F408015

General Info

Members Datasets Scaffolds Average Seq Length
325 123 650 584

Family's Representative Sequence

Representative Sequence 3300048913|Ga0496110_0000002|Ga0496110_0000002_2017_3933
Length 638
Sequence MFEFIRNHQRLMQFLLLLLILPSFVLVGVSQYEGRGNRDGVATVDGRSITQQEWEAAQRRQIDQARAMLGARFDQKLFDTPEAKQEVLDGLVAERAVSAEVTRNHLTVSDEALYRGIQEQTGLKKPDGSFDVEAYKAFLASQGMNAAGFEQRVRYQMAVQQLASAVQASAFAPRSVAGRLSDINDQQREVQELVFPAANYAAQVKVTDDMVKAYYDKNATLFQVPATIKAEYVVLNAEAVDKLVSVSDAEILETYNKNKARFATTEKRSASHILIAAPKDAKPADDAAAKAKAQAVLAEVQKSPNDFAKIAKAQSQDPGSAELGGDLGVVEKGLFDKPVEDAIFSLKEGQTSGLVRSSFGYHIVKLTKLVPAVQKTLEEAKPEIVADLKKTKLSNKYSELAETFTNTVYEQSDSLKPVADKLGLPIQTAEGLTATPNPALGASPVNNEKFLKAIFSPDATNNKRNTEAVEVAPSVLVAGRVVEFKPATKRPLADVADQIRGRVMQEEAVRLARQAGEAKLAAAKASGDAAGFGDVKVLSRTMEQPTINPAAAIAVLKADVSKLPAYVGVELPGQGYGVYRIGKVSLPAQPDQARRKQETEAISRAIGNAETYGYVEALKKKAKAKLNVKAADLGAKSE

