F407983

General Info

Members Datasets Scaffolds Average Seq Length
325 168 650 145

Family's Representative Sequence

Representative Sequence 3300046512|Ga0495610_0095232|Ga0495610_0095232_501_1028
Length 175
Sequence MYHREHRQEFRMTDPFLPLPAMRLSTVRRLTRRLLAILLLTLPAWPPAFAAEAGPHDPVIVVSPRNPLSALRYEQVAAIFMAQTDRFPGGAEAVALDLPPGSALRDAFYRRVADRSPALMKAYWSKMVFTGRGQPPRELHNSAAVRRMVADNPAMIGYIDRAALDASVKVLELRP

Samples

Sample ID Description Type Environment
1 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
22 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
23 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
24 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
25 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
28 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
29 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
30 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
31 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
32 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
33 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
34 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
36 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
37 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
38 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
39 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
41 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
43 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
57 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
58 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
59 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
60 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
61 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
62 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
63 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
64 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
65 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
66 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
67 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
68 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
69 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
70 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
71 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
72 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
73 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
74 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
75 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
76 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
77 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
78 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
79 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
80 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
81 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
82 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
83 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
84 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
85 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
86 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
87 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
88 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
89 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
90 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
91 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
92 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
93 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
94 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
95 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
96 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
97 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
98 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
99 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
