F408065
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 325 | 194 | 316 | 150 |
Family's Representative Sequence
| Representative Sequence | 3300053136|Ga0500559_0045313|Ga0500559_0045313_377_868 |
| Length | 163 |
| Sequence | MSIRVAAQEADFDVGAELARLEALGGGGVASFTGVVRGDDSGKAGGAAGLTALRLEAYPGMTQRALEGIAAEAATRWSLAGLTLIHRFGTLGIGDRIVLVGTAARHRAAALEACAFLIDWAKTKAPLWKQEIFADGTTRWIEPRASDDAAAAEWDASAEHGKP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 3 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 4 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 5 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 6 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 7 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 8 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 9 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 10 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 11 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 12 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 13 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 14 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 15 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 16 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 17 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 18 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 19 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 20 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 21 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 57 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 66 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 77 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 120 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 121 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 122 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 123 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 124 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 125 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 126 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 127 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 128 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 129 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 130 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 131 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 132 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 133 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 134 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 135 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 136 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 137 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 138 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 139 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 140 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 141 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 142 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 143 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 144 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 145 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 160 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 161 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 162 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 163 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 164 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 165 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 166 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 167 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 168 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 169 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 170 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 171 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 172 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 179 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 180 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 181 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 182 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 183 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 185 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 187 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 188 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 189 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 190 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 191 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 192 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 193 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 194 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.23 |
| Metatranscriptomes | 0 |
| Isolates | 2.77 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.38 |
| Nodule | 0 |
| Rhizoplane | 3.38 |
| Rhizosphere | 82.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_645837 | 2162886007 | Bacteria | 2865 |
| 2 | JGI24736J21556_1001483 | 3300001904 | Bacteria | 4292 |
| 3 | JGI24741J21665_1000228 | 3300001915 | Bacteria | 16799 |
| 4 | JGI24740J21852_10008724 | 3300001979 | Bacteria | 4024 |
| 5 | JGI24739J22299_10002767 | 3300001989 | Bacteria | 6741 |
| 6 | JGI24739J22299_10081354 | 3300001989 | Bacteria | 995 |
| 7 | JGI24737J22298_10001502 | 3300001990 | Bacteria | 8302 |
| 8 | JGI24737J22298_10068479 | 3300001990 | Bacteria | 1061 |
| 9 | JGI24735J21928_10000586 | 3300002067 | Bacteria | 12808 |
| 10 | JGI24735J21928_10003416 | 3300002067 | Bacteria | 5416 |
| 11 | JGI24738J21930_10001423 | 3300002075 | Bacteria | 6636 |
| 12 | JGI24738J21930_10007152 | 3300002075 | Bacteria | 2587 |
| 13 | JGI24738J21930_10010385 | 3300002075 | Bacteria | 2073 |
| 14 | JGI24744J21845_10000267 | 3300002077 | Bacteria | 8508 |
| 15 | JGI24751J29686_10000195 | 3300002459 | Bacteria | 26688 |
| 16 | rootL2_10177419 | 3300003322 | Bacteria | 2302 |
| 17 | Ga0065704_10008199 | 3300005289 | Bacteria | 4967 |
| 18 | Ga0065707_10004914 | 3300005295 | Bacteria | 4993 |
| 19 | Ga0065707_10087462 | 3300005295 | Bacteria | 5014 |
