
203 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
204 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
205 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
206 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
207 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
217 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 0.62
Isolates 0.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.85
Nodule 0
Rhizoplane 0.62
Rhizosphere 91.69
Stem 0
Stem Tuber 0
Unclassified 5.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1980541 2162886007 Unclassified 1632
2 MBSR1b_contig_2041644 2162886012 Bacteria 1414
3 MBSR1b_contig_3720924 2162886012 Bacteria 1390
4 JGI24740J21852_10034515 3300001979 Bacteria 1593
5 JGI24739J22299_10002634 3300001989 Bacteria 6912
6 JGI24737J22298_10004283 3300001990 Bacteria 4984
7 JGI24735J21928_10045835 3300002067 Bacteria 1269
8 rootH1_10053517 3300003316 Bacteria 7420
9 rootH2_10113637 3300003320 Bacteria 10379
10 rootH2_10296059 3300003320 Bacteria 1325
11 rootL2_10088397 3300003322 Bacteria 6404
12 rootH1_10057846 3300003323 Bacteria 2780
13 rootH1_10200636 3300003323 Bacteria 3641
14 Ga0006562J51391_1081508 3300003578 Bacteria 12445
15 Ga0006562J51391_1081509 3300003578 Bacteria 9180
16 Ga0065165_1001386 3300005262 Bacteria 26581
17 Ga0065704_10122314 3300005289 Bacteria 1752
18 Ga0065704_10185362 3300005289 Bacteria 1216
19 Ga0065715_10102361 3300005293 Bacteria 3121
20 Ga0065707_10093229 3300005295 Bacteria 3656
21 Ga0070658_10002009 3300005327 Bacteria 17089
22 Ga0070690_100012096 3300005330 Bacteria 5069
23 Ga0070690_100028355 3300005330 Bacteria 3467
24 Ga0070670_100000634 3300005331 Bacteria 27387
25 Ga0070677_10010015 3300005333 Bacteria 3229
26 Ga0070677_10066540 3300005333 Unclassified 1503
27 Ga0068869_100002979 3300005334 Bacteria 10287
28 Ga0070666_10000020 3300005335 Bacteria 177564
29 Ga0070689_100001257 3300005340 Bacteria 16110
30 Ga0070689_100008926 3300005340 Bacteria 7089
31 Ga0070689_100180620 3300005340 Bacteria 1714
32 Ga0070689_100518993 3300005340 Bacteria 1023
33 Ga0070687_100020394 3300005343 Bacteria 3099
34 Ga0070687_100029244 3300005343 Bacteria 2681
35 Ga0070661_100024575 3300005344 Bacteria 4322
36 Ga0070661_100059307 3300005344 Bacteria 2806
37 Ga0070692_10069833 3300005345 Bacteria 1869
38 Ga0070668_100017773 3300005347 Bacteria 5333
39 Ga0070668_100042108 3300005347 Bacteria 3500
40 Ga0070669_100001273 3300005353 Bacteria 18290
41 Ga0070669_100022985 3300005353 Bacteria 4460
42 Ga0070669_100047408 3300005353 Bacteria 3134
43 Ga0070669_100170625 3300005353 Bacteria 1696
44 Ga0070675_100014402 3300005354 Bacteria 6235
45 Ga0070675_100055474 3300005354 Bacteria 3262
46 Ga0070671_100169237 3300005355 Bacteria 1848
47 Ga0070674_100137813 3300005356 Bacteria 1828
48 Ga0070673_100023783 3300005364 Bacteria 4481
49 Ga0070673_100370451 3300005364 Bacteria 1275
50 Ga0070688_100096052 3300005365 Bacteria 1946
51 Ga0070688_100265713 3300005365 Bacteria 1227
52 Ga0070667_100012349 3300005367 Bacteria 7064
53 Ga0070701_10003458 3300005438 Bacteria 6257
54 Ga0070705_100008831 3300005440 Bacteria 4994
55 Ga0070700_100045976 3300005441 Bacteria 2695
56 Ga0070694_100121801 3300005444 Bacteria 1872
57 Ga0070663_100024471 3300005455 Bacteria 4065
58 Ga0070678_100307501 3300005456 Bacteria 1349
59 Ga0070678_100381021 3300005456 Bacteria 1220
60 Ga0070662_100134102 3300005457 Bacteria 1913
61 Ga0068867_100000265 3300005459 Bacteria 34503
62 Ga0068867_100005276 3300005459 Bacteria 9129
63 Ga0070672_100024782 3300005543 Bacteria 4440
64 Ga0070672_100028071 3300005543 Bacteria 4205
65 Ga0070686_100005051 3300005544 Bacteria 7286
66 Ga0070665_100220689 3300005548 Bacteria 1896
67 Ga0070704_100003130 3300005549 Bacteria 9435
68 Ga0068855_100007621 3300005563 Bacteria 13091
69 Ga0070664_100009953 3300005564 Bacteria 7707
70 Ga0068857_100000349 3300005577 Bacteria 31928
71 Ga0068857_100013697 3300005577 Bacteria 7067
72 Ga0068857_100605260 3300005577 Unclassified 1036
73 Ga0068857_100605722 3300005577 Unclassified 1036
74 Ga0068856_100000446 3300005614 Bacteria 45656
75 Ga0070702_100024780 3300005615 Bacteria 3205
76 Ga0068852_100348040 3300005616 Bacteria 1446
77 Ga0068859_100008542 3300005617 Bacteria 10360
78 Ga0068859_100036466 3300005617 Unclassified 4936
79 Ga0068864_100014978 3300005618 Bacteria 6445
80 Ga0068861_100000656 3300005719 Bacteria 20542
81 Ga0068861_100051861 3300005719 Bacteria 3116
82 Ga0068870_10000727 3300005840 Bacteria 12656
83 Ga0068870_10086864 3300005840 Bacteria 1740
84 Ga0068863_100192147 3300005841 Unclassified 1962
85 Ga0068863_100409365 3300005841 Bacteria 1327
86 Ga0068858_100019789 3300005842 Bacteria 6292