100 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
101 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
102 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
103 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
104 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
105 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
106 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
107 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
108 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
109 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
110 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
111 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
112 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
113 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
114 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
115 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
116 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
117 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
118 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
119 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
120 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
121 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
122 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
123 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
124 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
125 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
126 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
127 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
128 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
129 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
130 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
131 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
132 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
133 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
134 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
135 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
136 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
137 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
149 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
150 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
151 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
154 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
158 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
159 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
160 2643221684 Massilia sp. Root133 Isolate Unclassified
161 2738541297 Duganella sp. GV083 Isolate Unclassified
162 2738541357 Duganella sp. GV053 Isolate Unclassified
163 2738543003 Duganella sp. GV066 Isolate Unclassified
164 2738543026 Duganella sp. GV089 Isolate Unclassified
165 2738543029 Duganella sp. GV039 Isolate Unclassified
166 2842711865 Duganella sp. R-73148 Isolate Unclassified
167 2857558681 Duganella sp. R-74565 Isolate Unclassified
168 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.23
Metatranscriptomes 0
Isolates 2.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8
Nodule 0.62
Rhizoplane 3.69
Rhizosphere 80.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495610_0095232 3300046512 Bacteria 1342
2 rootL2_10057617 3300003322 Bacteria 8818
3 rootL2_10143604 3300003322 Bacteria 2942
4 Ga0055529_1000917 3300003763 Bacteria 16049
5 Ga0055526_1000120 3300003771 Bacteria 68989
6 Ga0055537_1000179 3300003773 Bacteria 47132
7 Ga0055524_1007957 3300003775 Bacteria 4450
8 Ga0055534_1000495 3300003784 Bacteria 21714
9 Ga0055528_1000119 3300003790 Bacteria 62428
10 Ga0065165_1000039 3300005262 Bacteria 208372
11 Ga0070658_10050913 3300005327 Bacteria 3357
12 Ga0070658_10142064 3300005327 Bacteria 2006
13 Ga0070658_10344577 3300005327 Bacteria 1275
14 Ga0070676_10994954 3300005328 Bacteria 629
15 Ga0068869_101350409 3300005334 Bacteria 630