| 20 | Ga0070658_10095369 | 3300005327 | Bacteria | 2456 |
| 21 | Ga0070658_10294339 | 3300005327 | Bacteria | 1384 |
| 22 | Ga0070676_10163065 | 3300005328 | Bacteria | 1436 |
| 23 | Ga0070670_100000033 | 3300005331 | Bacteria | 158509 |
| 24 | Ga0070670_100000639 | 3300005331 | Bacteria | 27231 |
| 25 | Ga0070670_101107550 | 3300005331 | Unclassified | 722 |
| 26 | Ga0070666_10005633 | 3300005335 | Bacteria | 7686 |
| 27 | Ga0070666_10034718 | 3300005335 | Bacteria | 3342 |
| 28 | Ga0070660_100002644 | 3300005339 | Bacteria | 12315 |
| 29 | Ga0070660_100006410 | 3300005339 | Bacteria | 8154 |
| 30 | Ga0070660_100328190 | 3300005339 | Bacteria | 1258 |
| 31 | Ga0070660_100832701 | 3300005339 | Bacteria | 777 |
| 32 | Ga0070661_100059465 | 3300005344 | Bacteria | 2802 |
| 33 | Ga0070661_100317610 | 3300005344 | Bacteria | 1216 |
| 34 | Ga0070668_100000003 | 3300005347 | Bacteria | 195738 |
| 35 | Ga0070668_100072912 | 3300005347 | Bacteria | 2676 |
| 36 | Ga0070669_100000005 | 3300005353 | Bacteria | 309134 |
| 37 | Ga0070669_100018613 | 3300005353 | Bacteria | 4964 |
| 38 | Ga0070669_100670740 | 3300005353 | Bacteria | 873 |
| 39 | Ga0070675_100007973 | 3300005354 | Bacteria | 8207 |
| 40 | Ga0070671_100000061 | 3300005355 | Bacteria | 73646 |
| 41 | Ga0070671_100025946 | 3300005355 | Bacteria | 4812 |
| 42 | Ga0070671_101283880 | 3300005355 | Unclassified | 645 |
| 43 | Ga0070674_100004933 | 3300005356 | Bacteria | 7648 |
| 44 | Ga0070659_100368488 | 3300005366 | Bacteria | 1208 |
| 45 | Ga0070667_100000035 | 3300005367 | Bacteria | 173461 |
| 46 | Ga0070667_100005221 | 3300005367 | Bacteria | 10854 |
| 47 | Ga0070667_101324173 | 3300005367 | Bacteria | 675 |
| 48 | Ga0070667_101490851 | 3300005367 | Bacteria | 635 |
| 49 | Ga0070663_100009261 | 3300005455 | Bacteria | 6092 |
| 50 | Ga0070678_100007498 | 3300005456 | Bacteria | 6478 |
| 51 | Ga0070662_100003187 | 3300005457 | Bacteria | 10196 |
| 52 | Ga0070662_100305064 | 3300005457 | Bacteria | 1294 |
| 53 | Ga0070662_101177392 | 3300005457 | Bacteria | 659 |
| 54 | Ga0068853_100008080 | 3300005539 | Bacteria | 8441 |
| 55 | Ga0068853_100331425 | 3300005539 | Bacteria | 1412 |
| 56 | Ga0070672_100077827 | 3300005543 | Bacteria | 2653 |
| 57 | Ga0070665_100840519 | 3300005548 | Bacteria | 931 |
| 58 | Ga0070664_100121726 | 3300005564 | Bacteria | 2285 |
| 59 | Ga0068857_100109767 | 3300005577 | Bacteria | 2479 |
| 60 | Ga0068857_100237961 | 3300005577 | Bacteria | 1666 |
| 61 | Ga0068854_100000051 | 3300005578 | Bacteria | 86667 |
| 62 | Ga0068854_100036629 | 3300005578 | Bacteria | 3441 |
| 63 | Ga0068856_100008621 | 3300005614 | Bacteria | 9916 |
| 64 | Ga0068852_100515573 | 3300005616 | Bacteria | 1192 |
| 65 | Ga0068852_100637643 | 3300005616 | Bacteria | 1072 |
| 66 | Ga0068852_100873100 | 3300005616 | Bacteria | 916 |
| 67 | Ga0068852_101153698 | 3300005616 | Bacteria | 795 |
| 68 | Ga0068859_100002190 | 3300005617 | Bacteria | 19848 |
| 69 | Ga0068859_100283695 | 3300005617 | Bacteria | 1749 |
| 70 | Ga0068864_100000042 | 3300005618 | Bacteria | 162930 |
| 71 | Ga0068864_100000861 | 3300005618 | Bacteria | 25572 |
| 72 | Ga0068861_100002413 | 3300005719 | Bacteria | 12172 |
| 73 | Ga0068851_10129505 | 3300005834 | Bacteria | 1363 |
| 74 | Ga0068863_100001950 | 3300005841 | Bacteria | 20502 |
| 75 | Ga0068863_100026727 | 3300005841 | Bacteria | 5503 |
| 76 | Ga0068858_100000465 | 3300005842 | Bacteria | 42293 |
| 77 | Ga0068860_100000106 | 3300005843 | Bacteria | 133556 |
| 78 | Ga0068860_100332267 | 3300005843 | Bacteria | 1493 |
| 79 | Ga0068862_100000005 | 3300005844 | Bacteria | 350713 |
| 80 | Ga0068862_100000677 | 3300005844 | Bacteria | 34813 |
| 81 | Ga0068862_100323134 | 3300005844 | Bacteria | 1425 |
| 82 | Ga0097621_100020039 | 3300006237 | Bacteria | 5149 |
| 83 | Ga0068865_100277064 | 3300006881 | Bacteria | 1334 |
| 84 | Ga0097620_100002190 | 3300006931 | Bacteria | 19848 |
| 85 | Ga0097620_100283708 | 3300006931 | Bacteria | 1749 |
| 86 | Ga0105251_10009288 | 3300009011 | Bacteria | 5822 |
| 87 | Ga0114129_10116752 | 3300009147 | Bacteria | 3677 |
| 88 | Ga0105243_10092224 | 3300009148 | Bacteria | 2497 |
| 89 | Ga0105241_10314105 | 3300009174 | Bacteria | 1349 |
| 90 | Ga0105248_10000171 | 3300009177 | Bacteria | 75565 |
| 91 | Ga0105248_10375099 | 3300009177 | Bacteria | 1601 |
| 92 | Ga0105237_10002989 | 3300009545 | Bacteria | 20424 |
| 93 | Ga0105237_10046738 | 3300009545 | Bacteria | 4354 |
| 94 | Ga0105238_10020860 | 3300009551 | Bacteria | 6675 |
| 95 | Ga0105238_10266463 | 3300009551 | Bacteria | 1693 |
| 96 | Ga0105148_100086 | 3300009978 | Bacteria | 14695 |
| 97 | Ga0105239_10000061 | 3300010375 | Bacteria | 154661 |
| 98 | Ga0105239_10696174 | 3300010375 | Bacteria | 1162 |
| 99 | Ga0105239_10857415 | 3300010375 | Bacteria | 1042 |
| 100 | Ga0157373_10018144 | 3300013100 | Bacteria | 5125 |
| 101 | Ga0157373_10077309 | 3300013100 | Bacteria | 2348 |
| 102 | Ga0157373_10221824 | 3300013100 | Bacteria | 1334 |
| 103 | Ga0157371_10031118 | 3300013102 | Bacteria | 3845 |
| 104 | Ga0157371_10110145 | 3300013102 | Bacteria | 1955 |
| 105 | Ga0157371_10203926 | 3300013102 | Bacteria | 1418 |
| 106 | Ga0157371_10337127 | 3300013102 | Bacteria | 1096 |
| 107 | Ga0157369_10214837 | 3300013105 | Bacteria | 2014 |
| 108 | Ga0157374_10021559 | 3300013296 | Bacteria | 5735 |
| 109 | Ga0157372_10033614 | 3300013307 | Bacteria | 5635 |
| 110 | Ga0157372_10629058 | 3300013307 | Bacteria | 1250 |
| 111 | Ga0157372_10649250 | 3300013307 | Bacteria | 1229 |
| 112 | Ga0157372_10683702 | 3300013307 | Bacteria | 1194 |
| 113 | Ga0157372_10699514 | 3300013307 | Bacteria | 1179 |
| 114 | Ga0163163_10013144 | 3300014325 | Bacteria | 7565 |
| 115 | Ga0157380_10006098 | 3300014326 | Bacteria | 8448 |
| 116 | Ga0157380_10173524 | 3300014326 | Bacteria | 1886 |
| 117 | Ga0157379_10613519 | 3300014968 | Bacteria | 1016 |
| 118 | Ga0163161_10003807 | 3300017792 | Bacteria | 10577 |
| 119 | Ga0163161_10272792 | 3300017792 | Bacteria | 1324 |
| 120 | Ga0213875_10000323 | 3300021388 | Bacteria | 45327 |
| 121 | Ga0207656_10079009 | 3300025321 | Bacteria | 1475 |
| 122 | Ga0207713_1034815 | 3300025735 | Bacteria | 2182 |