Samples

Sample ID Description Type Environment
1 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
2 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
3 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
15 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
16 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
17 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
18 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
19 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
20 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
21 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
22 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
23 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
29 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
30 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
31 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
32 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
33 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
34 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
35 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
36 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
37 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
38 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
39 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
40 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
41 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
42 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
43 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
44 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
45 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
46 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
47 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
48 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
49 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
50 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
51 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
52 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
53 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
54 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
55 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
56 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
57 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
58 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
59 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
60 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
61 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
62 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
63 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
64 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
65 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
66 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
67 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
68 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
69 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
70 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
71 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
72 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
73 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
74 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
75 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
76 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
77 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
78 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
79 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
80 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
81 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
82 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
83 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
84 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
85 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
86 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
87 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
88 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
89 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
90 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
91 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
92 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
93 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
94 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
95 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
96 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
97 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
98 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
99 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
100 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
101 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
102 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
103 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
104 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
105 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
106 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
107 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
108 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
109 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
112 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
113 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
114 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
115 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
116 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
117 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
118 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
119 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
120 2643221556 Massilia sp. Root1485 Isolate Unclassified
121 2643221684 Massilia sp. Root133 Isolate Unclassified
122 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
123 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 0
Isolates 1.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.08
Nodule 0.62
Rhizoplane 4
Rhizosphere 84.62
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496110_0000002 3300048913 Bacteria 166613
2 Ga0055525_1000008 3300003759 Bacteria 604287
3 Ga0055529_1000060 3300003763 Bacteria 191230
4 Ga0055526_1001605 3300003771 Bacteria 15871
5 Ga0055526_1003085 3300003771 Bacteria 10822
6 Ga0055537_1000505 3300003773 Bacteria 23525
7 Ga0055524_1000028 3300003775 Bacteria 206096
8 Ga0055524_1000112 3300003775 Bacteria 95840
9 Ga0055524_1016344 3300003775 Bacteria 2666
10 Ga0055534_1000323 3300003784 Bacteria 31797
11 Ga0055534_1000668 3300003784 Bacteria 17256
12 Ga0055528_1000013 3300003790 Bacteria 176239
13 Ga0065165_1003986 3300005262 Bacteria 9653
14 Ga0070658_10127198 3300005327 Bacteria 2121
15 Ga0070660_100075824 3300005339 Bacteria 2633
16 Ga0070659_100015379 3300005366 Bacteria 5731
17 Ga0070659_100039121 3300005366 Bacteria 3701
18 Ga0068855_100086636 3300005563 Bacteria 3621
19 Ga0099826_10000001 3300006948 Bacteria 1155201
20 Ga0209563_100003 3300025230 Bacteria 1932942
21 Ga0209148_1000892 3300025254 Bacteria 20352
22 Ga0209565_1000003 3300025263 Bacteria 1099648
23 Ga0209565_1003711 3300025263 Bacteria 4848
24 Ga0209455_1000026 3300025272 Bacteria 653778
25 Ga0209673_1000003 3300025273 Bacteria 980859
26 Ga0209675_1000003 3300025291 Bacteria 1003982
27 Ga0209564_1000012 3300025295 Bacteria 792078
28 Ga0209564_1012618 3300025295 Bacteria 3666
29 Ga0209256_1000007 3300025299 Bacteria 1136599
30 Ga0209256_1015447 3300025299 Bacteria 2669
31 Ga0207705_10110760 3300025909 Bacteria 2028
32 Ga0207657_10045965 3300025919 Bacteria 3827
33 Ga0207679_10038335 3300025945 Bacteria 3413
34 Ga0207667_10043282 3300025949 Bacteria 4779
35 Ga0207648_10053474 3300026089 Bacteria 3530
36 Ga0209282_1000001 3300027666 Bacteria 2450367
37 Ga0395899_0000012 3300037312 Bacteria 517561
38 Ga0395899_0027912 3300037312 Bacteria 4251
39 Ga0395900_0000028 3300037418 Bacteria 285042
40 Ga0395900_0125310 3300037418 Bacteria 2634
41 Ga0395898_0114222 3300037466 Bacteria 2587
42 Ga0395898_0122973 3300037466 Bacteria 2486
43 Ga0395905_0013934 3300037471 Bacteria 7689
44 Ga0395905_0015415 3300037471 Bacteria 7265