16 Ga0070660_100040609 3300005339 Bacteria 3542
17 Ga0070660_100076227 3300005339 Bacteria 2626
18 Ga0070692_11199343 3300005345 Bacteria 540
19 Ga0070659_100013628 3300005366 Bacteria 6057
20 Ga0070659_100105305 3300005366 Bacteria 2273
21 Ga0070679_100706266 3300005530 Bacteria 951
22 Ga0068855_100037644 3300005563 Bacteria 5751
23 Ga0068855_101013773 3300005563 Bacteria 872
24 Ga0070664_100322123 3300005564 Bacteria 1401
25 Ga0068852_100052606 3300005616 Bacteria 3500
26 Ga0070717_10153109 3300006028 Bacteria 1996
27 Ga0075362_10015726 3300006177 Bacteria 3083
28 Ga0099826_10000001 3300006948 Bacteria 1155201
29 Ga0105244_10010503 3300009036 Bacteria 5612
30 Ga0105243_10071091 3300009148 Bacteria 2812
31 Ga0105242_10012260 3300009176 Bacteria 6598
32 Ga0105239_10135143 3300010375 Bacteria 2745
33 Ga0157371_10000018 3300013102 Bacteria 310522
34 Ga0182006_1027566 3300015261 Bacteria 2316
35 Ga0182007_10044073 3300015262 Bacteria 1481
36 Ga0182007_10066299 3300015262 Bacteria 1183
37 Ga0163161_10133639 3300017792 Bacteria 1873
38 Ga0209437_107172 3300025233 Bacteria 1825
39 Ga0207425_1000198 3300025245 Bacteria 48223
40 Ga0209565_1000003 3300025263 Bacteria 1099648
41 Ga0209565_1003750 3300025263 Bacteria 4810
42 Ga0209455_1000026 3300025272 Bacteria 653778
43 Ga0209673_1000003 3300025273 Bacteria 980859
44 Ga0209130_1000084 3300025284 Bacteria 160070
45 Ga0209675_1000003 3300025291 Bacteria 1003982
46 Ga0209025_1008142 3300025294 Bacteria 7609
47 Ga0209564_1000002 3300025295 Bacteria 1636803
48 Ga0209564_1000012 3300025295 Bacteria 792078
49 Ga0209564_1012821 3300025295 Bacteria 3618
50 Ga0209758_1001300 3300025297 Bacteria 30598
51 Ga0209256_1000005 3300025299 Bacteria 1315082
52 Ga0209256_1000295 3300025299 Bacteria 87239
53 Ga0207426_1006899 3300025302 Bacteria 4837
54 Ga0207655_1039115 3300025728 Bacteria 2064
55 Ga0207705_10001157 3300025909 Bacteria 21460
56 Ga0207705_10093901 3300025909 Bacteria 2199
57 Ga0207654_10149685 3300025911 Bacteria 1497
58 Ga0207671_10161527 3300025914 Bacteria 1735
59 Ga0207657_10031740 3300025919 Bacteria 4780
60 Ga0207657_10417258 3300025919 Bacteria 1055
61 Ga0207649_10061978 3300025920 Bacteria 2356
62 Ga0207706_10135685 3300025933 Bacteria 2165
63 Ga0207686_10012247 3300025934 Bacteria 4712
64 Ga0207709_10492472 3300025935 Bacteria 955
65 Ga0207704_10099755 3300025938 Bacteria 1932
66 Ga0207667_10015776 3300025949 Bacteria 8566
67 Ga0207667_10548544 3300025949 Bacteria 1169
68 Ga0207702_11545835 3300026078 Bacteria 657
69 Ga0207698_11624845 3300026142 Bacteria 662
70 Ga0209282_1000001 3300027666 Bacteria 2450367
71 Ga0316181_1077985 3300030744 Bacteria 2242
72 Ga0307406_11279507 3300031901 Bacteria 639
73 Ga0395899_0012541 3300037312 Bacteria 6497
74 Ga0395899_0036371 3300037312 Bacteria 3693
75 Ga0395900_0004864 3300037418 Bacteria 14154
76 Ga0395900_0017833 3300037418 Bacteria 7245
77 Ga0395900_0508884 3300037418 Bacteria 1153
78 Ga0395898_0067597 3300037466 Bacteria 3459
79 Ga0395898_0104716 3300037466 Bacteria 2713
80 Ga0395898_0471762 3300037466 Bacteria 1194
81 Ga0395898_0525131 3300037466 Bacteria 1125
82 Ga0395905_0035041 3300037471 Bacteria 4712
83 Ga0395905_0148743 3300037471 Bacteria 2203
84 Ga0395901_0002619 3300038443 Bacteria 18198
85 Ga0395901_0174997 3300038443 Bacteria 2251
86 Ga0395901_0525606 3300038443 Bacteria 1201
87 Ga0436363_0453409 3300039450 Bacteria 538
88 Ga0439448_0028890 3300042005 Bacteria 1753
89 Ga0439448_0041562 3300042005 Bacteria 1488
90 Ga0439450_002201 3300042008 Bacteria 3026
91 Ga0439458_0032241 3300042157 Bacteria 1252
92 Ga0466972_0195037 3300044658 Bacteria 949
93 Ga0466982_0023689 3300044672 Bacteria 3550
94 Ga0466965_0066674 3300044683 Bacteria 1805
95 Ga0466966_0105916 3300044684 Bacteria 1735
96 Ga0466966_0108493 3300044684 Bacteria 1712
97 Ga0466966_0178881 3300044684 Bacteria 1287
98 Ga0466961_0061094 3300044693 Bacteria 2395