| 123 | Ga0207680_10053938 | 3300025903 | Bacteria | 2416 |
| 124 | Ga0207647_10000195 | 3300025904 | Bacteria | 49520 |
| 125 | Ga0207647_10003079 | 3300025904 | Bacteria | 12537 |
| 126 | Ga0207647_10011660 | 3300025904 | Bacteria | 6155 |
| 127 | Ga0207647_10189258 | 3300025904 | Bacteria | 1193 |
| 128 | Ga0207645_10160816 | 3300025907 | Bacteria | 1469 |
| 129 | Ga0207705_10001763 | 3300025909 | Bacteria | 17086 |
| 130 | Ga0207705_10182371 | 3300025909 | Bacteria | 1585 |
| 131 | Ga0207705_10599319 | 3300025909 | Bacteria | 857 |
| 132 | Ga0207705_10794718 | 3300025909 | Bacteria | 734 |
| 133 | Ga0207654_10019316 | 3300025911 | Bacteria | 3595 |
| 134 | Ga0207654_10275515 | 3300025911 | Bacteria | 1136 |
| 135 | Ga0207695_10013684 | 3300025913 | Bacteria | 9657 |
| 136 | Ga0207671_10005232 | 3300025914 | Bacteria | 12051 |
| 137 | Ga0207671_10746045 | 3300025914 | Bacteria | 778 |
| 138 | Ga0207657_10008571 | 3300025919 | Bacteria | 10361 |
| 139 | Ga0207657_10009826 | 3300025919 | Bacteria | 9585 |
| 140 | Ga0207657_10321694 | 3300025919 | Bacteria | 1223 |
| 141 | Ga0207657_10769920 | 3300025919 | Bacteria | 745 |
| 142 | Ga0207649_10011858 | 3300025920 | Bacteria | 4821 |
| 143 | Ga0207649_10222954 | 3300025920 | Bacteria | 1344 |
| 144 | Ga0207681_10000003 | 3300025923 | Bacteria | 713245 |
| 145 | Ga0207681_10014843 | 3300025923 | Bacteria | 4851 |
| 146 | Ga0207681_10019678 | 3300025923 | Bacteria | 4269 |
| 147 | Ga0207694_10129588 | 3300025924 | Bacteria | 2021 |
| 148 | Ga0207694_10474608 | 3300025924 | Bacteria | 1046 |
| 149 | Ga0207650_10000012 | 3300025925 | Bacteria | 437889 |
| 150 | Ga0207650_10015130 | 3300025925 | Bacteria | 5369 |
| 151 | Ga0207659_10007049 | 3300025926 | Bacteria | 6897 |
| 152 | Ga0207644_10000069 | 3300025931 | Bacteria | 75201 |
| 153 | Ga0207644_10599692 | 3300025931 | Bacteria | 914 |
| 154 | Ga0207690_10195924 | 3300025932 | Bacteria | 1531 |
| 155 | Ga0207690_10396391 | 3300025932 | Bacteria | 1100 |
| 156 | Ga0207706_10003037 | 3300025933 | Bacteria | 16179 |
| 157 | Ga0207706_10126025 | 3300025933 | Bacteria | 2252 |
| 158 | Ga0207706_10384653 | 3300025933 | Bacteria | 1217 |
| 159 | Ga0207709_10078439 | 3300025935 | Bacteria | 2120 |
| 160 | Ga0207669_10002608 | 3300025937 | Bacteria | 7711 |
| 161 | Ga0207704_10263487 | 3300025938 | Bacteria | 1301 |
| 162 | Ga0207691_10060811 | 3300025940 | Bacteria | 3432 |
| 163 | Ga0207711_10001461 | 3300025941 | Bacteria | 22080 |
| 164 | Ga0207711_10370348 | 3300025941 | Bacteria | 1328 |
| 165 | Ga0207661_10926278 | 3300025944 | Bacteria | 803 |
| 166 | Ga0207679_10053455 | 3300025945 | Bacteria | 2968 |
| 167 | Ga0207667_10254274 | 3300025949 | Bacteria | 1797 |
| 168 | Ga0207668_10000006 | 3300025972 | Bacteria | 191468 |
| 169 | Ga0207668_10026421 | 3300025972 | Bacteria | 3769 |
| 170 | Ga0207668_10125314 | 3300025972 | Bacteria | 1952 |
| 171 | Ga0207640_10001537 | 3300025981 | Bacteria | 12441 |
| 172 | Ga0207640_10013098 | 3300025981 | Bacteria | 4743 |
| 173 | Ga0207640_10017027 | 3300025981 | Bacteria | 4244 |
| 174 | Ga0207640_10640763 | 3300025981 | Bacteria | 904 |
| 175 | Ga0207658_10000026 | 3300025986 | Bacteria | 178292 |
| 176 | Ga0207658_10009247 | 3300025986 | Bacteria | 6683 |
| 177 | Ga0207703_10000234 | 3300026035 | Bacteria | 63325 |
| 178 | Ga0207639_10000269 | 3300026041 | Bacteria | 37143 |
| 179 | Ga0207639_10012721 | 3300026041 | Bacteria | 5870 |
| 180 | Ga0207639_10027130 | 3300026041 | Bacteria | 4168 |
| 181 | Ga0207639_10190824 | 3300026041 | Bacteria | 1750 |
| 182 | Ga0207678_10000400 | 3300026067 | Bacteria | 39732 |
| 183 | Ga0207678_10001983 | 3300026067 | Bacteria | 18643 |
| 184 | Ga0207702_10006623 | 3300026078 | Bacteria | 9964 |
| 185 | Ga0207641_10000617 | 3300026088 | Bacteria | 38890 |
| 186 | Ga0207641_10001438 | 3300026088 | Bacteria | 23396 |
| 187 | Ga0207676_10000009 | 3300026095 | Bacteria | 545256 |
| 188 | Ga0207676_10004386 | 3300026095 | Bacteria | 9979 |
| 189 | Ga0207674_10003571 | 3300026116 | Bacteria | 18967 |
| 190 | Ga0207675_100001338 | 3300026118 | Bacteria | 24709 |
| 191 | Ga0207683_10026399 | 3300026121 | Bacteria | 5012 |
| 192 | Ga0207698_12349426 | 3300026142 | Bacteria | 545 |
| 193 | Ga0268266_10043391 | 3300028379 | Bacteria | 3843 |
| 194 | Ga0268265_10000001 | 3300028380 | Bacteria | 1230727 |
| 195 | Ga0268265_10000380 | 3300028380 | Bacteria | 47826 |
| 196 | Ga0268265_10399614 | 3300028380 | Bacteria | 1270 |
| 197 | Ga0268264_10000076 | 3300028381 | Bacteria | 255518 |
| 198 | Ga0268264_10472080 | 3300028381 | Bacteria | 1219 |
| 199 | Ga0307408_100003396 | 3300031548 | Bacteria | 10921 |
| 200 | Ga0307408_100034106 | 3300031548 | Bacteria | 3561 |
| 201 | Ga0307408_100288246 | 3300031548 | Bacteria | 1370 |
| 202 | Ga0307405_10014422 | 3300031731 | Bacteria | 4250 |
| 203 | Ga0307405_10017685 | 3300031731 | Bacteria | 3918 |
| 204 | Ga0307405_11027322 | 3300031731 | Bacteria | 705 |
| 205 | Ga0307406_10031543 | 3300031901 | Bacteria | 3228 |
| 206 | Ga0307406_10232516 | 3300031901 | Bacteria | 1377 |
| 207 | Ga0307412_10000933 | 3300031911 | Bacteria | 16724 |
| 208 | Ga0307412_10013627 | 3300031911 | Bacteria | 4774 |
| 209 | Ga0307412_10033013 | 3300031911 | Bacteria | 3285 |
| 210 | Ga0307416_100090872 | 3300032002 | Bacteria | 2620 |
| 211 | Ga0307416_100967713 | 3300032002 | Bacteria | 953 |
| 212 | Ga0307414_10187265 | 3300032004 | Bacteria | 1671 |
| 213 | Ga0307414_10619787 | 3300032004 | Bacteria | 972 |
| 214 | Ga0307411_10099909 | 3300032005 | Bacteria | 2049 |
| 215 | Ga0395905_0015362 | 3300037471 | Bacteria | 7277 |
| 216 | Ga0395905_0325084 | 3300037471 | Bacteria | 1428 |
| 217 | Ga0436364_0129444 | 3300037853 | Bacteria | 50814 |
| 218 | Ga0395901_0605102 | 3300038443 | Bacteria | 1105 |
| 219 | Ga0436365_0285743 | 3300039437 | Bacteria | 711 |
| 220 | Ga0451789_0739190 | 3300041443 | Bacteria | 547 |
| 221 | Ga0451802_0768085 | 3300041460 | Bacteria | 1834 |
| 222 | Ga0451806_295426 | 3300041462 | Bacteria | 2967 |
| 223 | Ga0451807_2500641 | 3300041486 | Bacteria | 2041 |
| 224 | Ga0451845_0392982 | 3300041501 | Bacteria | 693 |