45 Ga0395901_0000191 3300038443 Bacteria 78454
46 Ga0395901_0018879 3300038443 Bacteria 7048
47 Ga0395901_0157814 3300038443 Bacteria 2382
48 Ga0439448_0000423 3300042005 Bacteria 9726
49 Ga0439448_0010934 3300042005 Bacteria 2699
50 Ga0439450_001495 3300042008 Bacteria 3439
51 Ga0466972_0011237 3300044658 Bacteria 4494
52 Ga0466965_0008418 3300044683 Bacteria 4773
53 Ga0466964_0002872 3300044706 Bacteria 6213
54 Ga0466964_0018752 3300044706 Bacteria 2657
55 Ga0466968_0001261 3300044735 Bacteria 9011
56 Ga0466957_0006865 3300044842 Bacteria 6434
57 Ga0466959_0078999 3300045049 Bacteria 2372
58 Ga0466967_0005033 3300045976 Bacteria 9057
59 Ga0466967_0054251 3300045976 Bacteria 3526
60 Ga0495617_000001 3300046452 Bacteria 877032
61 Ga0495617_000428 3300046452 Bacteria 22687
62 Ga0495627_001428 3300046453 Bacteria 14030
63 Ga0495603_0007339 3300046455 Bacteria 6628
64 Ga0495603_0035084 3300046455 Bacteria 3014
65 Ga0495590_0000029 3300046457 Bacteria 146662
66 Ga0495590_0001804 3300046457 Bacteria 9070
67 Ga0495591_000359 3300046458 Bacteria 39622
68 Ga0495629_0028043 3300046459 Bacteria 3998
69 Ga0495629_0067800 3300046459 Bacteria 2489
70 Ga0495653_0029751 3300046463 Bacteria 4355
71 Ga0495653_0055999 3300046463 Bacteria 3007
72 Ga0495650_0000511 3300046471 Bacteria 57834
73 Ga0495650_0022203 3300046471 Bacteria 3048
74 Ga0495580_0022677 3300046472 Bacteria 4616
75 Ga0495582_0003354 3300046473 Bacteria 9006
76 Ga0495582_0014171 3300046473 Bacteria 4387
77 Ga0495605_0000138 3300046474 Bacteria 94241
78 Ga0495605_0000304 3300046474 Bacteria 52709
79 Ga0495605_0004870 3300046474 Bacteria 7846
80 Ga0495605_0022557 3300046474 Bacteria 3323
81 Ga0495584_0000002 3300046491 Bacteria 512179
82 Ga0495584_0000615 3300046491 Bacteria 23831
83 Ga0495584_0002378 3300046491 Bacteria 10694
84 Ga0495584_0003879 3300046491 Bacteria 8103
85 Ga0495584_0007815 3300046491 Bacteria 5563
86 Ga0495584_0013439 3300046491 Bacteria 4180
87 Ga0495584_0019488 3300046491 Bacteria 3446
88 Ga0495584_0020256 3300046491 Bacteria 3380
89 Ga0495584_0020678 3300046491 Bacteria 3343
90 Ga0495584_0040669 3300046491 Bacteria 2347
91 Ga0495585_0000002 3300046492 Bacteria 529316
92 Ga0495585_0000038 3300046492 Bacteria 131919
93 Ga0495585_0000708 3300046492 Bacteria 29983
94 Ga0495585_0001767 3300046492 Bacteria 16411
95 Ga0495585_0003788 3300046492 Bacteria 10079
96 Ga0495585_0007322 3300046492 Bacteria 6766
97 Ga0495585_0014559 3300046492 Bacteria 4580
98 Ga0495585_0018582 3300046492 Bacteria 4008
99 Ga0495585_0024063 3300046492 Bacteria 3493
100 Ga0495585_0026512 3300046492 Bacteria 3310
101 Ga0495594_0010393 3300046499 Bacteria 4827
102 Ga0495594_0016450 3300046499 Bacteria 3896
103 Ga0495596_0001156 3300046500 Bacteria 15514
104 Ga0495596_0001439 3300046500 Bacteria 13633
105 Ga0495596_0006007 3300046500 Bacteria 5663
106 Ga0495596_0006617 3300046500 Bacteria 5316
107 Ga0495596_0009560 3300046500 Bacteria 4261
108 Ga0495596_0010926 3300046500 Bacteria 3934
109 Ga0495596_0012587 3300046500 Bacteria 3617
110 Ga0495607_0001847 3300046501 Bacteria 18008
111 Ga0495607_0005104 3300046501 Bacteria 9501
112 Ga0495607_0006227 3300046501 Bacteria 8414
113 Ga0495607_0006565 3300046501 Bacteria 8173
114 Ga0495607_0012953 3300046501 Bacteria 5484
115 Ga0495583_0000009 3300046506 Bacteria 372527
116 Ga0495583_0000712 3300046506 Bacteria 42668
117 Ga0495583_0001891 3300046506 Bacteria 19407
118 Ga0495583_0003655 3300046506 Bacteria 11470
119 Ga0495583_0013275 3300046506 Bacteria 4604
120 Ga0495583_0014861 3300046506 Bacteria 4263
121 Ga0495583_0016888 3300046506 Bacteria 3899
122 Ga0495583_0022097 3300046506 Bacteria 3255
123 Ga0495606_0015109 3300046507 Bacteria 5973
124 Ga0495606_0018344 3300046507 Bacteria 5252
125 Ga0495606_0021721 3300046507 Bacteria 4695
126 Ga0495616_0000037 3300046513 Bacteria 123624
127 Ga0495616_0000494 3300046513 Bacteria 30040
128 Ga0495616_0001312 3300046513 Bacteria 17377
129 Ga0495616_0002527 3300046513 Bacteria 12092
130 Ga0495616_0018533 3300046513 Bacteria 3819
131 Ga0495616_0019441 3300046513 Bacteria 3707
132 Ga0495616_0036603 3300046513 Bacteria 2531
133 Ga0495620_0016528 3300046515 Bacteria 3699