99 Ga0466961_0128302 3300044693 Bacteria 1590
100 Ga0466971_0054788 3300044719 Bacteria 1797
101 Ga0466971_0113969 3300044719 Bacteria 1249
102 Ga0466971_0182417 3300044719 Bacteria 987
103 Ga0466971_0429667 3300044719 Bacteria 646
104 Ga0466970_0020288 3300044765 Bacteria 3452
105 Ga0466970_0069498 3300044765 Bacteria 1893
106 Ga0466970_0106466 3300044765 Bacteria 1530
107 Ga0466970_0116526 3300044765 Bacteria 1461
108 Ga0466957_0029308 3300044842 Bacteria 3281
109 Ga0466957_0124424 3300044842 Bacteria 1646
110 Ga0466957_0807865 3300044842 Bacteria 666
111 Ga0466960_0286293 3300044901 Bacteria 925
112 Ga0466959_0120217 3300045049 Bacteria 1868
113 Ga0466959_0147514 3300045049 Bacteria 1659
114 Ga0466959_0633094 3300045049 Bacteria 718
115 Ga0466967_0013183 3300045976 Bacteria 6373
116 Ga0466967_0303710 3300045976 Bacteria 1536
117 Ga0495617_001350 3300046452 Bacteria 10873
118 Ga0495627_000228 3300046453 Bacteria 59535
119 Ga0495603_0036400 3300046455 Bacteria 2955
120 Ga0495590_0020337 3300046457 Bacteria 2360
121 Ga0495638_0000157 3300046460 Bacteria 107187
122 Ga0495638_0122219 3300046460 Bacteria 1537
123 Ga0495650_0000159 3300046471 Bacteria 152501
124 Ga0495650_0000410 3300046471 Bacteria 70515
125 Ga0495605_0000046 3300046474 Bacteria 175985
126 Ga0495605_0000183 3300046474 Bacteria 77763
127 Ga0495639_0031954 3300046475 Bacteria 2346
128 Ga0495584_0000597 3300046491 Bacteria 24296
129 Ga0495584_0051607 3300046491 Bacteria 2070
130 Ga0495584_0060990 3300046491 Bacteria 1896
131 Ga0495585_0000010 3300046492 Bacteria 229958
132 Ga0495585_0001850 3300046492 Bacteria 16006
133 Ga0495585_0001938 3300046492 Bacteria 15469
134 Ga0495585_0036013 3300046492 Bacteria 2795
135 Ga0495585_0370120 3300046492 Bacteria 693
136 Ga0495596_0000893 3300046500 Bacteria 17914
137 Ga0495596_0001921 3300046500 Bacteria 11512
138 Ga0495596_0019097 3300046500 Bacteria 2820
139 Ga0495607_0001028 3300046501 Bacteria 25612
140 Ga0495607_0001319 3300046501 Bacteria 22110
141 Ga0495607_0001945 3300046501 Bacteria 17457
142 Ga0495607_0003485 3300046501 Bacteria 12045
143 Ga0495607_0003486 3300046501 Bacteria 12045
144 Ga0495607_0016650 3300046501 Bacteria 4740
145 Ga0495607_0232494 3300046501 Bacteria 896
146 Ga0495583_0000006 3300046506 Bacteria 436893
147 Ga0495583_0001816 3300046506 Bacteria 20059
148 Ga0495606_0000088 3300046507 Bacteria 155985
149 Ga0495606_0000103 3300046507 Bacteria 145893
150 Ga0495606_0002016 3300046507 Bacteria 24929
151 Ga0495610_0000008 3300046512 Bacteria 622732
152 Ga0495610_0003032 3300046512 Bacteria 13450
153 Ga0495610_0094166 3300046512 Bacteria 1352
154 Ga0495616_0000335 3300046513 Bacteria 37189
155 Ga0495616_0001486 3300046513 Bacteria 16254
156 Ga0495616_0002365 3300046513 Bacteria 12564
157 Ga0495616_0004047 3300046513 Bacteria 9315
158 Ga0495616_0008930 3300046513 Bacteria 5889
159 Ga0495616_0016579 3300046513 Bacteria 4075
160 Ga0495616_0065532 3300046513 Bacteria 1769
161 Ga0495616_0189259 3300046513 Bacteria 910
162 Ga0495631_0004873 3300046518 Bacteria 7064
163 Ga0495631_0064427 3300046518 Bacteria 1586
164 Ga0495632_0000291 3300046519 Bacteria 48631
165 Ga0495637_0004454 3300046520 Bacteria 7257
166 Ga0495643_0000117 3300046522 Bacteria 129698
167 Ga0495643_0000386 3300046522 Bacteria 58386
168 Ga0495643_0003893 3300046522 Bacteria 10713
169 Ga0495643_0019384 3300046522 Bacteria 3936
170 Ga0495643_0020617 3300046522 Bacteria 3797
171 Ga0495644_0016898 3300046523 Bacteria 2792
172 Ga0495644_0075927 3300046523 Bacteria 1265
173 Ga0495648_0000003 3300046524 Bacteria 386817
174 Ga0495648_0000648 3300046524 Bacteria 37132
175 Ga0495648_0000815 3300046524 Bacteria 32978
176 Ga0495648_0001741 3300046524 Bacteria 21023
177 Ga0495648_0006405 3300046524 Bacteria 9615
178 Ga0495648_0006573 3300046524 Bacteria 9456
179 Ga0495663_0010441 3300046525 Bacteria 2584
180 Ga0495663_0220642 3300046525 Bacteria 666
181 Ga0495666_0018048 3300046526 Bacteria 3514