| 225 | Ga0451849_0243155 | 3300041505 | Bacteria | 988 |
| 226 | Ga0439458_0022048 | 3300042157 | Bacteria | 1477 |
| 227 | Ga0466973_0107406 | 3300044659 | Bacteria | 2345 |
| 228 | Ga0466966_0020439 | 3300044684 | Bacteria | 4353 |
| 229 | Ga0466961_0295990 | 3300044693 | Bacteria | 989 |
| 230 | Ga0466963_0239465 | 3300044694 | Bacteria | 1272 |
| 231 | Ga0466971_0373601 | 3300044719 | Bacteria | 692 |
| 232 | Ga0466970_0093515 | 3300044765 | Bacteria | 1633 |
| 233 | Ga0466959_0072564 | 3300045049 | Bacteria | 2491 |
| 234 | Ga0466958_0066211 | 3300045836 | Bacteria | 2206 |
| 235 | Ga0495638_0265450 | 3300046460 | Bacteria | 939 |
| 236 | Ga0495638_0307406 | 3300046460 | Bacteria | 852 |
| 237 | Ga0495584_0049795 | 3300046491 | Bacteria | 2110 |
| 238 | Ga0495632_0000001 | 3300046519 | Bacteria | 873295 |
| 239 | Ga0495637_0000330 | 3300046520 | Bacteria | 36746 |
| 240 | Ga0495643_0000020 | 3300046522 | Bacteria | 294973 |
| 241 | Ga0495648_0126528 | 3300046524 | Bacteria | 1364 |
| 242 | Ga0495663_0000002 | 3300046525 | Bacteria | 495384 |
| 243 | Ga0495633_0000213 | 3300046558 | Bacteria | 72710 |
| 244 | Ga0495633_0003218 | 3300046558 | Bacteria | 11022 |
| 245 | Ga0495633_0110138 | 3300046558 | Bacteria | 1276 |
| 246 | Ga0495633_0150619 | 3300046558 | Bacteria | 1074 |
| 247 | Ga0495671_0000016 | 3300046692 | Bacteria | 294821 |
| 248 | Ga0495687_080891 | 3300047443 | Bacteria | 1273 |
| 249 | Ga0495673_0035658 | 3300047469 | Bacteria | 2289 |
| 250 | Ga0495681_0003075 | 3300047470 | Bacteria | 11701 |
| 251 | Ga0495686_0000197 | 3300047472 | Bacteria | 112818 |
| 252 | Ga0495686_0002725 | 3300047472 | Bacteria | 16154 |
| 253 | Ga0495686_0005357 | 3300047472 | Bacteria | 10149 |
| 254 | Ga0495686_0029169 | 3300047472 | Bacteria | 3591 |
| 255 | Ga0496100_0176740 | 3300048903 | Bacteria | 1542 |
| 256 | Ga0496108_0003224 | 3300048911 | Bacteria | 13116 |
| 257 | Ga0496108_0630829 | 3300048911 | Bacteria | 932 |
| 258 | Ga0496110_0302406 | 3300048913 | Bacteria | 1457 |
| 259 | Ga0496111_0085939 | 3300048914 | Bacteria | 2301 |
| 260 | Ga0496111_0659231 | 3300048914 | Bacteria | 763 |
| 261 | Ga0496113_0506537 | 3300048916 | Bacteria | 969 |
| 262 | Ga0496116_0035885 | 3300048919 | Bacteria | 3478 |
| 263 | Ga0496117_0084685 | 3300048920 | Bacteria | 2067 |
| 264 | Ga0496117_0215805 | 3300048920 | Bacteria | 1072 |
| 265 | Ga0496118_0026247 | 3300048921 | Bacteria | 4969 |
| 266 | Ga0496118_0089205 | 3300048921 | Bacteria | 2130 |
| 267 | Ga0496119_0072336 | 3300048922 | Bacteria | 2015 |
| 268 | Ga0496121_0000192 | 3300048924 | Bacteria | 136529 |
| 269 | Ga0496121_0000584 | 3300048924 | Bacteria | 68507 |
| 270 | Ga0496121_0010392 | 3300048924 | Bacteria | 10509 |
| 271 | Ga0496121_0071730 | 3300048924 | Bacteria | 2784 |
| 272 | Ga0496122_0011471 | 3300048925 | Bacteria | 8966 |
| 273 | Ga0496122_0568006 | 3300048925 | Bacteria | 537 |
| 274 | Ga0496124_0086543 | 3300048927 | Bacteria | 2564 |
| 275 | Ga0496124_0132276 | 3300048927 | Bacteria | 1980 |
| 276 | Ga0496124_0552451 | 3300048927 | Bacteria | 760 |
| 277 | Ga0496125_0001515 | 3300048928 | Bacteria | 33290 |
| 278 | Ga0496125_0011116 | 3300048928 | Bacteria | 9030 |
| 279 | Ga0496125_0082923 | 3300048928 | Bacteria | 2441 |
| 280 | Ga0496125_0154435 | 3300048928 | Bacteria | 1570 |
| 281 | Ga0496125_0328550 | 3300048928 | Bacteria | 923 |
| 282 | Ga0496126_0021282 | 3300048929 | Bacteria | 6337 |
| 283 | Ga0496126_0072270 | 3300048929 | Bacteria | 3069 |
| 284 | Ga0496126_0236607 | 3300048929 | Bacteria | 1528 |
| 285 | Ga0496126_0248848 | 3300048929 | Bacteria | 1482 |
| 286 | Ga0496126_0438267 | 3300048929 | Bacteria | 1054 |
| 287 | Ga0501031_0301811 | 3300049568 | Bacteria | 1038 |
| 288 | Ga0501032_0199879 | 3300049569 | Bacteria | 1304 |
| 289 | Ga0501043_0050154 | 3300049579 | Bacteria | 3281 |
| 290 | Ga0501043_0204577 | 3300049579 | Bacteria | 1531 |
| 291 | Ga0501046_0031392 | 3300049580 | Bacteria | 4306 |
| 292 | Ga0501047_0001735 | 3300049581 | Bacteria | 21178 |
| 293 | Ga0501047_0001840 | 3300049581 | Bacteria | 20467 |
| 294 | Ga0501047_0897711 | 3300049581 | Bacteria | 700 |
| 295 | Ga0501048_0079289 | 3300049582 | Bacteria | 2317 |
| 296 | Ga0501223_000004 | 3300049663 | Bacteria | 141027 |
| 297 | Ga0501235_000242 | 3300049669 | Bacteria | 9987 |
| 298 | Ga0501236_004068 | 3300049670 | Bacteria | 1724 |
| 299 | Ga0501246_000921 | 3300049676 | Bacteria | 2198 |
| 300 | Ga0501225_0000003 | 3300049705 | Bacteria | 141070 |
| 301 | Ga0501225_0000673 | 3300049705 | Bacteria | 10658 |
| 302 | Ga0501225_0006456 | 3300049705 | Bacteria | 3423 |
| 303 | Ga0501083_0839970 | 3300049744 | Bacteria | 598 |
| 304 | Ga0501282_009829 | 3300049778 | Bacteria | 1026 |
| 305 | Ga0501044_0101391 | 3300049823 | Bacteria | 2896 |
| 306 | nmdc:mga0k408_582610_c1 | 3300050493 | Bacteria | 660 |
| 307 | nmdc:mga07m45_193628_c1 | 3300050496 | Bacteria | 1182 |
| 308 | Ga0500643_006760 | 3300053087 | Bacteria | 4734 |
| 309 | Ga0500562_000252 | 3300053108 | Bacteria | 13785 |
| 310 | Ga0500559_0004676 | 3300053136 | Bacteria | 6447 |
| 311 | Ga0500559_0045313 | 3300053136 | Bacteria | 1925 |
| 312 | Ga0500564_181945 | 3300053138 | Bacteria | 876 |
| 313 | Ga0500624_000099 | 3300053157 | Bacteria | 42473 |
| 314 | Ga0500624_001219 | 3300053157 | Bacteria | 4599 |
| 315 | Ga0500633_0379462 | 3300053160 | Bacteria | 512 |
| 316 | Ga0500636_0019007 | 3300053177 | Bacteria | 4065 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300002075 | JGI24738J21930_10010385 | JGI24738J21930_100103854 | 130 |
| 2 | 3300046460 | Ga0495638_0307406 | Ga0495638_0307406_198_623 | 141 |
| 3 | iso_pu_bacteria | 2775507255 | 2778124435 | 142 |
| 4 | iso_pu_bacteria | 2808606401 | 2809061832 | 143 |
| 5 | iso_pu_bacteria | 2808606404 | 2809077796 | 143 |
| 6 | iso_pu_bacteria | 2808606405 | 2809082496 | 143 |
| 7 | iso_pu_bacteria | 2880518877 | 2880519985 | 143 |
| 8 | 3300005616 | Ga0068852_100873100 | Ga0068852_1008731002 | 145 |
| 9 | 3300049581 | Ga0501047_0001840 | Ga0501047_0001840_15278_15718 | 145 |
| 10 | 3300049744 | Ga0501083_0839970 | Ga0501083_0839970_106_546 | 145 |