134 Ga0495630_0024887 3300046517 Bacteria 4426
135 Ga0495631_0002036 3300046518 Bacteria 11773
136 Ga0495631_0004703 3300046518 Bacteria 7212
137 Ga0495631_0004799 3300046518 Bacteria 7126
138 Ga0495631_0018841 3300046518 Bacteria 3244
139 Ga0495631_0019268 3300046518 Bacteria 3201
140 Ga0495632_0000133 3300046519 Bacteria 75692
141 Ga0495632_0000462 3300046519 Bacteria 38625
142 Ga0495632_0002361 3300046519 Bacteria 14445
143 Ga0495632_0005608 3300046519 Bacteria 8260
144 Ga0495637_0000002 3300046520 Bacteria 629280
145 Ga0495643_0000441 3300046522 Bacteria 53599
146 Ga0495643_0001739 3300046522 Bacteria 18784
147 Ga0495643_0001979 3300046522 Bacteria 17183
148 Ga0495643_0020410 3300046522 Bacteria 3819
149 Ga0495648_0000012 3300046524 Bacteria 294111
150 Ga0495648_0002845 3300046524 Bacteria 15579
151 Ga0495648_0014888 3300046524 Bacteria 5666
152 Ga0495648_0030080 3300046524 Bacteria 3597
153 Ga0495648_0039781 3300046524 Bacteria 2988
154 Ga0495648_0052956 3300046524 Bacteria 2462
155 Ga0495666_0000825 3300046526 Bacteria 14323
156 Ga0495666_0008415 3300046526 Bacteria 5172
157 Ga0495666_0013061 3300046526 Bacteria 4138
158 Ga0495642_0000009 3300046528 Bacteria 152645
159 Ga0495642_0001547 3300046528 Bacteria 10159
160 Ga0495642_0002580 3300046528 Bacteria 7318
161 Ga0495642_0007240 3300046528 Bacteria 4258
162 Ga0495642_0007974 3300046528 Bacteria 4052
163 Ga0495642_0010294 3300046528 Bacteria 3582
164 Ga0495652_0020649 3300046529 Bacteria 5855
165 Ga0495654_0003920 3300046530 Bacteria 8985
166 Ga0495654_0005022 3300046530 Bacteria 7761
167 Ga0495665_0005778 3300046531 Bacteria 6678
168 Ga0495665_0045420 3300046531 Bacteria 2333
169 Ga0495586_0003133 3300046535 Bacteria 8900
170 Ga0495586_0012279 3300046535 Bacteria 4545
171 Ga0495609_0000001 3300046538 Bacteria 1060094
172 Ga0495609_0002702 3300046538 Bacteria 10702
173 Ga0495609_0003298 3300046538 Bacteria 9311
174 Ga0495609_0009986 3300046538 Bacteria 4572
175 Ga0495597_0000145 3300046542 Bacteria 63472
176 Ga0495597_0000725 3300046542 Bacteria 26335
177 Ga0495597_0001600 3300046542 Bacteria 15896
178 Ga0495597_0002794 3300046542 Bacteria 10727
179 Ga0495597_0004631 3300046542 Bacteria 7494
180 Ga0495597_0013048 3300046542 Bacteria 3989
181 Ga0495633_0006379 3300046558 Bacteria 7002
182 Ga0495633_0006545 3300046558 Bacteria 6885
183 Ga0495633_0011664 3300046558 Bacteria 4720
184 Ga0495633_0018116 3300046558 Bacteria 3581
185 Ga0495633_0025169 3300046558 Bacteria 2932
186 Ga0495668_0000052 3300046616 Bacteria 212864
187 Ga0495668_0002533 3300046616 Bacteria 14898
188 Ga0495668_0004603 3300046616 Bacteria 9703
189 Ga0495668_0006281 3300046616 Bacteria 7828
190 Ga0495668_0022759 3300046616 Bacteria 3581
191 Ga0495634_0025511 3300046642 Bacteria 4134
192 Ga0495611_0000132 3300046648 Bacteria 52191
193 Ga0495611_0002753 3300046648 Bacteria 7890
194 Ga0495611_0003425 3300046648 Bacteria 6992
195 Ga0495625_0010239 3300046660 Bacteria 7776
196 Ga0495625_0017561 3300046660 Bacteria 5600
197 Ga0495625_0019338 3300046660 Bacteria 5287
198 Ga0495661_0000090 3300046665 Bacteria 110201
199 Ga0495661_0000238 3300046665 Bacteria 63454
200 Ga0495661_0004438 3300046665 Bacteria 10126
201 Ga0495661_0016530 3300046665 Bacteria 4888
202 Ga0495661_0020258 3300046665 Bacteria 4346
203 Ga0495661_0021400 3300046665 Bacteria 4217
204 Ga0495661_0022072 3300046665 Bacteria 4143
205 Ga0495588_0000095 3300046674 Bacteria 175627
206 Ga0495588_0005964 3300046674 Bacteria 5462
207 Ga0495588_0036141 3300046674 Bacteria 2505
208 Ga0495588_0047700 3300046674 Bacteria 2199
209 Ga0495669_0001458 3300046684 Bacteria 9753
210 Ga0495669_0005088 3300046684 Bacteria 5472
211 Ga0495669_0011337 3300046684 Bacteria 3784
212 Ga0495669_0018393 3300046684 Bacteria 3004
213 Ga0495669_0035763 3300046684 Bacteria 2193
214 Ga0495670_0000590 3300046691 Bacteria 17330
215 Ga0495670_0012403 3300046691 Bacteria 4190
216 Ga0495670_0014495 3300046691 Bacteria 3875
217 Ga0495671_0000047 3300046692 Bacteria 156459
218 Ga0495671_0002194 3300046692 Bacteria 12425
219 Ga0495671_0007620 3300046692 Bacteria 6151
220 Ga0495671_0046730 3300046692 Bacteria 2164