182 Ga0495642_0000013 3300046528 Bacteria 123896
183 Ga0495642_0008861 3300046528 Bacteria 3848
184 Ga0495642_0018178 3300046528 Bacteria 2750
185 Ga0495642_0044213 3300046528 Bacteria 1818
186 Ga0495642_0054030 3300046528 Bacteria 1656
187 Ga0495642_0124777 3300046528 Bacteria 1106
188 Ga0495654_0004344 3300046530 Bacteria 8435
189 Ga0495654_0030883 3300046530 Bacteria 2722
190 Ga0495665_0010057 3300046531 Bacteria 5126
191 Ga0495586_0034303 3300046535 Bacteria 2725
192 Ga0495609_0000250 3300046538 Bacteria 50865
193 Ga0495609_0001665 3300046538 Bacteria 14427
194 Ga0495609_0023076 3300046538 Bacteria 2860
195 Ga0495609_0042612 3300046538 Bacteria 2038
196 Ga0495609_0188430 3300046538 Bacteria 866
197 Ga0495597_0000159 3300046542 Bacteria 59699
198 Ga0495597_0000761 3300046542 Bacteria 25457
199 Ga0495597_0068021 3300046542 Bacteria 1540
200 Ga0495597_0069477 3300046542 Bacteria 1520
201 Ga0495622_0000048 3300046557 Bacteria 108955
202 Ga0495633_0004722 3300046558 Bacteria 8562
203 Ga0495633_0005744 3300046558 Bacteria 7499
204 Ga0495633_0012255 3300046558 Bacteria 4570
205 Ga0495633_0013450 3300046558 Bacteria 4313
206 Ga0495633_0066720 3300046558 Bacteria 1680
207 Ga0495656_0037211 3300046615 Bacteria 2008
208 Ga0495656_0112739 3300046615 Bacteria 1274
209 Ga0495668_0000373 3300046616 Bacteria 59298
210 Ga0495668_0000428 3300046616 Bacteria 54563
211 Ga0495668_0001093 3300046616 Bacteria 28137
212 Ga0495668_0136905 3300046616 Bacteria 1340
213 Ga0495611_0046280 3300046648 Bacteria 1950
214 Ga0495625_0000241 3300046660 Bacteria 85835
215 Ga0495625_0003570 3300046660 Bacteria 15339
216 Ga0495625_0005901 3300046660 Bacteria 11022
217 Ga0495659_0001006 3300046664 Bacteria 9846
218 Ga0495661_0003185 3300046665 Bacteria 12269
219 Ga0495661_0009116 3300046665 Bacteria 6822
220 Ga0495661_0009433 3300046665 Bacteria 6699
221 Ga0495661_0023092 3300046665 Bacteria 4041
222 Ga0495661_0023578 3300046665 Bacteria 3993
223 Ga0495661_0029999 3300046665 Bacteria 3465
224 Ga0495661_0062285 3300046665 Bacteria 2210
225 Ga0495661_0321220 3300046665 Bacteria 769
226 Ga0495588_0000078 3300046674 Bacteria 214254
227 Ga0495588_0054961 3300046674 Bacteria 2054
228 Ga0495669_0020968 3300046684 Bacteria 2832
229 Ga0495670_0056295 3300046691 Bacteria 1972
230 Ga0495670_0088154 3300046691 Bacteria 1586
231 Ga0495671_0000002 3300046692 Bacteria 1136189
232 Ga0495671_0000989 3300046692 Bacteria 19828
233 Ga0495671_0003846 3300046692 Bacteria 9123
234 Ga0495671_0014763 3300046692 Bacteria 4197
235 Ga0495649_0010354 3300046694 Bacteria 5508
236 Ga0495649_0232022 3300046694 Bacteria 952
237 Ga0495649_0251133 3300046694 Bacteria 908
238 Ga0495589_0000472 3300046794 Bacteria 29346
239 Ga0495589_0001108 3300046794 Bacteria 16056
240 Ga0495589_0226984 3300046794 Bacteria 876
241 Ga0495660_0000252 3300046810 Bacteria 51417
242 Ga0495660_0012485 3300046810 Bacteria 4931
243 Ga0495660_0028881 3300046810 Bacteria 3131
244 Ga0495660_0107315 3300046810 Bacteria 1429
245 Ga0495581_0062230 3300047315 Bacteria 2156
246 Ga0495636_0014380 3300047318 Bacteria 3146
247 Ga0495672_0000165 3300047320 Bacteria 96215
248 Ga0495672_0000325 3300047320 Bacteria 63353
249 Ga0495672_0001165 3300047320 Bacteria 26623
250 Ga0495672_0001467 3300047320 Bacteria 23143
251 Ga0495672_0085777 3300047320 Bacteria 1744
252 Ga0495676_0155632 3300047321 Bacteria 1622
253 Ga0495676_0330906 3300047321 Bacteria 1021
254 Ga0495683_0002344 3300047323 Bacteria 11503
255 Ga0495683_0004064 3300047323 Bacteria 8387
256 Ga0495683_0007167 3300047323 Bacteria 6049
257 Ga0495683_0150419 3300047323 Bacteria 1084
258 Ga0495687_001288 3300047443 Bacteria 23563
259 Ga0495687_001505 3300047443 Bacteria 21228
260 Ga0495687_001508 3300047443 Bacteria 21220
261 Ga0495687_018683 3300047443 Bacteria 3419
262 Ga0495687_055729 3300047443 Bacteria 1651
263 Ga0495675_0382214 3300047444 Bacteria 823
264 Ga0495677_0000713 3300047445 Bacteria 13427