| 11 | 3300053136 | Ga0500559_0004676 | Ga0500559_0004676_3641_4078 | 145 |
| 12 | 3300001904 | JGI24736J21556_1001483 | JGI24736J21556_10014834 | 146 |
| 13 | 3300001915 | JGI24741J21665_1000228 | JGI24741J21665_100022813 | 146 |
| 14 | 3300001979 | JGI24740J21852_10008724 | JGI24740J21852_100087244 | 146 |
| 15 | 3300001989 | JGI24739J22299_10002767 | JGI24739J22299_100027676 | 146 |
| 16 | 3300001990 | JGI24737J22298_10068479 | JGI24737J22298_100684792 | 146 |
| 17 | 3300002067 | JGI24735J21928_10003416 | JGI24735J21928_100034163 | 146 |
| 18 | 3300002075 | JGI24738J21930_10007152 | JGI24738J21930_100071522 | 146 |
| 19 | 3300005327 | Ga0070658_10294339 | Ga0070658_102943392 | 146 |
| 20 | 3300005339 | Ga0070660_100006410 | Ga0070660_1000064102 | 146 |
| 21 | 3300005344 | Ga0070661_100059465 | Ga0070661_1000594652 | 146 |
| 22 | 3300005367 | Ga0070667_101324173 | Ga0070667_1013241731 | 146 |
| 23 | 3300005457 | Ga0070662_100305064 | Ga0070662_1003050642 | 146 |
| 24 | 3300005539 | Ga0068853_100331425 | Ga0068853_1003314252 | 146 |
| 25 | 3300005564 | Ga0070664_100121726 | Ga0070664_1001217262 | 146 |
| 26 | 3300005577 | Ga0068857_100237961 | Ga0068857_1002379612 | 146 |
| 27 | 3300005614 | Ga0068856_100008621 | Ga0068856_1000086218 | 146 |
| 28 | 3300005616 | Ga0068852_100515573 | Ga0068852_1005155732 | 146 |
| 29 | 3300005616 | Ga0068852_101153698 | Ga0068852_1011536981 | 146 |
| 30 | 3300005834 | Ga0068851_10129505 | Ga0068851_101295053 | 146 |
| 31 | 3300009011 | Ga0105251_10009288 | Ga0105251_100092884 | 146 |
| 32 | 3300009545 | Ga0105237_10046738 | Ga0105237_100467383 | 146 |
| 33 | 3300010375 | Ga0105239_10696174 | Ga0105239_106961742 | 146 |
| 34 | 3300013100 | Ga0157373_10018144 | Ga0157373_100181445 | 146 |
| 35 | 3300013102 | Ga0157371_10203926 | Ga0157371_102039262 | 146 |
| 36 | 3300013102 | Ga0157371_10337127 | Ga0157371_103371273 | 146 |
| 37 | 3300013307 | Ga0157372_10629058 | Ga0157372_106290582 | 146 |
| 38 | 3300013307 | Ga0157372_10699514 | Ga0157372_106995142 | 146 |
| 39 | 3300014326 | Ga0157380_10173524 | Ga0157380_101735243 | 146 |
| 40 | 3300017792 | Ga0163161_10003807 | Ga0163161_100038077 | 146 |
| 41 | 3300021388 | Ga0213875_10000323 | Ga0213875_1000032318 | 146 |
| 42 | 3300025321 | Ga0207656_10079009 | Ga0207656_100790092 | 146 |
| 43 | 3300025735 | Ga0207713_1034815 | Ga0207713_10348154 | 146 |
| 44 | 3300025904 | Ga0207647_10011660 | Ga0207647_100116606 | 146 |
| 45 | 3300025909 | Ga0207705_10599319 | Ga0207705_105993192 | 146 |
| 46 | 3300025911 | Ga0207654_10019316 | Ga0207654_100193163 | 146 |
| 47 | 3300025914 | Ga0207671_10746045 | Ga0207671_107460452 | 146 |
| 48 | 3300025919 | Ga0207657_10009826 | Ga0207657_1000982610 | 146 |
| 49 | 3300025920 | Ga0207649_10011858 | Ga0207649_100118584 | 146 |
| 50 | 3300025944 | Ga0207661_10926278 | Ga0207661_109262781 | 146 |
| 51 | 3300025945 | Ga0207679_10053455 | Ga0207679_100534552 | 146 |
| 52 | 3300025949 | Ga0207667_10254274 | Ga0207667_102542743 | 146 |
| 53 | 3300025972 | Ga0207668_10125314 | Ga0207668_101253143 | 146 |
| 54 | 3300025981 | Ga0207640_10013098 | Ga0207640_100130986 | 146 |
| 55 | 3300025981 | Ga0207640_10640763 | Ga0207640_106407632 | 146 |
| 56 | 3300026041 | Ga0207639_10000269 | Ga0207639_100002695 | 146 |
| 57 | 3300026041 | Ga0207639_10190824 | Ga0207639_101908244 | 146 |
| 58 | 3300026067 | Ga0207678_10000400 | Ga0207678_1000040022 | 146 |
| 59 | 3300026078 | Ga0207702_10006623 | Ga0207702_100066233 | 146 |
| 60 | 3300026116 | Ga0207674_10003571 | Ga0207674_1000357112 | 146 |
| 61 | 3300028379 | Ga0268266_10043391 | Ga0268266_100433915 | 146 |
| 62 | 3300031548 | Ga0307408_100003396 | Ga0307408_1000033967 | 146 |
| 63 | 3300031548 | Ga0307408_100034106 | Ga0307408_1000341062 | 146 |
| 64 | 3300031731 | Ga0307405_10014422 | Ga0307405_100144222 | 146 |
| 65 | 3300031731 | Ga0307405_10017685 | Ga0307405_100176853 | 146 |
| 66 | 3300031901 | Ga0307406_10031543 | Ga0307406_100315433 | 146 |
| 67 | 3300031901 | Ga0307406_10232516 | Ga0307406_102325163 | 146 |
| 68 | 3300031911 | Ga0307412_10000933 | Ga0307412_1000093311 | 146 |
| 69 | 3300031911 | Ga0307412_10033013 | Ga0307412_100330133 | 146 |
| 70 | 3300032002 | Ga0307416_100090872 | Ga0307416_1000908722 | 146 |
| 71 | 3300032002 | Ga0307416_100967713 | Ga0307416_1009677131 | 146 |
| 72 | 3300032004 | Ga0307414_10187265 | Ga0307414_101872653 | 146 |
| 73 | 3300032004 | Ga0307414_10619787 | Ga0307414_106197872 | 146 |
| 74 | 3300032005 | Ga0307411_10099909 | Ga0307411_100999092 | 146 |
| 75 | 3300037853 | Ga0436364_0129444 | Ga0436364_0129444_16937_17377 | 146 |
| 76 | 3300039437 | Ga0436365_0285743 | Ga0436365_0285743_225_665 | 146 |
| 77 | 3300046460 | Ga0495638_0265450 | Ga0495638_0265450_42_482 | 146 |
| 78 | 3300047472 | Ga0495686_0002725 | Ga0495686_0002725_10971_11411 | 146 |
| 79 | 3300047472 | Ga0495686_0005357 | Ga0495686_0005357_7675_8115 | 146 |
| 80 | 3300048911 | Ga0496108_0003224 | Ga0496108_0003224_4725_5177 | 146 |
| 81 | 3300048911 | Ga0496108_0630829 | Ga0496108_0630829_81_521 | 146 |
| 82 | 3300048913 | Ga0496110_0302406 | Ga0496110_0302406_732_1172 | 146 |
| 83 | 3300048914 | Ga0496111_0085939 | Ga0496111_0085939_1182_1622 | 146 |
| 84 | 3300048914 | Ga0496111_0659231 | Ga0496111_0659231_76_528 | 146 |
| 85 | 3300048916 | Ga0496113_0506537 | Ga0496113_0506537_221_661 | 146 |
| 86 | 3300048919 | Ga0496116_0035885 | Ga0496116_0035885_165_617 | 146 |
| 87 | 3300048920 | Ga0496117_0215805 | Ga0496117_0215805_597_1049 | 146 |
| 88 | 3300048924 | Ga0496121_0000192 | Ga0496121_0000192_52078_52530 | 146 |
| 89 | 3300048925 | Ga0496122_0011471 | Ga0496122_0011471_3483_3923 | 146 |
| 90 | 3300048925 | Ga0496122_0568006 | Ga0496122_0568006_60_512 | 146 |
| 91 | 3300048927 | Ga0496124_0086543 | Ga0496124_0086543_913_1353 | 146 |
| 92 | 3300048927 | Ga0496124_0132276 | Ga0496124_0132276_228_680 | 146 |
| 93 | 3300048928 | Ga0496125_0001515 | Ga0496125_0001515_10671_11111 | 146 |
| 94 | 3300048928 | Ga0496125_0082923 | Ga0496125_0082923_102_554 | 146 |
| 95 | 3300048928 | Ga0496125_0154435 | Ga0496125_0154435_311_754 | 146 |
| 96 | 3300048929 | Ga0496126_0021282 | Ga0496126_0021282_4204_4656 | 146 |