221 Ga0495671_0048971 3300046692 Bacteria 2107
222 Ga0495649_0001325 3300046694 Bacteria 18814
223 Ga0495649_0004246 3300046694 Bacteria 9393
224 Ga0495649_0017932 3300046694 Bacteria 3989
225 Ga0495589_0000029 3300046794 Bacteria 173640
226 Ga0495589_0000301 3300046794 Bacteria 39328
227 Ga0495589_0000463 3300046794 Bacteria 29663
228 Ga0495589_0006629 3300046794 Bacteria 6098
229 Ga0495589_0020143 3300046794 Bacteria 3412
230 Ga0495600_0025052 3300046809 Bacteria 3843
231 Ga0495600_0069793 3300046809 Bacteria 2296
232 Ga0495660_0000033 3300046810 Bacteria 212425
233 Ga0495660_0021247 3300046810 Bacteria 3717
234 Ga0495660_0029401 3300046810 Bacteria 3100
235 Ga0495660_0044573 3300046810 Bacteria 2439
236 Ga0495581_0018787 3300047315 Bacteria 4012
237 Ga0495581_0039655 3300047315 Bacteria 2726
238 Ga0495604_0035057 3300047317 Bacteria 3964
239 Ga0495604_0035737 3300047317 Bacteria 3922
240 Ga0495674_0003407 3300047319 Bacteria 15445
241 Ga0495674_0060543 3300047319 Bacteria 3303
242 Ga0495672_0000056 3300047320 Bacteria 223740
243 Ga0495672_0000063 3300047320 Bacteria 201893
244 Ga0495672_0000445 3300047320 Bacteria 49224
245 Ga0495672_0010221 3300047320 Bacteria 6705
246 Ga0495672_0014459 3300047320 Bacteria 5404
247 Ga0495672_0026537 3300047320 Bacteria 3694
248 Ga0495672_0032934 3300047320 Bacteria 3216
249 Ga0495672_0037976 3300047320 Bacteria 2942
250 Ga0495676_0021384 3300047321 Bacteria 5653
251 Ga0495683_0000017 3300047323 Bacteria 189599
252 Ga0495683_0000133 3300047323 Bacteria 72553
253 Ga0495683_0014856 3300047323 Bacteria 4054
254 Ga0495683_0017389 3300047323 Bacteria 3728
255 Ga0495683_0034090 3300047323 Bacteria 2589
256 Ga0495687_000003 3300047443 Bacteria 859509
257 Ga0495687_000092 3300047443 Bacteria 140313
258 Ga0495687_000150 3300047443 Bacteria 105759
259 Ga0495687_000411 3300047443 Bacteria 53055
260 Ga0495687_002045 3300047443 Bacteria 16987
261 Ga0495677_0000001 3300047445 Bacteria 715000
262 Ga0495677_0000465 3300047445 Bacteria 17334
263 Ga0495677_0001350 3300047445 Bacteria 9796
264 Ga0495677_0001824 3300047445 Bacteria 8505
265 Ga0495677_0002908 3300047445 Bacteria 6663
266 Ga0495677_0006913 3300047445 Bacteria 4265
267 Ga0495677_0007452 3300047445 Bacteria 4089
268 Ga0495677_0008141 3300047445 Bacteria 3892
269 Ga0495677_0012266 3300047445 Bacteria 3127
270 Ga0495679_002805 3300047446 Bacteria 8658
271 Ga0495679_008625 3300047446 Bacteria 4130
272 Ga0495685_000944 3300047447 Bacteria 8802
273 Ga0495685_002874 3300047447 Bacteria 5440
274 Ga0495681_0000054 3300047470 Bacteria 106578
275 Ga0495681_0000080 3300047470 Bacteria 84770
276 Ga0495681_0002428 3300047470 Bacteria 13309
277 Ga0495681_0014196 3300047470 Bacteria 4581
278 Ga0495681_0025060 3300047470 Bacteria 3126
279 Ga0495686_0000235 3300047472 Bacteria 101102
280 Ga0495686_0000379 3300047472 Bacteria 71434
281 Ga0495686_0024049 3300047472 Bacteria 4007
282 Ga0495686_0040718 3300047472 Bacteria 2962
283 Ga0495602_0011120 3300048088 Bacteria 9318
284 Ga0495614_0019774 3300048089 Bacteria 2913
285 Ga0495626_0000018 3300048091 Bacteria 230153
286 Ga0495626_0000159 3300048091 Bacteria 83571
287 Ga0495626_0000989 3300048091 Bacteria 24444
288 Ga0495626_0001616 3300048091 Bacteria 17518
289 Ga0495626_0016463 3300048091 Bacteria 3754
290 Ga0495626_0016647 3300048091 Bacteria 3730
291 Ga0495626_0019809 3300048091 Bacteria 3359
292 Ga0495626_0025202 3300048091 Bacteria 2910
293 Ga0496101_0046579 3300048904 Bacteria 3110
294 Ga0496101_0046633 3300048904 Bacteria 3108
295 Ga0496102_0000150 3300048905 Bacteria 94718
296 Ga0496102_0000176 3300048905 Bacteria 86747
297 Ga0496102_0017378 3300048905 Bacteria 6301
298 Ga0496102_0066892 3300048905 Bacteria 3294
299 Ga0496103_0077640 3300048906 Bacteria 2085
300 Ga0496107_0016088 3300048910 Bacteria 5248
301 Ga0496112_0142602 3300048915 Bacteria 2365
302 Ga0496113_0029627 3300048916 Bacteria 3956
303 Ga0496113_0114910 3300048916 Bacteria 2099
304 Ga0496115_0028749 3300048918 Bacteria 4359
305 Ga0496122_0000299 3300048925 Bacteria 109780
306 Ga0496122_0029871 3300048925 Bacteria 4583
307 Ga0496123_0016071 3300048926 Bacteria 6099
308 Ga0496123_0021203 3300048926 Bacteria 5057