87 Ga0068858_100054700 3300005842 Bacteria 3691
88 Ga0068860_100000171 3300005843 Bacteria 106956
89 Ga0068860_100053382 3300005843 Bacteria 3843
90 Ga0068860_100067513 3300005843 Bacteria 3398
91 Ga0068860_100099093 3300005843 Bacteria 2779
92 Ga0068860_100291391 3300005843 Bacteria 1597
93 Ga0068862_100003025 3300005844 Bacteria 14650
94 Ga0068862_100145414 3300005844 Bacteria 2107
95 Ga0068862_100215473 3300005844 Bacteria 1736
96 Ga0068862_100363675 3300005844 Bacteria 1345
97 Ga0075428_100072711 3300006844 Bacteria 3756
98 Ga0075431_100013816 3300006847 Bacteria 8153
99 Ga0075429_100049068 3300006880 Bacteria 3671
100 Ga0075429_100281922 3300006880 Bacteria 1455
101 Ga0068865_100025586 3300006881 Unclassified 3884
102 Ga0068865_100093125 3300006881 Bacteria 2190
103 Ga0097620_100008541 3300006931 Bacteria 10360
104 Ga0097620_100036465 3300006931 Unclassified 4936
105 Ga0105250_10106474 3300009092 Bacteria 1146
106 Ga0105240_10000179 3300009093 Bacteria 128695
107 Ga0105240_10000546 3300009093 Bacteria 69544
108 Ga0105240_10039168 3300009093 Bacteria 6072
109 Ga0111539_10007666 3300009094 Bacteria 13794
110 Ga0111539_10199813 3300009094 Bacteria 2331
111 Ga0105243_10098584 3300009148 Bacteria 2421
112 Ga0105242_10026775 3300009176 Bacteria 4572
113 Ga0105237_10000095 3300009545 Bacteria 121776
114 Ga0105238_10000325 3300009551 Bacteria 52092
115 Ga0105238_10073112 3300009551 Bacteria 3424
116 Ga0105249_10001223 3300009553 Bacteria 22627
117 Ga0105239_10004189 3300010375 Bacteria 17328
118 Ga0105239_10013742 3300010375 Bacteria 8988
119 Ga0157314_1000023 3300012500 Bacteria 15046
120 Ga0163162_10000547 3300013306 Bacteria 34748
121 Ga0163162_10251239 3300013306 Bacteria 1900
122 Ga0163162_10444841 3300013306 Bacteria 1428
123 Ga0157375_10005873 3300013308 Bacteria 10687
124 Ga0163163_10016160 3300014325 Bacteria 6928
125 Ga0163163_10270457 3300014325 Bacteria 1751
126 Ga0157380_10068016 3300014326 Bacteria 2870
127 Ga0157380_10207806 3300014326 Bacteria 1742
128 Ga0157380_10402203 3300014326 Bacteria 1300
129 Ga0157376_10024366 3300014969 Bacteria 4749
130 Ga0209566_101305 3300025225 Bacteria 8112
131 Ga0209672_102099 3300025228 Bacteria 5357
132 Ga0209646_1002605 3300025246 Bacteria 3889
133 Ga0209129_1001730 3300025258 Bacteria 11757
134 Ga0209758_1001867 3300025297 Bacteria 23104
135 Ga0207653_10007964 3300025885 Bacteria 3302
136 Ga0207682_10043273 3300025893 Bacteria 1843
137 Ga0207688_10214171 3300025901 Bacteria 1158
138 Ga0207680_10000001 3300025903 Bacteria 1091453
139 Ga0207647_10010621 3300025904 Bacteria 6493
140 Ga0207647_10091222 3300025904 Bacteria 1817
141 Ga0207645_10016323 3300025907 Bacteria 4917
142 Ga0207643_10002234 3300025908 Bacteria 10559
143 Ga0207643_10019622 3300025908 Bacteria 3706
144 Ga0207695_10000265 3300025913 Bacteria 132524
145 Ga0207695_10000640 3300025913 Bacteria 69743
146 Ga0207695_10005609 3300025913 Bacteria 16578
147 Ga0207695_10016318 3300025913 Bacteria 8695
148 Ga0207671_10000026 3300025914 Bacteria 268845
149 Ga0207662_10004201 3300025918 Bacteria 7548
150 Ga0207662_10035446 3300025918 Bacteria 2914
151 Ga0207649_10023933 3300025920 Bacteria 3543
152 Ga0207681_10003910 3300025923 Bacteria 9243
153 Ga0207681_10187190 3300025923 Bacteria 1581
154 Ga0207694_10000598 3300025924 Bacteria 32619
155 Ga0207694_10013222 3300025924 Bacteria 6214
156 Ga0207694_10014836 3300025924 Bacteria 5875
157 Ga0207650_10006089 3300025925 Bacteria 8225
158 Ga0207659_10039592 3300025926 Bacteria 3289
159 Ga0207659_10064254 3300025926 Bacteria 2655
160 Ga0207644_10034868 3300025931 Bacteria 3522
161 Ga0207686_10015941 3300025934 Bacteria 4211
162 Ga0207709_10027259 3300025935 Bacteria 3289
163 Ga0207670_10001058 3300025936 Bacteria 14511
164 Ga0207670_10281922 3300025936 Bacteria 1295
165 Ga0207670_10444641 3300025936 Bacteria 1044
166 Ga0207704_10060441 3300025938 Bacteria 2344
167 Ga0207704_10153631 3300025938 Bacteria 1628
168 Ga0207691_10037243 3300025940 Bacteria 4506
169 Ga0207691_10144868 3300025940 Bacteria 2092
170 Ga0207691_10153037 3300025940 Bacteria 2027
171 Ga0207689_10014592 3300025942 Bacteria 6679
172 Ga0207679_10009936 3300025945 Bacteria 6111
173 Ga0207679_10030502 3300025945 Bacteria 3766
174 Ga0207667_10001558 3300025949 Bacteria 28860
175 Ga0207667_10002239 3300025949 Bacteria 24309
176 Ga0207667_10028073 3300025949 Bacteria 6114
177 Ga0207651_10057029 3300025960 Bacteria 2691
178 Ga0207651_10391354 3300025960 Bacteria 1180
179 Ga0207712_10003831 3300025961 Bacteria 9497
180 Ga0207668_10028362 3300025972 Bacteria 3660
181 Ga0207668_10058755 3300025972 Bacteria 2690
182 Ga0207640_10000025 3300025981 Bacteria 143903
183 Ga0207640_10230155 3300025981 Bacteria 1425