| 97 | 3300048929 | Ga0496126_0438267 | Ga0496126_0438267_567_1007 | 146 |
| 98 | 3300049568 | Ga0501031_0301811 | Ga0501031_0301811_316_759 | 146 |
| 99 | 3300053108 | Ga0500562_000252 | Ga0500562_000252_3749_4189 | 146 |
| 100 | 3300053138 | Ga0500564_181945 | Ga0500564_181945_204_644 | 146 |
| 101 | 3300053160 | Ga0500633_0379462 | Ga0500633_0379462_39_479 | 146 |
| 102 | iso_pu_bacteria | 2643221541 | 2643727849 | 146 |
| 103 | iso_pu_bacteria | 2643221605 | 2644039103 | 146 |
| 104 | iso_pu_bacteria | 2643221606 | 2644043201 | 146 |
| 105 | iso_pu_bacteria | 2643221671 | 2644395368 | 146 |
| 106 | 2162886007 | SwRhRL2b_contig_645837 | SwRhRL2b_0319.00001190 | 147 |
| 107 | 3300001989 | JGI24739J22299_10081354 | JGI24739J22299_100813541 | 147 |
| 108 | 3300001990 | JGI24737J22298_10001502 | JGI24737J22298_100015029 | 147 |
| 109 | 3300002067 | JGI24735J21928_10000586 | JGI24735J21928_100005869 | 147 |
| 110 | 3300002075 | JGI24738J21930_10001423 | JGI24738J21930_100014234 | 147 |
| 111 | 3300002077 | JGI24744J21845_10000267 | JGI24744J21845_100002675 | 147 |
| 112 | 3300002459 | JGI24751J29686_10000195 | JGI24751J29686_1000019518 | 147 |
| 113 | 3300003322 | rootL2_10177419 | rootL2_101774195 | 147 |
| 114 | 3300005289 | Ga0065704_10008199 | Ga0065704_100081994 | 147 |
| 115 | 3300005295 | Ga0065707_10004914 | Ga0065707_100049145 | 147 |
| 116 | 3300005295 | Ga0065707_10087462 | Ga0065707_100874623 | 147 |
| 117 | 3300005327 | Ga0070658_10095369 | Ga0070658_100953692 | 147 |
| 118 | 3300005328 | Ga0070676_10163065 | Ga0070676_101630652 | 147 |
| 119 | 3300005331 | Ga0070670_100000033 | Ga0070670_10000003357 | 147 |
| 120 | 3300005331 | Ga0070670_100000639 | Ga0070670_10000063926 | 147 |
| 121 | 3300005331 | Ga0070670_101107550 | Ga0070670_1011075501 | 147 |
| 122 | 3300005335 | Ga0070666_10005633 | Ga0070666_100056334 | 147 |
| 123 | 3300005335 | Ga0070666_10034718 | Ga0070666_100347183 | 147 |
| 124 | 3300005339 | Ga0070660_100002644 | Ga0070660_10000264410 | 147 |
| 125 | 3300005339 | Ga0070660_100328190 | Ga0070660_1003281902 | 147 |
| 126 | 3300005339 | Ga0070660_100832701 | Ga0070660_1008327012 | 147 |
| 127 | 3300005344 | Ga0070661_100317610 | Ga0070661_1003176103 | 147 |
| 128 | 3300005347 | Ga0070668_100000003 | Ga0070668_10000000385 | 147 |
| 129 | 3300005347 | Ga0070668_100072912 | Ga0070668_1000729124 | 147 |
| 130 | 3300005353 | Ga0070669_100000005 | Ga0070669_10000000570 | 147 |
| 131 | 3300005353 | Ga0070669_100018613 | Ga0070669_1000186137 | 147 |
| 132 | 3300005353 | Ga0070669_100670740 | Ga0070669_1006707402 | 147 |
| 133 | 3300005354 | Ga0070675_100007973 | Ga0070675_1000079735 | 147 |
| 134 | 3300005355 | Ga0070671_100000061 | Ga0070671_10000006129 | 147 |
| 135 | 3300005355 | Ga0070671_100025946 | Ga0070671_1000259465 | 147 |
| 136 | 3300005355 | Ga0070671_101283880 | Ga0070671_1012838801 | 147 |
| 137 | 3300005356 | Ga0070674_100004933 | Ga0070674_1000049338 | 147 |
| 138 | 3300005366 | Ga0070659_100368488 | Ga0070659_1003684882 | 147 |
| 139 | 3300005367 | Ga0070667_100000035 | Ga0070667_100000035103 | 147 |
| 140 | 3300005367 | Ga0070667_100005221 | Ga0070667_10000522111 | 147 |
| 141 | 3300005367 | Ga0070667_101490851 | Ga0070667_1014908511 | 147 |
| 142 | 3300005455 | Ga0070663_100009261 | Ga0070663_1000092617 | 147 |
| 143 | 3300005456 | Ga0070678_100007498 | Ga0070678_1000074982 | 147 |
| 144 | 3300005457 | Ga0070662_100003187 | Ga0070662_1000031875 | 147 |
| 145 | 3300005457 | Ga0070662_101177392 | Ga0070662_1011773922 | 147 |
| 146 | 3300005539 | Ga0068853_100008080 | Ga0068853_1000080809 | 147 |
| 147 | 3300005543 | Ga0070672_100077827 | Ga0070672_1000778272 | 147 |
| 148 | 3300005548 | Ga0070665_100840519 | Ga0070665_1008405193 | 147 |
| 149 | 3300005577 | Ga0068857_100109767 | Ga0068857_1001097674 | 147 |
| 150 | 3300005578 | Ga0068854_100000051 | Ga0068854_10000005193 | 147 |
| 151 | 3300005578 | Ga0068854_100036629 | Ga0068854_1000366294 | 147 |
| 152 | 3300005616 | Ga0068852_100637643 | Ga0068852_1006376433 | 147 |
| 153 | 3300005617 | Ga0068859_100002190 | Ga0068859_10000219020 | 147 |
| 154 | 3300005617 | Ga0068859_100283695 | Ga0068859_1002836953 | 147 |
| 155 | 3300005618 | Ga0068864_100000042 | Ga0068864_10000004258 | 147 |
| 156 | 3300005618 | Ga0068864_100000861 | Ga0068864_10000086110 | 147 |
| 157 | 3300005719 | Ga0068861_100002413 | Ga0068861_1000024133 | 147 |
| 158 | 3300005841 | Ga0068863_100001950 | Ga0068863_10000195024 | 147 |
| 159 | 3300005841 | Ga0068863_100026727 | Ga0068863_1000267273 | 147 |
| 160 | 3300005842 | Ga0068858_100000465 | Ga0068858_10000046512 | 147 |
| 161 | 3300005843 | Ga0068860_100000106 | Ga0068860_10000010633 | 147 |
| 162 | 3300005843 | Ga0068860_100332267 | Ga0068860_1003322672 | 147 |
| 163 | 3300005844 | Ga0068862_100000005 | Ga0068862_10000000577 | 147 |
| 164 | 3300005844 | Ga0068862_100000677 | Ga0068862_1000006779 | 147 |
| 165 | 3300005844 | Ga0068862_100323134 | Ga0068862_1003231342 | 147 |
| 166 | 3300006237 | Ga0097621_100020039 | Ga0097621_1000200398 | 147 |
| 167 | 3300006881 | Ga0068865_100277064 | Ga0068865_1002770642 | 147 |
| 168 | 3300006931 | Ga0097620_100002190 | Ga0097620_1000021904 | 147 |
| 169 | 3300006931 | Ga0097620_100283708 | Ga0097620_1002837083 | 147 |
| 170 | 3300009147 | Ga0114129_10116752 | Ga0114129_101167523 | 147 |
| 171 | 3300009148 | Ga0105243_10092224 | Ga0105243_100922244 | 147 |
| 172 | 3300009174 | Ga0105241_10314105 | Ga0105241_103141053 | 147 |
| 173 | 3300009177 | Ga0105248_10000171 | Ga0105248_1000017116 | 147 |
| 174 | 3300009177 | Ga0105248_10375099 | Ga0105248_103750992 | 147 |
| 175 | 3300009545 | Ga0105237_10002989 | Ga0105237_1000298919 | 147 |
| 176 | 3300009551 | Ga0105238_10020860 | Ga0105238_1002086010 | 147 |
| 177 | 3300009551 | Ga0105238_10266463 | Ga0105238_102664634 | 147 |
| 178 | 3300009978 | Ga0105148_100086 | Ga0105148_10008615 | 147 |
| 179 | 3300010375 | Ga0105239_10000061 | Ga0105239_1000006139 | 147 |
| 180 | 3300010375 | Ga0105239_10857415 | Ga0105239_108574152 | 147 |
| 181 | 3300013100 | Ga0157373_10077309 | Ga0157373_100773094 | 147 |
| 182 | 3300013100 | Ga0157373_10221824 | Ga0157373_102218242 | 147 |