265 Ga0495677_0001179 3300047445 Bacteria 10470
266 Ga0495677_0003495 3300047445 Bacteria 6096
267 Ga0495677_0012939 3300047445 Bacteria 3038
268 Ga0495677_0039384 3300047445 Bacteria 1728
269 Ga0495677_0065641 3300047445 Bacteria 1349
270 Ga0495677_0304534 3300047445 Bacteria 627
271 Ga0495679_007893 3300047446 Bacteria 4384
272 Ga0495679_082566 3300047446 Bacteria 910
273 Ga0495673_0000005 3300047469 Bacteria 943364
274 Ga0495673_0000064 3300047469 Bacteria 225793
275 Ga0495681_0002833 3300047470 Bacteria 12257
276 Ga0495686_0001699 3300047472 Bacteria 22746
277 Ga0495686_0026781 3300047472 Bacteria 3771
278 Ga0495686_0096937 3300047472 Bacteria 1784
279 Ga0495593_0063795 3300047673 Bacteria 1923
280 Ga0495615_0005511 3300048090 Bacteria 2280
281 Ga0495626_0000003 3300048091 Bacteria 427774
282 Ga0495626_0000028 3300048091 Bacteria 204580
283 Ga0495626_0003690 3300048091 Bacteria 9698
284 Ga0495626_0111519 3300048091 Bacteria 1184
285 Ga0495626_0144861 3300048091 Bacteria 1005
286 Ga0496102_0314286 3300048905 Bacteria 1476
287 Ga0496104_1845413 3300048907 Bacteria 506
288 Ga0496105_0649356 3300048908 Bacteria 814
289 Ga0496105_0957411 3300048908 Bacteria 642
290 Ga0496106_0303500 3300048909 Bacteria 1281
291 Ga0496107_0066187 3300048910 Bacteria 2620
292 Ga0496109_0706530 3300048912 Bacteria 946
293 Ga0496110_0163237 3300048913 Bacteria 2020
294 Ga0496112_0147148 3300048915 Bacteria 2324
295 Ga0496114_0057224 3300048917 Bacteria 3255
296 Ga0496115_0546330 3300048918 Bacteria 926
297 Ga0496115_0808639 3300048918 Bacteria 729
298 Ga0496121_0433836 3300048924 Bacteria 851
299 Ga0496122_0057704 3300048925 Bacteria 2880
300 Ga0496122_0069601 3300048925 Bacteria 2519
301 Ga0496123_0005050 3300048926 Bacteria 13496
302 Ga0496124_0018809 3300048927 Bacteria 6453
303 Ga0496124_0021884 3300048927 Bacteria 5881
304 Ga0496124_0022964 3300048927 Bacteria 5707
305 Ga0496124_0030296 3300048927 Bacteria 4805
306 Ga0496124_0087008 3300048927 Bacteria 2556
307 Ga0496126_0006011 3300048929 Bacteria 13633
308 Ga0495678_000103 3300049459 Bacteria 103891
309 Ga0495678_020401 3300049459 Bacteria 2935
310 Ga0495678_042565 3300049459 Bacteria 1809
311 Ga0495682_0066433 3300049460 Bacteria 1300
312 Ga0501036_0046266 3300049572 Bacteria 3685
313 Ga0501080_0021599 3300049742 Bacteria 5958
314 Ga0501269_000197 3300049766 Bacteria 18175
315 nmdc:mga03683_48322_c1 3300050489 Bacteria 1768
316 Ga0500618_011074 3300053125 Bacteria 2402
317 2644472141 2643221684 Bacteria 7145183
318 2738828673 2738541297 Bacteria 6549566
319 2739152469 2738541357 Bacteria 6549408
320 2739194389 2738543003 Bacteria 6549560
321 2739320865 2738543026 Bacteria 6549408
322 2739339106 2738543029 Bacteria 6549249
323 2842714605 2842711865 Bacteria 7155354
324 2857562843 2857558681 Bacteria 6617694
325 8047675259 8047673197 Bacteria 7395230
326 Ga0495610_0095232
327 rootL2_10057617
328 rootL2_10143604
329 Ga0055529_1000917
330 Ga0055526_1000120
331 Ga0055537_1000179
332 Ga0055524_1007957
333 Ga0055534_1000495
334 Ga0055528_1000119
335 Ga0065165_1000039
336 Ga0070658_10050913
337 Ga0070658_10142064
338 Ga0070658_10344577
339 Ga0070676_10994954
340 Ga0068869_101350409
341 Ga0070660_100040609
342 Ga0070660_100076227
343 Ga0070692_11199343
344 Ga0070659_100013628
345 Ga0070659_100105305
346 Ga0070679_100706266
347 Ga0068855_100037644
348 Ga0068855_101013773
349 Ga0070664_100322123
350 Ga0068852_100052606
351 Ga0070717_10153109
352 Ga0075362_10015726
353 Ga0099826_10000001
354 Ga0105244_10010503
355 Ga0105243_10071091
356 Ga0105242_10012260
357 Ga0105239_10135143
358 Ga0157371_10000018
359 Ga0182006_1027566
360 Ga0182007_10044073
361 Ga0182007_10066299
362 Ga0163161_10133639
363 Ga0209437_107172
364 Ga0207425_1000198
365 Ga0209565_1000003
366 Ga0209565_1003750
367 Ga0209455_1000026
368 Ga0209673_1000003
369 Ga0209130_1000084
370 Ga0209675_1000003
371 Ga0209025_1008142
372 Ga0209564_1000002