184 Ga0207677_10370578 3300026023 Bacteria 1206
185 Ga0207703_10026790 3300026035 Bacteria 4541
186 Ga0207703_10152401 3300026035 Unclassified 2017
187 Ga0207703_10381128 3300026035 Bacteria 1304
188 Ga0207678_10050791 3300026067 Bacteria 3582
189 Ga0207678_10109774 3300026067 Bacteria 2353
190 Ga0207708_10016480 3300026075 Bacteria 5557
191 Ga0207708_10054421 3300026075 Bacteria 3051
192 Ga0207708_10129726 3300026075 Bacteria 1970
193 Ga0207702_10016155 3300026078 Bacteria 6180
194 Ga0207702_10089044 3300026078 Bacteria 2698
195 Ga0207641_10173035 3300026088 Unclassified 1972
196 Ga0207648_10000844 3300026089 Bacteria 34567
197 Ga0207648_10012977 3300026089 Bacteria 7776
198 Ga0207676_10101193 3300026095 Bacteria 2389
199 Ga0207676_10173578 3300026095 Bacteria 1880
200 Ga0207674_10000553 3300026116 Bacteria 48913
201 Ga0207674_10020527 3300026116 Bacteria 7135
202 Ga0207675_100002554 3300026118 Bacteria 18027
203 Ga0207675_100040789 3300026118 Bacteria 4335
204 Ga0207683_10041693 3300026121 Bacteria 4009
205 Ga0207683_10137042 3300026121 Bacteria 2203
206 Ga0207683_10156914 3300026121 Bacteria 2056
207 Ga0207683_10427415 3300026121 Bacteria 1220
208 Ga0207698_10068136 3300026142 Bacteria 2809
209 Ga0207428_10000562 3300027907 Bacteria 43846
210 Ga0268266_10000067 3300028379 Bacteria 241577
211 Ga0268265_10000103 3300028380 Bacteria 106177
212 Ga0268264_10000453 3300028381 Bacteria 55983
213 Ga0268264_10127722 3300028381 Bacteria 2249
214 Ga0268264_10163511 3300028381 Bacteria 2007
215 Ga0268264_10172816 3300028381 Bacteria 1955
216 Ga0265319_1039809 3300028563 Bacteria 1591
217 Ga0307517_10135965 3300028786 Bacteria 1748
218 Ga0265338_10000263 3300028800 Bacteria 95638
219 Ga0265338_10044743 3300028800 Unclassified 4081
220 Ga0265338_10097315 3300028800 Bacteria 2411
221 Ga0265324_10016114 3300029957 Bacteria 2736
222 Ga0265324_10069619 3300029957 Unclassified 1199
223 Ga0265320_10000375 3300031240 Bacteria 36376
224 Ga0265320_10003450 3300031240 Bacteria 10630
225 Ga0265320_10056655 3300031240 Bacteria 1882
226 Ga0265325_10094599 3300031241 Bacteria 1469
227 Ga0265327_10000571 3300031251 Bacteria 62622
228 Ga0265316_10066465 3300031344 Bacteria 2790
229 Ga0265316_10148092 3300031344 Bacteria 1760
230 Ga0265342_10084631 3300031712 Bacteria 1826
231 Ga0307510_10004025 3300033180 Bacteria 17232
232 Ga0373930_0000376 3300034816 Bacteria 5849
233 Ga0373928_0000122 3300035084 Bacteria 14457
234 Ga0373929_0003661 3300035085 Bacteria 2757
235 Ga0373940_0018929 3300035088 Bacteria 1733
236 Ga0373944_0000161 3300035089 Bacteria 13384
237 Ga0373951_0002331 3300035091 Bacteria 4817
238 Ga0373932_0000001 3300035112 Bacteria 1459067
239 Ga0373945_0025362 3300035116 Bacteria 2059
240 Ga0373962_0000013 3300035242 Bacteria 49373
241 Ga0373931_0000002 3300035691 Bacteria 599830
242 Ga0373927_0019194 3300035695 Bacteria 4483
243 Ga0373925_0003063 3300037068 Bacteria 13135
244 Ga0373925_0011613 3300037068 Bacteria 6372
245 Ga0395905_0148856 3300037471 Bacteria 2202
246 Ga0466972_0040418 3300044658 Bacteria 2272
247 Ga0466982_0000015 3300044672 Bacteria 131281
248 Ga0466964_0002947 3300044706 Bacteria 6148
249 Ga0466971_0002321 3300044719 Bacteria 8054
250 Ga0466968_0051288 3300044735 Bacteria 1762
251 Ga0466970_0026887 3300044765 Bacteria 3016
252 Ga0466957_0048535 3300044842 Bacteria 2581
253 Ga0466960_0014798 3300044901 Bacteria 3350
254 Ga0451576_0469011 3300045051 Unclassified 1322
255 Ga0495603_0006732 3300046455 Bacteria 6899
256 Ga0495638_0001562 3300046460 Bacteria 20538
257 Ga0495638_0001917 3300046460 Bacteria 17910
258 Ga0495653_0014584 3300046463 Bacteria 6414
259 Ga0495650_0000092 3300046471 Bacteria 224681
260 Ga0495650_0000743 3300046471 Bacteria 40889
261 Ga0495582_0223760 3300046473 Bacteria 1077
262 Ga0495584_0001206 3300046491 Bacteria 15841
263 Ga0495585_0000808 3300046492 Bacteria 27257
264 Ga0495585_0001739 3300046492 Bacteria 16585
265 Ga0495585_0002267 3300046492 Bacteria 13909
266 Ga0495594_0105830 3300046499 Bacteria 1584
267 Ga0495596_0003672 3300046500 Bacteria 7679
268 Ga0495606_0000633 3300046507 Bacteria 55270
269 Ga0495606_0001530 3300046507 Bacteria 30598
270 Ga0495606_0065604 3300046507 Bacteria 2306
271 Ga0495616_0005219 3300046513 Bacteria 8031
272 Ga0495628_0050720 3300046516 Unclassified 3282
273 Ga0495630_0024462 3300046517 Unclassified 4465
274 Ga0495652_0038393 3300046529 Bacteria 4149
275 Ga0495640_0020001 3300046533 Unclassified 4934
276 Ga0495609_0007429 3300046538 Bacteria 5476
277 Ga0495597_0125535 3300046542 Bacteria 1067
278 Ga0495645_0009099 3300046543 Bacteria 6939
279 Ga0495633_0001748 3300046558 Bacteria 16146
280 Ga0495633_0010254 3300046558 Bacteria 5126
281 Ga0495667_0018009 3300046559 Unclassified 4771