309 Ga0496124_0011257 3300048927 Bacteria 8958
310 Ga0496124_0025739 3300048927 Bacteria 5321
311 Ga0496124_0033514 3300048927 Bacteria 4518
312 Ga0496124_0080099 3300048927 Bacteria 2688
313 Ga0496124_0120012 3300048927 Bacteria 2102
314 Ga0496125_0010778 3300048928 Bacteria 9205
315 Ga0495678_000086 3300049459 Bacteria 117150
316 Ga0495678_000122 3300049459 Bacteria 91100
317 Ga0495678_001461 3300049459 Bacteria 18531
318 Ga0495678_010170 3300049459 Bacteria 4586
319 Ga0495682_0004367 3300049460 Bacteria 6069
320 Ga0495682_0007627 3300049460 Bacteria 4295
321 Ga0501035_0013023 3300049822 Bacteria 7675
322 2643798907 2643221556 Bacteria 7251154
323 2644472763 2643221684 Bacteria 7145183
324 2809143317 2808606418 Bacteria 6724496
325 8047675507 8047673197 Bacteria 7395230
326 Ga0496110_0000002
327 Ga0055525_1000008
328 Ga0055529_1000060
329 Ga0055526_1001605
330 Ga0055526_1003085
331 Ga0055537_1000505
332 Ga0055524_1000028
333 Ga0055524_1000112
334 Ga0055524_1016344
335 Ga0055534_1000323
336 Ga0055534_1000668
337 Ga0055528_1000013
338 Ga0065165_1003986
339 Ga0070658_10127198
340 Ga0070660_100075824
341 Ga0070659_100015379
342 Ga0070659_100039121
343 Ga0068855_100086636
344 Ga0099826_10000001
345 Ga0209563_100003
346 Ga0209148_1000892
347 Ga0209565_1000003
348 Ga0209565_1003711
349 Ga0209455_1000026
350 Ga0209673_1000003
351 Ga0209675_1000003
352 Ga0209564_1000012
353 Ga0209564_1012618
354 Ga0209256_1000007
355 Ga0209256_1015447
356 Ga0207705_10110760
357 Ga0207657_10045965
358 Ga0207679_10038335
359 Ga0207667_10043282
360 Ga0207648_10053474
361 Ga0209282_1000001
362 Ga0395899_0000012
363 Ga0395899_0027912
364 Ga0395900_0000028
365 Ga0395900_0125310
366 Ga0395898_0114222
367 Ga0395898_0122973
368 Ga0395905_0013934
369 Ga0395905_0015415
370 Ga0395901_0000191
371 Ga0395901_0018879
372 Ga0395901_0157814
373 Ga0439448_0000423
374 Ga0439448_0010934
375 Ga0439450_001495
376 Ga0466972_0011237
377 Ga0466965_0008418
378 Ga0466964_0002872
379 Ga0466964_0018752
380 Ga0466968_0001261
381 Ga0466957_0006865
382 Ga0466959_0078999
383 Ga0466967_0005033
384 Ga0466967_0054251
385 Ga0495617_000001
386 Ga0495617_000428
387 Ga0495627_001428
388 Ga0495603_0007339
389 Ga0495603_0035084
390 Ga0495590_0000029
391 Ga0495590_0001804
392 Ga0495591_000359
393 Ga0495629_0028043
394 Ga0495629_0067800
395 Ga0495653_0029751
396 Ga0495653_0055999
397 Ga0495650_0000511
398 Ga0495650_0022203
399 Ga0495580_0022677
400 Ga0495582_0003354
401 Ga0495582_0014171
402 Ga0495605_0000138
403 Ga0495605_0000304
404 Ga0495605_0004870
405 Ga0495605_0022557
406 Ga0495584_0000002
407 Ga0495584_0000615
408 Ga0495584_0002378
409 Ga0495584_0003879
410 Ga0495584_0007815
411 Ga0495584_0013439
412 Ga0495584_0019488
413 Ga0495584_0020256
414 Ga0495584_0020678
415 Ga0495584_0040669
416 Ga0495585_0000002
417 Ga0495585_0000038
418 Ga0495585_0000708
419 Ga0495585_0001767
420 Ga0495585_0003788
421 Ga0495585_0007322
422 Ga0495585_0014559
423 Ga0495585_0018582
424 Ga0495585_0024063
425 Ga0495585_0026512
426 Ga0495594_0010393
427 Ga0495594_0016450
428 Ga0495596_0001156
429 Ga0495596_0001439
430 Ga0495596_0006007
431 Ga0495596_0006617
432 Ga0495596_0009560
433 Ga0495596_0010926
434 Ga0495596_0012587
435 Ga0495607_0001847
436 Ga0495607_0005104
437 Ga0495607_0006227
438 Ga0495607_0006565
439 Ga0495607_0012953
440 Ga0495583_0000009
441 Ga0495583_0000712
442 Ga0495583_0001891
443 Ga0495583_0003655
444 Ga0495583_0013275
445 Ga0495583_0014861
446 Ga0495583_0016888
447 Ga0495583_0022097
448 Ga0495606_0015109
449 Ga0495606_0018344
450 Ga0495606_0021721
451 Ga0495616_0000037
452 Ga0495616_0000494
453 Ga0495616_0001312
454 Ga0495616_0002527
455 Ga0495616_0018533
456 Ga0495616_0019441
457 Ga0495616_0036603
458 Ga0495620_0016528
459 Ga0495630_0024887
460 Ga0495631_0002036
461 Ga0495631_0004703
462 Ga0495631_0004799
463 Ga0495631_0018841
464 Ga0495631_0019268
465 Ga0495632_0000133
466 Ga0495632_0000462
467 Ga0495632_0002361
468 Ga0495632_0005608
469 Ga0495637_0000002
470 Ga0495643_0000441
471 Ga0495643_0001739
472 Ga0495643_0001979
473 Ga0495643_0020410
474 Ga0495648_0000012
475 Ga0495648_0002845
476 Ga0495648_0014888