373 Ga0209564_1000012
374 Ga0209564_1012821
375 Ga0209758_1001300
376 Ga0209256_1000005
377 Ga0209256_1000295
378 Ga0207426_1006899
379 Ga0207655_1039115
380 Ga0207705_10001157
381 Ga0207705_10093901
382 Ga0207654_10149685
383 Ga0207671_10161527
384 Ga0207657_10031740
385 Ga0207657_10417258
386 Ga0207649_10061978
387 Ga0207706_10135685
388 Ga0207686_10012247
389 Ga0207709_10492472
390 Ga0207704_10099755
391 Ga0207667_10015776
392 Ga0207667_10548544
393 Ga0207702_11545835
394 Ga0207698_11624845
395 Ga0209282_1000001
396 Ga0316181_1077985
397 Ga0307406_11279507
398 Ga0395899_0012541
399 Ga0395899_0036371
400 Ga0395900_0004864
401 Ga0395900_0017833
402 Ga0395900_0508884
403 Ga0395898_0067597
404 Ga0395898_0104716
405 Ga0395898_0471762
406 Ga0395898_0525131
407 Ga0395905_0035041
408 Ga0395905_0148743
409 Ga0395901_0002619
410 Ga0395901_0174997
411 Ga0395901_0525606
412 Ga0436363_0453409
413 Ga0439448_0028890
414 Ga0439448_0041562
415 Ga0439450_002201
416 Ga0439458_0032241
417 Ga0466972_0195037
418 Ga0466982_0023689
419 Ga0466965_0066674
420 Ga0466966_0105916
421 Ga0466966_0108493
422 Ga0466966_0178881
423 Ga0466961_0061094
424 Ga0466961_0128302
425 Ga0466971_0054788
426 Ga0466971_0113969
427 Ga0466971_0182417
428 Ga0466971_0429667
429 Ga0466970_0020288
430 Ga0466970_0069498
431 Ga0466970_0106466
432 Ga0466970_0116526
433 Ga0466957_0029308
434 Ga0466957_0124424
435 Ga0466957_0807865
436 Ga0466960_0286293
437 Ga0466959_0120217
438 Ga0466959_0147514
439 Ga0466959_0633094
440 Ga0466967_0013183
441 Ga0466967_0303710
442 Ga0495617_001350
443 Ga0495627_000228
444 Ga0495603_0036400
445 Ga0495590_0020337
446 Ga0495638_0000157
447 Ga0495638_0122219
448 Ga0495650_0000159
449 Ga0495650_0000410
450 Ga0495605_0000046
451 Ga0495605_0000183
452 Ga0495639_0031954
453 Ga0495584_0000597
454 Ga0495584_0051607
455 Ga0495584_0060990
456 Ga0495585_0000010
457 Ga0495585_0001850
458 Ga0495585_0001938
459 Ga0495585_0036013
460 Ga0495585_0370120
461 Ga0495596_0000893
462 Ga0495596_0001921
463 Ga0495596_0019097
464 Ga0495607_0001028
465 Ga0495607_0001319
466 Ga0495607_0001945
467 Ga0495607_0003485
468 Ga0495607_0003486
469 Ga0495607_0016650
470 Ga0495607_0232494
471 Ga0495583_0000006
472 Ga0495583_0001816
473 Ga0495606_0000088
474 Ga0495606_0000103
475 Ga0495606_0002016
476 Ga0495610_0000008
477 Ga0495610_0003032
478 Ga0495610_0094166
479 Ga0495616_0000335
480 Ga0495616_0001486
481 Ga0495616_0002365
482 Ga0495616_0004047
483 Ga0495616_0008930
484 Ga0495616_0016579
485 Ga0495616_0065532
486 Ga0495616_0189259
487 Ga0495631_0004873
488 Ga0495631_0064427
489 Ga0495632_0000291
490 Ga0495637_0004454
491 Ga0495643_0000117
492 Ga0495643_0000386
493 Ga0495643_0003893
494 Ga0495643_0019384
495 Ga0495643_0020617
496 Ga0495644_0016898
497 Ga0495644_0075927
498 Ga0495648_0000003
499 Ga0495648_0000648
500 Ga0495648_0000815
501 Ga0495648_0001741
502 Ga0495648_0006405
503 Ga0495648_0006573
504 Ga0495663_0010441
505 Ga0495663_0220642
506 Ga0495666_0018048
507 Ga0495642_0000013
508 Ga0495642_0008861
509 Ga0495642_0018178
510 Ga0495642_0044213
511 Ga0495642_0054030
512 Ga0495642_0124777
513 Ga0495654_0004344
514 Ga0495654_0030883
515 Ga0495665_0010057
516 Ga0495586_0034303
517 Ga0495609_0000250
518 Ga0495609_0001665
519 Ga0495609_0023076
520 Ga0495609_0042612
521 Ga0495609_0188430
522 Ga0495597_0000159
523 Ga0495597_0000761
524 Ga0495597_0068021
525 Ga0495597_0069477
526 Ga0495622_0000048
527 Ga0495633_0004722
528 Ga0495633_0005744
529 Ga0495633_0012255
530 Ga0495633_0013450
531 Ga0495633_0066720
532 Ga0495656_0037211
533 Ga0495656_0112739
534 Ga0495668_0000373
535 Ga0495668_0000428
536 Ga0495668_0001093
537 Ga0495668_0136905
538 Ga0495611_0046280
539 Ga0495625_0000241
540 Ga0495625_0003570
541 Ga0495625_0005901
542 Ga0495659_0001006
543 Ga0495661_0003185
544 Ga0495661_0009116
545 Ga0495661_0009433
546 Ga0495661_0023092
547 Ga0495661_0023578
548 Ga0495661_0029999
549 Ga0495661_0062285