282 Ga0495634_0136056 3300046642 Unclassified 1563
283 Ga0495634_0190206 3300046642 Bacteria 1280
284 Ga0495625_0018703 3300046660 Bacteria 5398
285 Ga0495625_0023244 3300046660 Bacteria 4737
286 Ga0495625_0078474 3300046660 Bacteria 2305
287 Ga0495635_0034203 3300046663 Unclassified 3525
288 Ga0495659_0012154 3300046664 Bacteria 2784
289 Ga0495661_0000028 3300046665 Bacteria 182191
290 Ga0495661_0019633 3300046665 Bacteria 4425
291 Ga0495657_0143165 3300046675 Unclassified 1489
292 Ga0495599_0010322 3300046678 Bacteria 5713
293 Ga0495613_0075375 3300046689 Bacteria 2456
294 Ga0495670_0008351 3300046691 Bacteria 5090
295 Ga0495649_0039701 3300046694 Bacteria 2580
296 Ga0495636_0026873 3300047318 Bacteria 2343
297 Ga0495674_0040403 3300047319 Unclassified 4172
298 Ga0495680_0027727 3300047322 Unclassified 4648
299 Ga0495683_0000224 3300047323 Bacteria 53121
300 Ga0495675_0016723 3300047444 Unclassified 4639
301 Ga0495684_0016969 3300047471 Bacteria 5609
302 Ga0495602_0008316 3300048088 Bacteria 10845
303 Ga0496115_0001179 3300048918 Bacteria 18754
304 Ga0496115_0015051 3300048918 Bacteria 5863
305 Ga0496118_0204858 3300048921 Unclassified 1164
306 Ga0496121_0245959 3300048924 Bacteria 1243
307 Ga0496125_0001992 3300048928 Bacteria 27698
308 Ga0496125_0024842 3300048928 Bacteria 5499
309 Ga0496126_0067684 3300048929 Bacteria 3190
310 Ga0496126_0073960 3300048929 Bacteria 3027
311 Ga0495678_024373 3300049459 Bacteria 2613
312 Ga0495682_0018715 3300049460 Bacteria 2609
313 Ga0501031_0000149 3300049568 Bacteria 39446
314 Ga0501032_0029030 3300049569 Bacteria 3799
315 Ga0501033_0004956 3300049570 Bacteria 10589
316 Ga0501037_0077925 3300049573 Unclassified 2405
317 Ga0501044_0000281 3300049823 Bacteria 64762
318 nmdc:mga09592_51954_c1 3300050508 Bacteria 3458
319 nmdc:mga0qj67_37187_c1 3300050509 Unclassified 3812
320 nmdc:mga06r32_66430_c1 3300050510 Bacteria 3480
321 nmdc:mga08y16_1714_c1 3300050511 Bacteria 22252
322 Ga0500559_0009906 3300053136 Bacteria 4106
323 Ga0466962_0007938 3300061719 Bacteria 5089

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025228 Ga0209672_102099 Ga0209672_1020993 264
2 3300009551 Ga0105238_10073112 Ga0105238_100731122 273
3 3300031240 Ga0265320_10000375 Ga0265320_1000037523 274
4 3300046460 Ga0495638_0001562 Ga0495638_0001562_7855_8766 275
5 3300005340 Ga0070689_100008926 Ga0070689_1000089266 276
6 3300005344 Ga0070661_100059307 Ga0070661_1000593072 276
7 3300005843 Ga0068860_100053382 Ga0068860_1000533823 276
8 3300005844 Ga0068862_100215473 Ga0068862_1002154731 276
9 3300013306 Ga0163162_10444841 Ga0163162_104448412 276
10 3300014969 Ga0157376_10024366 Ga0157376_100243663 276
11 3300025225 Ga0209566_101305 Ga0209566_10130510 276
12 3300025246 Ga0209646_1002605 Ga0209646_10026051 276
13 3300025936 Ga0207670_10001058 Ga0207670_1000105812 276
14 3300026067 Ga0207678_10109774 Ga0207678_101097741 276
15 3300046460 Ga0495638_0001917 Ga0495638_0001917_5956_6867 276
16 3300046471 Ga0495650_0000092 Ga0495650_0000092_151656_152567 276
17 3300046507 Ga0495606_0001530 Ga0495606_0001530_13065_13976 276
18 3300046542 Ga0495597_0125535 Ga0495597_0125535_56_967 276
19 3300046660 Ga0495625_0018703 Ga0495625_0018703_4368_5279 276
20 3300046660 Ga0495625_0078474 Ga0495625_0078474_465_1376 276
21 3300046694 Ga0495649_0039701 Ga0495649_0039701_543_1454 276
22 3300048918 Ga0496115_0001179 Ga0496115_0001179_12082_12993 276
23 3300048918 Ga0496115_0015051 Ga0496115_0015051_4045_4956 276
24 3300048924 Ga0496121_0245959 Ga0496121_0245959_38_949 276
25 3300048929 Ga0496126_0067684 Ga0496126_0067684_1705_2616 276
26 3300001979 JGI24740J21852_10034515 JGI24740J21852_100345151 277
27 3300001989 JGI24739J22299_10002634 JGI24739J22299_100026345 277
28 3300001990 JGI24737J22298_10004283 JGI24737J22298_100042835 277
29 3300002067 JGI24735J21928_10045835 JGI24735J21928_100458352 277
30 3300003578 Ga0006562J51391_1081508 Ga0006562J51391_10815089 277
31 3300003578 Ga0006562J51391_1081509 Ga0006562J51391_10815094 277
32 3300005455 Ga0070663_100024471 Ga0070663_1000244712 277
33 3300005577 Ga0068857_100000349 Ga0068857_10000034926 277
34 3300005616 Ga0068852_100348040 Ga0068852_1003480401 277
35 3300005842 Ga0068858_100019789 Ga0068858_1000197895 277
36 3300009093 Ga0105240_10039168 Ga0105240_100391684 277
37 3300009545 Ga0105237_10000095 Ga0105237_1000009585 277
38 3300010375 Ga0105239_10004189 Ga0105239_1000418914 277
39 3300012500 Ga0157314_1000023 Ga0157314_100002311 277
40 3300025258 Ga0209129_1001730 Ga0209129_10017301 277
41 3300025297 Ga0209758_1001867 Ga0209758_100186711 277
42 3300025904 Ga0207647_10010621 Ga0207647_100106215 277
43 3300025913 Ga0207695_10005609 Ga0207695_100056093 277