477 Ga0495648_0030080
478 Ga0495648_0039781
479 Ga0495648_0052956
480 Ga0495666_0000825
481 Ga0495666_0008415
482 Ga0495666_0013061
483 Ga0495642_0000009
484 Ga0495642_0001547
485 Ga0495642_0002580
486 Ga0495642_0007240
487 Ga0495642_0007974
488 Ga0495642_0010294
489 Ga0495652_0020649
490 Ga0495654_0003920
491 Ga0495654_0005022
492 Ga0495665_0005778
493 Ga0495665_0045420
494 Ga0495586_0003133
495 Ga0495586_0012279
496 Ga0495609_0000001
497 Ga0495609_0002702
498 Ga0495609_0003298
499 Ga0495609_0009986
500 Ga0495597_0000145
501 Ga0495597_0000725
502 Ga0495597_0001600
503 Ga0495597_0002794
504 Ga0495597_0004631
505 Ga0495597_0013048
506 Ga0495633_0006379
507 Ga0495633_0006545
508 Ga0495633_0011664
509 Ga0495633_0018116
510 Ga0495633_0025169
511 Ga0495668_0000052
512 Ga0495668_0002533
513 Ga0495668_0004603
514 Ga0495668_0006281
515 Ga0495668_0022759
516 Ga0495634_0025511
517 Ga0495611_0000132
518 Ga0495611_0002753
519 Ga0495611_0003425
520 Ga0495625_0010239
521 Ga0495625_0017561
522 Ga0495625_0019338
523 Ga0495661_0000090
524 Ga0495661_0000238
525 Ga0495661_0004438
526 Ga0495661_0016530
527 Ga0495661_0020258
528 Ga0495661_0021400
529 Ga0495661_0022072
530 Ga0495588_0000095
531 Ga0495588_0005964
532 Ga0495588_0036141
533 Ga0495588_0047700
534 Ga0495669_0001458
535 Ga0495669_0005088
536 Ga0495669_0011337
537 Ga0495669_0018393
538 Ga0495669_0035763
539 Ga0495670_0000590
540 Ga0495670_0012403
541 Ga0495670_0014495
542 Ga0495671_0000047
543 Ga0495671_0002194
544 Ga0495671_0007620
545 Ga0495671_0046730
546 Ga0495671_0048971
547 Ga0495649_0001325
548 Ga0495649_0004246
549 Ga0495649_0017932
550 Ga0495589_0000029
551 Ga0495589_0000301
552 Ga0495589_0000463
553 Ga0495589_0006629
554 Ga0495589_0020143
555 Ga0495600_0025052
556 Ga0495600_0069793
557 Ga0495660_0000033
558 Ga0495660_0021247
559 Ga0495660_0029401
560 Ga0495660_0044573
561 Ga0495581_0018787
562 Ga0495581_0039655
563 Ga0495604_0035057
564 Ga0495604_0035737
565 Ga0495674_0003407
566 Ga0495674_0060543
567 Ga0495672_0000056
568 Ga0495672_0000063
569 Ga0495672_0000445
570 Ga0495672_0010221
571 Ga0495672_0014459
572 Ga0495672_0026537
573 Ga0495672_0032934
574 Ga0495672_0037976
575 Ga0495676_0021384
576 Ga0495683_0000017
577 Ga0495683_0000133
578 Ga0495683_0014856
579 Ga0495683_0017389
580 Ga0495683_0034090
581 Ga0495687_000003
582 Ga0495687_000092
583 Ga0495687_000150
584 Ga0495687_000411
585 Ga0495687_002045
586 Ga0495677_0000001
587 Ga0495677_0000465
588 Ga0495677_0001350
589 Ga0495677_0001824
590 Ga0495677_0002908
591 Ga0495677_0006913
592 Ga0495677_0007452
593 Ga0495677_0008141
594 Ga0495677_0012266
595 Ga0495679_002805
596 Ga0495679_008625
597 Ga0495685_000944
598 Ga0495685_002874
599 Ga0495681_0000054
600 Ga0495681_0000080
601 Ga0495681_0002428
602 Ga0495681_0014196
603 Ga0495681_0025060
604 Ga0495686_0000235
605 Ga0495686_0000379
606 Ga0495686_0024049
607 Ga0495686_0040718
608 Ga0495602_0011120
609 Ga0495614_0019774
610 Ga0495626_0000018
611 Ga0495626_0000159
612 Ga0495626_0000989
613 Ga0495626_0001616
614 Ga0495626_0016463
615 Ga0495626_0016647
616 Ga0495626_0019809
617 Ga0495626_0025202
618 Ga0496101_0046579
619 Ga0496101_0046633
620 Ga0496102_0000150
621 Ga0496102_0000176
622 Ga0496102_0017378
623 Ga0496102_0066892
624 Ga0496103_0077640
625 Ga0496107_0016088
626 Ga0496112_0142602
627 Ga0496113_0029627
628 Ga0496113_0114910
629 Ga0496115_0028749
630 Ga0496122_0000299
631 Ga0496122_0029871
632 Ga0496123_0016071
633 Ga0496123_0021203
634 Ga0496124_0011257
635 Ga0496124_0025739
636 Ga0496124_0033514
637 Ga0496124_0080099
638 Ga0496124_0120012
639 Ga0496125_0010778
640 Ga0495678_000086
641 Ga0495678_000122
642 Ga0495678_001461
643 Ga0495678_010170
644 Ga0495682_0004367
645 Ga0495682_0007627
646 Ga0501035_0013023
647 2643798907
648 2644472763
649 2809143317
650 8047675507

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00639

Rotamase

PPIC-type PPIASE domain

272

368

0.99

PF13624

SurA_N_3

SurA-like N-terminal domain

1

163

0.98

PF13623

SurA_N_2

SurA-like N-terminal domain

2

139

0.97

PF13145

Rotamase_2

PPIC-type PPIASE domain

246

382

0.87

PF13616

Rotamase_3

PPIC-type PPIASE domain

249

370

0.87

Map