550 Ga0495661_0321220
551 Ga0495588_0000078
552 Ga0495588_0054961
553 Ga0495669_0020968
554 Ga0495670_0056295
555 Ga0495670_0088154
556 Ga0495671_0000002
557 Ga0495671_0000989
558 Ga0495671_0003846
559 Ga0495671_0014763
560 Ga0495649_0010354
561 Ga0495649_0232022
562 Ga0495649_0251133
563 Ga0495589_0000472
564 Ga0495589_0001108
565 Ga0495589_0226984
566 Ga0495660_0000252
567 Ga0495660_0012485
568 Ga0495660_0028881
569 Ga0495660_0107315
570 Ga0495581_0062230
571 Ga0495636_0014380
572 Ga0495672_0000165
573 Ga0495672_0000325
574 Ga0495672_0001165
575 Ga0495672_0001467
576 Ga0495672_0085777
577 Ga0495676_0155632
578 Ga0495676_0330906
579 Ga0495683_0002344
580 Ga0495683_0004064
581 Ga0495683_0007167
582 Ga0495683_0150419
583 Ga0495687_001288
584 Ga0495687_001505
585 Ga0495687_001508
586 Ga0495687_018683
587 Ga0495687_055729
588 Ga0495675_0382214
589 Ga0495677_0000713
590 Ga0495677_0001179
591 Ga0495677_0003495
592 Ga0495677_0012939
593 Ga0495677_0039384
594 Ga0495677_0065641
595 Ga0495677_0304534
596 Ga0495679_007893
597 Ga0495679_082566
598 Ga0495673_0000005
599 Ga0495673_0000064
600 Ga0495681_0002833
601 Ga0495686_0001699
602 Ga0495686_0026781
603 Ga0495686_0096937
604 Ga0495593_0063795
605 Ga0495615_0005511
606 Ga0495626_0000003
607 Ga0495626_0000028
608 Ga0495626_0003690
609 Ga0495626_0111519
610 Ga0495626_0144861
611 Ga0496102_0314286
612 Ga0496104_1845413
613 Ga0496105_0649356
614 Ga0496105_0957411
615 Ga0496106_0303500
616 Ga0496107_0066187
617 Ga0496109_0706530
618 Ga0496110_0163237
619 Ga0496112_0147148
620 Ga0496114_0057224
621 Ga0496115_0546330
622 Ga0496115_0808639
623 Ga0496121_0433836
624 Ga0496122_0057704
625 Ga0496122_0069601
626 Ga0496123_0005050
627 Ga0496124_0018809
628 Ga0496124_0021884
629 Ga0496124_0022964
630 Ga0496124_0030296
631 Ga0496124_0087008
632 Ga0496126_0006011
633 Ga0495678_000103
634 Ga0495678_020401
635 Ga0495678_042565
636 Ga0495682_0066433
637 Ga0501036_0046266
638 Ga0501080_0021599
639 Ga0501269_000197
640 nmdc:mga03683_48322_c1
641 Ga0500618_011074
642 2644472141
643 2738828673
644 2739152469
645 2739194389
646 2739320865
647 2739339106
648 2842714605
649 2857562843
650 8047675259

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ecf-assembly1.cif.gz_A crystal structure of an abc-type phosphate transport system, periplasmic component (lvis_0633) from lactobacillus brevis atcc 367 at 1.55 a resolution 0.8491 26 143
1twy-assembly10.cif.gz_B crystal structure of an abc-type phosphate transport receptor from vibrio cholerae 0.8136 26 143
4exl-assembly3.cif.gz_C crystal structure of phosphate abc transporter, periplasmic phosphate-binding protein psts 1 (pbp1) from streptococcus pneumoniae canada mdr_19a 0.8112 26 143
4gd5-assembly1.cif.gz_A x-ray crystal structure of a putative phosphate abc transporter substrate-binding protein with bound phosphate from clostridium perfringens 0.8012 26 143
1twy-assembly1.cif.gz_A crystal structure of an abc-type phosphate transport receptor from vibrio cholerae 0.779 26 143
ID Description Score Start End Superfamily
4q8rA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8568 29 143 3.40.190.10
4ecfA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8427 27 143 3.40.190.10
4exlD02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8067 27 143 3.40.190.10
2mh2A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7785 80 102 1.10.10.10
1twyH02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7685 29 143 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A3A3FWM2-F1-model_v4 Phosphate ABC transporter substrate-binding protein 0.9878 21 145
AF-A0A4Q3KIP7-F1-model_v4 deleted 0.9859 24 146
AF-A0A3D6EN82-F1-model_v4 Phosphate ABC transporter substrate-binding protein 0.9857 24 145
AF-A0A7Z2W2D7-F1-model_v4 Phosphate ABC transporter substrate-binding protein 0.9838 24 146
AF-A0A242N2V9-F1-model_v4 ABC-type phosphate transport system, periplasmic component 0.9801 27 146

Map