44 3300025914 Ga0207671_10000026 Ga0207671_1000002636 277
45 3300025945 Ga0207679_10030502 Ga0207679_100305022 277
46 3300025949 Ga0207667_10001558 Ga0207667_100015587 277
47 3300026035 Ga0207703_10381128 Ga0207703_103811282 277
48 3300026116 Ga0207674_10000553 Ga0207674_1000055336 277
49 3300026142 Ga0207698_10068136 Ga0207698_100681362 277
50 3300048928 Ga0496125_0001992 Ga0496125_0001992_23514_24440 277
51 3300003323 rootH1_10057846 rootH1_100578463 280
52 3300025913 Ga0207695_10016318 Ga0207695_100163184 280
53 3300025949 Ga0207667_10002239 Ga0207667_100022397 280
54 3300025981 Ga0207640_10000025 Ga0207640_1000002585 280
55 3300028786 Ga0307517_10135965 Ga0307517_101359652 281
56 3300005617 Ga0068859_100036466 Ga0068859_1000364662 282
57 3300005842 Ga0068858_100054700 Ga0068858_1000547002 282
58 3300006931 Ga0097620_100036465 Ga0097620_1000364655 282
59 3300014325 Ga0163163_10016160 Ga0163163_100161603 282
60 3300026035 Ga0207703_10026790 Ga0207703_100267902 283
61 3300031241 Ga0265325_10094599 Ga0265325_100945991 283
62 3300035695 Ga0373927_0019194 Ga0373927_0019194_627_1544 285
63 3300037068 Ga0373925_0011613 Ga0373925_0011613_781_1698 285
64 3300006847 Ga0075431_100013816 Ga0075431_1000138164 287
65 3300031344 Ga0265316_10066465 Ga0265316_100664654 287
66 3300031712 Ga0265342_10084631 Ga0265342_100846312 287
67 3300050509 nmdc:mga0qj67_37187_c1 nmdc:mga0qj67_37187_c1_702_1604 287
68 3300050510 nmdc:mga06r32_66430_c1 nmdc:mga06r32_66430_c1_1188_2090 287
69 iso_pu_bacteria 2739367700 2739732734 288
70 iso_pu_bacteria 2884411467 2884412941 289
71 3300005327 Ga0070658_10002009 Ga0070658_1000200912 291
72 3300005335 Ga0070666_10000020 Ga0070666_1000002076 291
73 3300005344 Ga0070661_100024575 Ga0070661_1000245752 291
74 3300005347 Ga0070668_100017773 Ga0070668_1000177732 291
75 3300005367 Ga0070667_100012349 Ga0070667_1000123494 291
76 3300005456 Ga0070678_100307501 Ga0070678_1003075012 291
77 3300005577 Ga0068857_100605260 Ga0068857_1006052601 291
78 3300005841 Ga0068863_100409365 Ga0068863_1004093652 291
79 3300005843 Ga0068860_100067513 Ga0068860_1000675132 291
80 3300005844 Ga0068862_100363675 Ga0068862_1003636751 291
81 3300009092 Ga0105250_10106474 Ga0105250_101064742 291
82 3300009551 Ga0105238_10000325 Ga0105238_1000032549 291
83 3300013306 Ga0163162_10000547 Ga0163162_1000054712 291
84 3300025903 Ga0207680_10000001 Ga0207680_10000001880 291
85 3300025920 Ga0207649_10023933 Ga0207649_100239332 291
86 3300025924 Ga0207694_10000598 Ga0207694_1000059832 291
87 3300025972 Ga0207668_10028362 Ga0207668_100283622 291
88 3300026121 Ga0207683_10156914 Ga0207683_101569142 291
89 3300028379 Ga0268266_10000067 Ga0268266_10000067146 291
90 3300028381 Ga0268264_10172816 Ga0268264_101728162 291
91 3300033180 Ga0307510_10004025 Ga0307510_1000402511 291
92 3300046471 Ga0495650_0000743 Ga0495650_0000743_22757_23653 291
93 3300046492 Ga0495585_0000808 Ga0495585_0000808_2441_3325 291
94 3300046507 Ga0495606_0065604 Ga0495606_0065604_133_1029 291
95 3300046660 Ga0495625_0023244 Ga0495625_0023244_2897_3793 291
96 3300046665 Ga0495661_0000028 Ga0495661_0000028_141760_142644 291
97 3300048928 Ga0496125_0024842 Ga0496125_0024842_2976_3872 291
98 3300048929 Ga0496126_0073960 Ga0496126_0073960_1551_2447 291
99 3300046463 Ga0495653_0014584 Ga0495653_0014584_1719_2606 292
100 3300046507 Ga0495606_0000633 Ga0495606_0000633_1707_2594 292
101 3300049459 Ga0495678_024373 Ga0495678_024373_557_1444 292
102 3300005330 Ga0070690_100028355 Ga0070690_1000283553 293
103 3300005331 Ga0070670_100000634 Ga0070670_10000063421 293
104 3300005333 Ga0070677_10010015 Ga0070677_100100151 293
105 3300005333 Ga0070677_10066540 Ga0070677_100665402 293
106 3300005334 Ga0068869_100002979 Ga0068869_1000029794 293
107 3300005340 Ga0070689_100518993 Ga0070689_1005189931 293
108 3300005343 Ga0070687_100020394 Ga0070687_1000203943 293
109 3300005353 Ga0070669_100047408 Ga0070669_1000474082 293
110 3300005355 Ga0070671_100169237 Ga0070671_1001692372 293
111 3300005356 Ga0070674_100137813 Ga0070674_1001378132 293
112 3300005364 Ga0070673_100023783 Ga0070673_1000237832 293
113 3300005365 Ga0070688_100265713 Ga0070688_1002657131 293
114 3300005459 Ga0068867_100005276 Ga0068867_1000052764 293
115 3300005543 Ga0070672_100028071 Ga0070672_1000280714 293
116 3300005564 Ga0070664_100009953 Ga0070664_1000099533 293
117 3300005615 Ga0070702_100024780 Ga0070702_1000247803 293
118 3300005719 Ga0068861_100051861 Ga0068861_1000518613 293
119 3300005840 Ga0068870_10086864 Ga0068870_100868642 293
120 3300005843 Ga0068860_100000171 Ga0068860_10000017140 293
121 3300005843 Ga0068860_100099093 Ga0068860_1000990932 293
122 3300006881 Ga0068865_100093125 Ga0068865_1000931252 293
123 3300009148 Ga0105243_10098584 Ga0105243_100985842 293
124 3300009176 Ga0105242_10026775 Ga0105242_100267754 293
125 3300014326 Ga0157380_10068016 Ga0157380_100680162 293
126 3300014326 Ga0157380_10207806 Ga0157380_102078062 293
127 3300025893 Ga0207682_10043273 Ga0207682_100432732 293
128 3300025901 Ga0207688_10214171 Ga0207688_102141712 293
129 3300025907 Ga0207645_10016323 Ga0207645_100163233 293
130 3300025918 Ga0207662_10035446 Ga0207662_100354462 293
131 3300025925 Ga0207650_10006089 Ga0207650_100060899 293
132 3300025931 Ga0207644_10034868 Ga0207644_100348684 293
133 3300025934 Ga0207686_10015941 Ga0207686_100159412 293
134 3300025935 Ga0207709_10027259 Ga0207709_100272593 293
135 3300025936 Ga0207670_10444641 Ga0207670_104446411 293
136 3300025938 Ga0207704_10060441 Ga0207704_100604412 293
137 3300025940 Ga0207691_10144868 Ga0207691_101448682 293
138 3300025942 Ga0207689_10014592 Ga0207689_100145924 293
139 3300025945 Ga0207679_10009936 Ga0207679_100099367 293
140 3300025960 Ga0207651_10057029 Ga0207651_100570293 293
141 3300025981 Ga0207640_10230155 Ga0207640_102301552 293
142 3300026075 Ga0207708_10016480 Ga0207708_100164803 293
143 3300026089 Ga0207648_10012977 Ga0207648_100129776 293
144 3300026095 Ga0207676_10101193 Ga0207676_101011932 293
145 3300026118 Ga0207675_100040789 Ga0207675_1000407893 293
146 3300026121 Ga0207683_10041693 Ga0207683_100416931 293
147 3300026121 Ga0207683_10137042 Ga0207683_101370421 293
148 3300028381 Ga0268264_10000453 Ga0268264_1000045340 293
149 3300028381 Ga0268264_10163511 Ga0268264_101635112 293
150 3300005340 Ga0070689_100180620 Ga0070689_1001806202 294
151 3300005353 Ga0070669_100170625 Ga0070669_1001706252 294
152 3300005354 Ga0070675_100014402 Ga0070675_1000144023 294
153 3300005364 Ga0070673_100370451 Ga0070673_1003704511 294
154 3300005548 Ga0070665_100220689 Ga0070665_1002206892 294
155 3300005844 Ga0068862_100145414 Ga0068862_1001454142 294
156 3300009094 Ga0111539_10199813 Ga0111539_101998133 294
157 3300014325 Ga0163163_10270457 Ga0163163_102704572 294
158 3300014326 Ga0157380_10402203 Ga0157380_104022032 294
159 3300025908 Ga0207643_10019622 Ga0207643_100196223 294
160 3300025923 Ga0207681_10187190 Ga0207681_101871902 294
161 3300025926 Ga0207659_10064254 Ga0207659_100642543 294
162 3300025936 Ga0207670_10281922 Ga0207670_102819222 294
163 3300025940 Ga0207691_10037243 Ga0207691_100372432 294
164 3300025960 Ga0207651_10391354 Ga0207651_103913542 294
165 3300026035 Ga0207703_10152401 Ga0207703_101524012 294
166 3300005353 Ga0070669_100022985 Ga0070669_1000229855 295
167 3300005841 Ga0068863_100192147 Ga0068863_1001921472 295
168 3300006880 Ga0075429_100281922 Ga0075429_1002819222 295
169 3300026067 Ga0207678_10050791 Ga0207678_100507911 295
170 3300026088 Ga0207641_10173035 Ga0207641_101730352 295
171 3300031344 Ga0265316_10148092 Ga0265316_101480922 295
172 3300046491 Ga0495584_0001206 Ga0495584_0001206_4579_5514 295
173 3300046492 Ga0495585_0001739 Ga0495585_0001739_10753_11688 295
174 3300046492 Ga0495585_0002267 Ga0495585_0002267_5222_6157 295
175 3300046500 Ga0495596_0003672 Ga0495596_0003672_4883_5818 295
176 3300046513 Ga0495616_0005219 Ga0495616_0005219_3519_4454 295
177 3300046538 Ga0495609_0007429 Ga0495609_0007429_2015_2950 295
178 3300046558 Ga0495633_0001748 Ga0495633_0001748_10759_11694 295
179 3300046558 Ga0495633_0010254 Ga0495633_0010254_3496_4431 295
180 3300046642 Ga0495634_0190206 Ga0495634_0190206_301_1212 295
181 3300046665 Ga0495661_0019633 Ga0495661_0019633_1779_2714 295
182 3300046691 Ga0495670_0008351 Ga0495670_0008351_1911_2846 295
183 3300047323 Ga0495683_0000224 Ga0495683_0000224_33736_34671 295
184 3300049460 Ga0495682_0018715 Ga0495682_0018715_999_1934 295
185 3300049568 Ga0501031_0000149 Ga0501031_0000149_13647_14588 295
186 3300049569 Ga0501032_0029030 Ga0501032_0029030_1347_2288 295
187 3300049570 Ga0501033_0004956 Ga0501033_0004956_779_1720 295
188 3300049573 Ga0501037_0077925 Ga0501037_0077925_1263_2204 295
189 3300049823 Ga0501044_0000281 Ga0501044_0000281_16230_17171 295
190 3300003320 rootH2_10113637 rootH2_1011363710 296
191 3300005456 Ga0070678_100381021 Ga0070678_1003810211 296
192 3300025924 Ga0207694_10013222 Ga0207694_100132225 296
193 3300026023 Ga0207677_10370578 Ga0207677_103705781 296
194 3300026078 Ga0207702_10089044 Ga0207702_100890442 296
195 3300026121 Ga0207683_10427415 Ga0207683_104274151 296
196 3300028563 Ga0265319_1039809 Ga0265319_10398092 296
197 3300028800 Ga0265338_10097315 Ga0265338_100973152 296
198 3300031240 Ga0265320_10056655 Ga0265320_100566555 296
199 3300003316 rootH1_10053517 rootH1_100535173 297
200 3300003322 rootL2_10088397 rootL2_100883978 297
201 3300003323 rootH1_10200636 rootH1_102006362 297