| 183 | 3300013102 | Ga0157371_10031118 | Ga0157371_100311184 | 147 |
| 184 | 3300013102 | Ga0157371_10110145 | Ga0157371_101101452 | 147 |
| 185 | 3300013105 | Ga0157369_10214837 | Ga0157369_102148372 | 147 |
| 186 | 3300013296 | Ga0157374_10021559 | Ga0157374_100215595 | 147 |
| 187 | 3300013307 | Ga0157372_10033614 | Ga0157372_100336144 | 147 |
| 188 | 3300013307 | Ga0157372_10649250 | Ga0157372_106492502 | 147 |
| 189 | 3300013307 | Ga0157372_10683702 | Ga0157372_106837022 | 147 |
| 190 | 3300014325 | Ga0163163_10013144 | Ga0163163_100131444 | 147 |
| 191 | 3300014326 | Ga0157380_10006098 | Ga0157380_1000609810 | 147 |
| 192 | 3300014968 | Ga0157379_10613519 | Ga0157379_106135192 | 147 |
| 193 | 3300017792 | Ga0163161_10272792 | Ga0163161_102727923 | 147 |
| 194 | 3300025903 | Ga0207680_10053938 | Ga0207680_100539383 | 147 |
| 195 | 3300025904 | Ga0207647_10000195 | Ga0207647_1000019540 | 147 |
| 196 | 3300025904 | Ga0207647_10003079 | Ga0207647_100030793 | 147 |
| 197 | 3300025904 | Ga0207647_10189258 | Ga0207647_101892582 | 147 |
| 198 | 3300025907 | Ga0207645_10160816 | Ga0207645_101608162 | 147 |
| 199 | 3300025909 | Ga0207705_10001763 | Ga0207705_100017638 | 147 |
| 200 | 3300025909 | Ga0207705_10182371 | Ga0207705_101823714 | 147 |
| 201 | 3300025909 | Ga0207705_10794718 | Ga0207705_107947182 | 147 |
| 202 | 3300025911 | Ga0207654_10275515 | Ga0207654_102755152 | 147 |
| 203 | 3300025913 | Ga0207695_10013684 | Ga0207695_100136849 | 147 |
| 204 | 3300025914 | Ga0207671_10005232 | Ga0207671_100052327 | 147 |
| 205 | 3300025919 | Ga0207657_10008571 | Ga0207657_100085713 | 147 |
| 206 | 3300025919 | Ga0207657_10321694 | Ga0207657_103216942 | 147 |
| 207 | 3300025919 | Ga0207657_10769920 | Ga0207657_107699202 | 147 |
| 208 | 3300025920 | Ga0207649_10222954 | Ga0207649_102229542 | 147 |
| 209 | 3300025923 | Ga0207681_10000003 | Ga0207681_10000003243 | 147 |
| 210 | 3300025923 | Ga0207681_10014843 | Ga0207681_100148433 | 147 |
| 211 | 3300025923 | Ga0207681_10019678 | Ga0207681_100196787 | 147 |
| 212 | 3300025924 | Ga0207694_10129588 | Ga0207694_101295882 | 147 |
| 213 | 3300025924 | Ga0207694_10474608 | Ga0207694_104746082 | 147 |
| 214 | 3300025925 | Ga0207650_10000012 | Ga0207650_10000012251 | 147 |
| 215 | 3300025925 | Ga0207650_10015130 | Ga0207650_100151304 | 147 |
| 216 | 3300025926 | Ga0207659_10007049 | Ga0207659_100070493 | 147 |
| 217 | 3300025931 | Ga0207644_10000069 | Ga0207644_1000006951 | 147 |
| 218 | 3300025931 | Ga0207644_10599692 | Ga0207644_105996923 | 147 |
| 219 | 3300025932 | Ga0207690_10195924 | Ga0207690_101959242 | 147 |
| 220 | 3300025932 | Ga0207690_10396391 | Ga0207690_103963912 | 147 |
| 221 | 3300025933 | Ga0207706_10003037 | Ga0207706_1000303711 | 147 |
| 222 | 3300025933 | Ga0207706_10126025 | Ga0207706_101260255 | 147 |
| 223 | 3300025933 | Ga0207706_10384653 | Ga0207706_103846532 | 147 |
| 224 | 3300025935 | Ga0207709_10078439 | Ga0207709_100784391 | 147 |
| 225 | 3300025937 | Ga0207669_10002608 | Ga0207669_100026089 | 147 |
| 226 | 3300025938 | Ga0207704_10263487 | Ga0207704_102634872 | 147 |
| 227 | 3300025940 | Ga0207691_10060811 | Ga0207691_100608113 | 147 |
| 228 | 3300025941 | Ga0207711_10001461 | Ga0207711_100014617 | 147 |
| 229 | 3300025941 | Ga0207711_10370348 | Ga0207711_103703483 | 147 |
| 230 | 3300025972 | Ga0207668_10000006 | Ga0207668_1000000681 | 147 |
| 231 | 3300025972 | Ga0207668_10026421 | Ga0207668_100264214 | 147 |
| 232 | 3300025981 | Ga0207640_10001537 | Ga0207640_1000153712 | 147 |
| 233 | 3300025981 | Ga0207640_10017027 | Ga0207640_100170272 | 147 |
| 234 | 3300025986 | Ga0207658_10000026 | Ga0207658_1000002628 | 147 |
| 235 | 3300025986 | Ga0207658_10009247 | Ga0207658_100092475 | 147 |
| 236 | 3300026035 | Ga0207703_10000234 | Ga0207703_1000023412 | 147 |
| 237 | 3300026041 | Ga0207639_10012721 | Ga0207639_100127215 | 147 |
| 238 | 3300026041 | Ga0207639_10027130 | Ga0207639_100271303 | 147 |
| 239 | 3300026067 | Ga0207678_10001983 | Ga0207678_100019838 | 147 |
| 240 | 3300026088 | Ga0207641_10000617 | Ga0207641_1000061724 | 147 |
| 241 | 3300026088 | Ga0207641_10001438 | Ga0207641_1000143819 | 147 |
| 242 | 3300026095 | Ga0207676_10000009 | Ga0207676_10000009240 | 147 |
| 243 | 3300026095 | Ga0207676_10004386 | Ga0207676_100043868 | 147 |
| 244 | 3300026118 | Ga0207675_100001338 | Ga0207675_10000133812 | 147 |
| 245 | 3300026121 | Ga0207683_10026399 | Ga0207683_100263997 | 147 |
| 246 | 3300026142 | Ga0207698_12349426 | Ga0207698_123494262 | 147 |
| 247 | 3300028380 | Ga0268265_10000001 | Ga0268265_10000001169 | 147 |
| 248 | 3300028380 | Ga0268265_10000380 | Ga0268265_1000038036 | 147 |
| 249 | 3300028380 | Ga0268265_10399614 | Ga0268265_103996142 | 147 |
| 250 | 3300028381 | Ga0268264_10000076 | Ga0268264_10000076159 | 147 |
| 251 | 3300028381 | Ga0268264_10472080 | Ga0268264_104720802 | 147 |
| 252 | 3300031548 | Ga0307408_100288246 | Ga0307408_1002882462 | 147 |
| 253 | 3300031731 | Ga0307405_11027322 | Ga0307405_110273222 | 147 |
| 254 | 3300031911 | Ga0307412_10013627 | Ga0307412_100136273 | 147 |
| 255 | 3300037471 | Ga0395905_0015362 | Ga0395905_0015362_6717_7169 | 147 |
| 256 | 3300037471 | Ga0395905_0325084 | Ga0395905_0325084_13_465 | 147 |
| 257 | 3300038443 | Ga0395901_0605102 | Ga0395901_0605102_94_546 | 147 |
| 258 | 3300041443 | Ga0451789_0739190 | Ga0451789_0739190_43_501 | 147 |
| 259 | 3300041460 | Ga0451802_0768085 | Ga0451802_0768085_921_1373 | 147 |
| 260 | 3300041462 | Ga0451806_295426 | Ga0451806_295426_855_1307 | 147 |
| 261 | 3300041486 | Ga0451807_2500641 | Ga0451807_2500641_1506_1958 | 147 |
| 262 | 3300041501 | Ga0451845_0392982 | Ga0451845_0392982_48_500 | 147 |
| 263 | 3300041505 | Ga0451849_0243155 | Ga0451849_0243155_466_918 | 147 |
| 264 | 3300042157 | Ga0439458_0022048 | Ga0439458_0022048_72_524 | 147 |
| 265 | 3300044659 | Ga0466973_0107406 | Ga0466973_0107406_824_1309 | 147 |
| 266 | 3300044684 | Ga0466966_0020439 | Ga0466966_0020439_3279_3731 | 147 |
| 267 | 3300044693 | Ga0466961_0295990 | Ga0466961_0295990_185_637 | 147 |
| 268 | 3300044694 | Ga0466963_0239465 | Ga0466963_0239465_113_565 | 147 |