202 3300005262 Ga0065165_1001386 Ga0065165_10013862 297
203 3300009093 Ga0105240_10000179 Ga0105240_1000017955 297
204 3300025913 Ga0207695_10000265 Ga0207695_1000026570 297
205 3300037471 Ga0395905_0148856 Ga0395905_0148856_1134_2069 297
206 3300044658 Ga0466972_0040418 Ga0466972_0040418_706_1632 297
207 3300044672 Ga0466982_0000015 Ga0466982_0000015_29467_30393 297
208 3300044706 Ga0466964_0002947 Ga0466964_0002947_1515_2441 297
209 3300044719 Ga0466971_0002321 Ga0466971_0002321_5670_6596 297
210 3300044735 Ga0466968_0051288 Ga0466968_0051288_585_1511 297
211 3300044765 Ga0466970_0026887 Ga0466970_0026887_2080_3006 297
212 3300044842 Ga0466957_0048535 Ga0466957_0048535_188_1114 297
213 3300044901 Ga0466960_0014798 Ga0466960_0014798_1284_2210 297
214 3300048921 Ga0496118_0204858 Ga0496118_0204858_210_1133 297
215 3300061719 Ga0466962_0007938 Ga0466962_0007938_3665_4591 297
216 3300006844 Ga0075428_100072711 Ga0075428_1000727114 298
217 3300046664 Ga0495659_0012154 Ga0495659_0012154_1426_2322 298
218 3300047318 Ga0495636_0026873 Ga0495636_0026873_976_1872 298
219 3300005544 Ga0070686_100005051 Ga0070686_1000050513 299
220 3300025924 Ga0207694_10014836 Ga0207694_100148367 299
221 3300028800 Ga0265338_10000263 Ga0265338_1000026323 299
222 3300028800 Ga0265338_10044743 Ga0265338_100447433 299
223 3300029957 Ga0265324_10069619 Ga0265324_100696191 299
224 3300031240 Ga0265320_10003450 Ga0265320_100034504 299
225 3300003320 rootH2_10296059 rootH2_102960591 300
226 3300005289 Ga0065704_10185362 Ga0065704_101853622 300
227 3300005295 Ga0065707_10093229 Ga0065707_100932294 300
228 3300005330 Ga0070690_100012096 Ga0070690_1000120965 300
229 3300005340 Ga0070689_100001257 Ga0070689_1000012577 300
230 3300005343 Ga0070687_100029244 Ga0070687_1000292443 300
231 3300005345 Ga0070692_10069833 Ga0070692_100698332 300
232 3300005347 Ga0070668_100042108 Ga0070668_1000421082 300
233 3300005353 Ga0070669_100001273 Ga0070669_10000127310 300
234 3300005354 Ga0070675_100055474 Ga0070675_1000554742 300
235 3300005365 Ga0070688_100096052 Ga0070688_1000960522 300
236 3300005438 Ga0070701_10003458 Ga0070701_100034585 300
237 3300005440 Ga0070705_100008831 Ga0070705_1000088314 300
238 3300005441 Ga0070700_100045976 Ga0070700_1000459762 300
239 3300005444 Ga0070694_100121801 Ga0070694_1001218012 300
240 3300005457 Ga0070662_100134102 Ga0070662_1001341023 300
241 3300005459 Ga0068867_100000265 Ga0068867_10000026527 300
242 3300005543 Ga0070672_100024782 Ga0070672_1000247824 300
243 3300005549 Ga0070704_100003130 Ga0070704_1000031304 300
244 3300005577 Ga0068857_100013697 Ga0068857_1000136972 300
245 3300005617 Ga0068859_100008542 Ga0068859_1000085425 300
246 3300005618 Ga0068864_100014978 Ga0068864_1000149783 300
247 3300005719 Ga0068861_100000656 Ga0068861_10000065610 300
248 3300005840 Ga0068870_10000727 Ga0068870_100007276 300
249 3300005843 Ga0068860_100291391 Ga0068860_1002913911 300
250 3300005844 Ga0068862_100003025 Ga0068862_10000302510 300
251 3300006880 Ga0075429_100049068 Ga0075429_1000490682 300
252 3300006881 Ga0068865_100025586 Ga0068865_1000255865 300
253 3300006931 Ga0097620_100008541 Ga0097620_1000085417 300
254 3300009094 Ga0111539_10007666 Ga0111539_1000766613 300
255 3300009553 Ga0105249_10001223 Ga0105249_1000122319 300
256 3300013306 Ga0163162_10251239 Ga0163162_102512392 300
257 3300013308 Ga0157375_10005873 Ga0157375_100058735 300
258 3300025885 Ga0207653_10007964 Ga0207653_100079641 300
259 3300025904 Ga0207647_10091222 Ga0207647_100912223 300
260 3300025908 Ga0207643_10002234 Ga0207643_100022345 300
261 3300025918 Ga0207662_10004201 Ga0207662_100042017 300
262 3300025923 Ga0207681_10003910 Ga0207681_100039107 300
263 3300025926 Ga0207659_10039592 Ga0207659_100395922 300
264 3300025938 Ga0207704_10153631 Ga0207704_101536313 300
265 3300025940 Ga0207691_10153037 Ga0207691_101530372 300
266 3300025961 Ga0207712_10003831 Ga0207712_100038313 300
267 3300025972 Ga0207668_10058755 Ga0207668_100587553 300
268 3300026075 Ga0207708_10054421 Ga0207708_100544212 300
269 3300026089 Ga0207648_10000844 Ga0207648_1000084426 300
270 3300026095 Ga0207676_10173578 Ga0207676_101735782 300
271 3300026116 Ga0207674_10020527 Ga0207674_100205276 300
272 3300026118 Ga0207675_100002554 Ga0207675_1000025547 300
273 3300027907 Ga0207428_10000562 Ga0207428_1000056224 300
274 3300028380 Ga0268265_10000103 Ga0268265_1000010398 300
275 3300028381 Ga0268264_10127722 Ga0268264_101277223 300
276 3300029957 Ga0265324_10016114 Ga0265324_100161143 300
277 3300046455 Ga0495603_0006732 Ga0495603_0006732_335_1261 300
278 3300046473 Ga0495582_0223760 Ga0495582_0223760_115_1041 300
279 3300046499 Ga0495594_0105830 Ga0495594_0105830_565_1491 300
280 3300046516 Ga0495628_0050720 Ga0495628_0050720_102_1028 300
281 3300046517 Ga0495630_0024462 Ga0495630_0024462_1222_2148 300
282 3300046529 Ga0495652_0038393 Ga0495652_0038393_805_1731 300
283 3300046533 Ga0495640_0020001 Ga0495640_0020001_1683_2609 300
284 3300046543 Ga0495645_0009099 Ga0495645_0009099_1555_2481 300
285 3300046559 Ga0495667_0018009 Ga0495667_0018009_1447_2373 300
286 3300046642 Ga0495634_0136056 Ga0495634_0136056_398_1324 300
287 3300046663 Ga0495635_0034203 Ga0495635_0034203_1802_2728 300
288 3300046675 Ga0495657_0143165 Ga0495657_0143165_378_1304 300
289 3300046678 Ga0495599_0010322 Ga0495599_0010322_241_1167 300
290 3300046689 Ga0495613_0075375 Ga0495613_0075375_685_1611 300
291 3300047319 Ga0495674_0040403 Ga0495674_0040403_2258_3184 300
292 3300047322 Ga0495680_0027727 Ga0495680_0027727_2346_3272 300
293 3300047444 Ga0495675_0016723 Ga0495675_0016723_2172_3098 300
294 3300047471 Ga0495684_0016969 Ga0495684_0016969_102_1028 300
295 3300048088 Ga0495602_0008316 Ga0495602_0008316_5677_6603 300
296 3300050508 nmdc:mga09592_51954_c1 nmdc:mga09592_51954_c1_859_1776 300
297 3300050511 nmdc:mga08y16_1714_c1 nmdc:mga08y16_1714_c1_12425_13342 300
298 2162886012 MBSR1b_contig_2041644 MBSR1b_0660.00003580 302
299 2162886012 MBSR1b_contig_3720924 MBSR1b_0915.00001500 302
300 3300005293 Ga0065715_10102361 Ga0065715_101023612 302
301 3300009093 Ga0105240_10000546 Ga0105240_1000054639 302
302 3300010375 Ga0105239_10013742 Ga0105239_100137423 302
303 3300025913 Ga0207695_10000640 Ga0207695_1000064040 302
304 3300005563 Ga0068855_100007621 Ga0068855_1000076212 303
305 3300005577 Ga0068857_100605722 Ga0068857_1006057221 303
306 3300005614 Ga0068856_100000446 Ga0068856_10000044618 303
307 3300025949 Ga0207667_10028073 Ga0207667_100280733 303
308 3300026078 Ga0207702_10016155 Ga0207702_100161553 303
309 3300035088 Ga0373940_0018929 Ga0373940_0018929_24_968 303
310 3300026075 Ga0207708_10129726 Ga0207708_101297261 304
311 3300031251 Ga0265327_10000571 Ga0265327_1000057137 304
312 3300005289 Ga0065704_10122314 Ga0065704_101223142 305
313 3300045051 Ga0451576_0469011 Ga0451576_0469011_294_1211 305
314 3300053136 Ga0500559_0009906 Ga0500559_0009906_3050_4009 305
315 3300034816 Ga0373930_0000376 Ga0373930_0000376_3406_4470 328
316 3300035084 Ga0373928_0000122 Ga0373928_0000122_2831_3895 328
317 3300035085 Ga0373929_0003661 Ga0373929_0003661_412_1476 328
318 3300035089 Ga0373944_0000161 Ga0373944_0000161_9704_10768 328
319 3300035091 Ga0373951_0002331 Ga0373951_0002331_2561_3625 328
320 3300035112 Ga0373932_0000001 Ga0373932_0000001_1257805_1258869 328
321 3300035116 Ga0373945_0025362 Ga0373945_0025362_481_1545 328
322 3300035242 Ga0373962_0000013 Ga0373962_0000013_13119_14183 328
323 3300035691 Ga0373931_0000002 Ga0373931_0000002_236529_237593 328
324 3300037068 Ga0373925_0003063 Ga0373925_0003063_8115_9179 328
325 2162886007 SwRhRL2b_contig_1980541 SwRhRL2b_0422.00002660 349

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09935

DUF2167

Protein of unknown function (DUF2167)

88

334

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tsh-assembly1.cif.gz_E pilb from geobacter metallireducens bound to amp-pnp 0.6981 209 255
4n7s-assembly2.cif.gz_D crystal structure of tse3-tsi3 complex with zinc ion 0.6731 90 272
3g0k-assembly1.cif.gz_A-2 crystal structure of a protein of unknown function with a cystatin-like fold (saro_2880) from novosphingobium aromaticivorans dsm at 1.30 a resolution 0.6719 187 251
4luq-assembly2.cif.gz_D crystal structure of virulence effector tse3 in complex with neutralizer tsi3 0.6691 84 272
7onx-assembly1.cif.gz_A crystal structure of pbp3 from p. aeruginosa 0.6675 213 251
ID Description Score Start End Superfamily
af_A4I937_6_264_3.70.10.10 Alpha Beta;Box;Proliferating Cell Nuclear Antigen; 0.7678 214 251 3.70.10.10
af_P45759_80_213_3.30.450.90 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.7365 209 249 3.30.450.90
af_Q21351_28_147_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7099 195 255 3.10.450.50
af_F1QX66_321_559_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.707 199 247 2.120.10.30
3g0kA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.6872 187 252 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A6M6BE11-F1-model_v4 DUF2167 domain-containing protein 0.9494 81 237
AF-A0A4Q6DQC4-F1-model_v4 deleted 0.9473 62 290
AF-A0A6M6BE11-F1-model_v4 DUF2167 domain-containing protein 0.9318 81 237
AF-A0A379K4J8-F1-model_v4 Uncharacterized membrane-anchored protein conserved in bacteria 0.9074 61 274
AF-A0A7C9I017-F1-model_v4 DUF2167 domain-containing protein 0.8984 85 319 GO:0016020

Feature Viewer

pLDDT pTM Quality
73.19 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map