| 269 | 3300044719 | Ga0466971_0373601 | Ga0466971_0373601_35_487 | 147 |
| 270 | 3300044765 | Ga0466970_0093515 | Ga0466970_0093515_1116_1568 | 147 |
| 271 | 3300045049 | Ga0466959_0072564 | Ga0466959_0072564_1394_1846 | 147 |
| 272 | 3300045836 | Ga0466958_0066211 | Ga0466958_0066211_705_1157 | 147 |
| 273 | 3300046491 | Ga0495584_0049795 | Ga0495584_0049795_720_1163 | 147 |
| 274 | 3300046519 | Ga0495632_0000001 | Ga0495632_0000001_199897_200340 | 147 |
| 275 | 3300046520 | Ga0495637_0000330 | Ga0495637_0000330_11640_12083 | 147 |
| 276 | 3300046522 | Ga0495643_0000020 | Ga0495643_0000020_184763_185206 | 147 |
| 277 | 3300046524 | Ga0495648_0126528 | Ga0495648_0126528_637_1080 | 147 |
| 278 | 3300046525 | Ga0495663_0000002 | Ga0495663_0000002_198227_198670 | 147 |
| 279 | 3300046558 | Ga0495633_0000213 | Ga0495633_0000213_32867_33310 | 147 |
| 280 | 3300046558 | Ga0495633_0003218 | Ga0495633_0003218_10050_10493 | 147 |
| 281 | 3300046558 | Ga0495633_0110138 | Ga0495633_0110138_717_1163 | 147 |
| 282 | 3300046558 | Ga0495633_0150619 | Ga0495633_0150619_102_545 | 147 |
| 283 | 3300046692 | Ga0495671_0000016 | Ga0495671_0000016_184763_185206 | 147 |
| 284 | 3300047443 | Ga0495687_080891 | Ga0495687_080891_526_978 | 147 |
| 285 | 3300047469 | Ga0495673_0035658 | Ga0495673_0035658_898_1365 | 147 |
| 286 | 3300047470 | Ga0495681_0003075 | Ga0495681_0003075_6783_7226 | 147 |
| 287 | 3300047472 | Ga0495686_0000197 | Ga0495686_0000197_32760_33227 | 147 |
| 288 | 3300047472 | Ga0495686_0029169 | Ga0495686_0029169_1796_2239 | 147 |
| 289 | 3300048903 | Ga0496100_0176740 | Ga0496100_0176740_453_905 | 147 |
| 290 | 3300048920 | Ga0496117_0084685 | Ga0496117_0084685_339_806 | 147 |
| 291 | 3300048921 | Ga0496118_0026247 | Ga0496118_0026247_2730_3197 | 147 |
| 292 | 3300048921 | Ga0496118_0089205 | Ga0496118_0089205_123_590 | 147 |
| 293 | 3300048922 | Ga0496119_0072336 | Ga0496119_0072336_806_1273 | 147 |
| 294 | 3300048924 | Ga0496121_0000584 | Ga0496121_0000584_27290_27757 | 147 |
| 295 | 3300048924 | Ga0496121_0010392 | Ga0496121_0010392_1316_1783 | 147 |
| 296 | 3300048924 | Ga0496121_0071730 | Ga0496121_0071730_38_505 | 147 |
| 297 | 3300048927 | Ga0496124_0552451 | Ga0496124_0552451_36_494 | 147 |
| 298 | 3300048928 | Ga0496125_0011116 | Ga0496125_0011116_1013_1471 | 147 |
| 299 | 3300048928 | Ga0496125_0328550 | Ga0496125_0328550_421_867 | 147 |
| 300 | 3300048929 | Ga0496126_0072270 | Ga0496126_0072270_417_863 | 147 |
| 301 | 3300048929 | Ga0496126_0236607 | Ga0496126_0236607_597_1055 | 147 |
| 302 | 3300048929 | Ga0496126_0248848 | Ga0496126_0248848_527_994 | 147 |
| 303 | 3300049569 | Ga0501032_0199879 | Ga0501032_0199879_93_554 | 147 |
| 304 | 3300049579 | Ga0501043_0050154 | Ga0501043_0050154_143_604 | 147 |
| 305 | 3300049579 | Ga0501043_0204577 | Ga0501043_0204577_985_1452 | 147 |
| 306 | 3300049580 | Ga0501046_0031392 | Ga0501046_0031392_17_478 | 147 |
| 307 | 3300049581 | Ga0501047_0001735 | Ga0501047_0001735_3914_4375 | 147 |
| 308 | 3300049581 | Ga0501047_0897711 | Ga0501047_0897711_99_566 | 147 |
| 309 | 3300049582 | Ga0501048_0079289 | Ga0501048_0079289_10_471 | 147 |
| 310 | 3300049663 | Ga0501223_000004 | Ga0501223_000004_136042_136485 | 147 |
| 311 | 3300049669 | Ga0501235_000242 | Ga0501235_000242_2584_3027 | 147 |
| 312 | 3300049670 | Ga0501236_004068 | Ga0501236_004068_441_884 | 147 |
| 313 | 3300049676 | Ga0501246_000921 | Ga0501246_000921_309_752 | 147 |
| 314 | 3300049705 | Ga0501225_0000003 | Ga0501225_0000003_4358_4801 | 147 |
| 315 | 3300049705 | Ga0501225_0000673 | Ga0501225_0000673_8425_8868 | 147 |
| 316 | 3300049705 | Ga0501225_0006456 | Ga0501225_0006456_2221_2664 | 147 |
| 317 | 3300049778 | Ga0501282_009829 | Ga0501282_009829_384_839 | 147 |
| 318 | 3300049823 | Ga0501044_0101391 | Ga0501044_0101391_689_1156 | 147 |
| 319 | 3300050493 | nmdc:mga0k408_582610_c1 | nmdc:mga0k408_582610_c1_40_498 | 147 |
| 320 | 3300050496 | nmdc:mga07m45_193628_c1 | nmdc:mga07m45_193628_c1_261_719 | 147 |
| 321 | 3300053087 | Ga0500643_006760 | Ga0500643_006760_3739_4185 | 147 |
| 322 | 3300053136 | Ga0500559_0045313 | Ga0500559_0045313_377_868 | 147 |
| 323 | 3300053157 | Ga0500624_000099 | Ga0500624_000099_25942_26388 | 147 |
| 324 | 3300053157 | Ga0500624_001219 | Ga0500624_001219_2420_2866 | 147 |
| 325 | 3300053177 | Ga0500636_0019007 | Ga0500636_0019007_3481_3927 | 147 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1nvi-assembly1.cif.gz_E-2 | orthorhombic crystal form of molybdopterin synthase | 0.9578 | 1 | 145 |
| 1nvj-assembly1.cif.gz_A | deletion mutant (delta 141) of molybdopterin synthase | 0.9546 | 1 | 120 |
| 1nvj-assembly1.cif.gz_B | deletion mutant (delta 141) of molybdopterin synthase | 0.9498 | 1 | 120 |
| 1nvi-assembly1.cif.gz_E-2 | orthorhombic crystal form of molybdopterin synthase | 0.9447 | 1 | 145 |
| 1nvj-assembly2.cif.gz_C | deletion mutant (delta 141) of molybdopterin synthase | 0.9335 | 1 | 120 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1fmaE00 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.9557 | 2 | 145 | 3.90.1170.40 |
| af_Q86HF4_1_145_3.90.1170.40 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.939 | 2 | 132 | 3.90.1170.40 |
| 1fmaE00 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.9362 | 2 | 145 | 3.90.1170.40 |
| 1nvjC00 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.9335 | 1 | 120 | 3.90.1170.40 |
| af_Q6AY59_40_191_3.90.1170.40 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.9254 | 2 | 133 | 3.90.1170.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1B6Z5U6-F1-model_v4 | Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) | 0.987 | 1 | 147 |
GO:0006777
GO:0030366 |
| AF-A0A248LE25-F1-model_v4 | Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) | 0.9807 | 52 | 147 |
GO:0006777
GO:0030366 |
| AF-A0A1Z5YSD3-F1-model_v4 | Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) | 0.9801 | 1 | 145 |
GO:0006777
GO:0030366 |
| AF-A0A1W9JY99-F1-model_v4 | deleted | 0.9795 | 3 | 147 |
|
| AF-A0A526YMD2-F1-model_v4 | Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) | 0.9789 | 26 | 147 |
GO:0006777
GO:0030366 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar