F408065

General Info

Members Datasets Scaffolds Average Seq Length
325 194 316 150

Family's Representative Sequence

Representative Sequence 3300053136|Ga0500559_0045313|Ga0500559_0045313_377_868
Length 163
Sequence MSIRVAAQEADFDVGAELARLEALGGGGVASFTGVVRGDDSGKAGGAAGLTALRLEAYPGMTQRALEGIAAEAATRWSLAGLTLIHRFGTLGIGDRIVLVGTAARHRAAALEACAFLIDWAKTKAPLWKQEIFADGTTRWIEPRASDDAAAAEWDASAEHGKP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
3 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
4 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
5 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
6 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
7 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
8 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
9 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
10 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
11 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
12 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
13 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
14 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
15 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
16 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
17 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
18 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
19 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
130 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
131 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
132 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
133 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
134 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
135 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
136 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
137 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
141 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
142 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
145 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
146 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
147 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
148 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
149 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
150 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
151 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
152 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
153 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
154 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
155 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
156 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
164 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
165 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
166 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
167 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
168 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
169 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
170 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
171 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
172 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
179 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
180 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
181 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
182 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
183 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
184 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
187 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
188 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
189 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
190 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
191 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
192 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
193 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
194 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.23
Metatranscriptomes 0
Isolates 2.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.38
Nodule 0
Rhizoplane 3.38
Rhizosphere 82.15
Stem 0
Stem Tuber 0
Unclassified 11.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_645837 2162886007 Bacteria 2865
2 JGI24736J21556_1001483 3300001904 Bacteria 4292
3 JGI24741J21665_1000228 3300001915 Bacteria 16799
4 JGI24740J21852_10008724 3300001979 Bacteria 4024
5 JGI24739J22299_10002767 3300001989 Bacteria 6741
6 JGI24739J22299_10081354 3300001989 Bacteria 995
7 JGI24737J22298_10001502 3300001990 Bacteria 8302
8 JGI24737J22298_10068479 3300001990 Bacteria 1061
9 JGI24735J21928_10000586 3300002067 Bacteria 12808
10 JGI24735J21928_10003416 3300002067 Bacteria 5416
11 JGI24738J21930_10001423 3300002075 Bacteria 6636
12 JGI24738J21930_10007152 3300002075 Bacteria 2587
13 JGI24738J21930_10010385 3300002075 Bacteria 2073
14 JGI24744J21845_10000267 3300002077 Bacteria 8508
15 JGI24751J29686_10000195 3300002459 Bacteria 26688
16 rootL2_10177419 3300003322 Bacteria 2302
17 Ga0065704_10008199 3300005289 Bacteria 4967
18 Ga0065707_10004914 3300005295 Bacteria 4993
19 Ga0065707_10087462 3300005295 Bacteria 5014
20 Ga0070658_10095369 3300005327 Bacteria 2456
21 Ga0070658_10294339 3300005327 Bacteria 1384
22 Ga0070676_10163065 3300005328 Bacteria 1436
23 Ga0070670_100000033 3300005331 Bacteria 158509
24 Ga0070670_100000639 3300005331 Bacteria 27231
25 Ga0070670_101107550 3300005331 Unclassified 722
26 Ga0070666_10005633 3300005335 Bacteria 7686
27 Ga0070666_10034718 3300005335 Bacteria 3342
28 Ga0070660_100002644 3300005339 Bacteria 12315
29 Ga0070660_100006410 3300005339 Bacteria 8154
30 Ga0070660_100328190 3300005339 Bacteria 1258
31 Ga0070660_100832701 3300005339 Bacteria 777
32 Ga0070661_100059465 3300005344 Bacteria 2802
33 Ga0070661_100317610 3300005344 Bacteria 1216
34 Ga0070668_100000003 3300005347 Bacteria 195738
35 Ga0070668_100072912 3300005347 Bacteria 2676
36 Ga0070669_100000005 3300005353 Bacteria 309134
37 Ga0070669_100018613 3300005353 Bacteria 4964
38 Ga0070669_100670740 3300005353 Bacteria 873
39 Ga0070675_100007973 3300005354 Bacteria 8207
40 Ga0070671_100000061 3300005355 Bacteria 73646
41 Ga0070671_100025946 3300005355 Bacteria 4812
42 Ga0070671_101283880 3300005355 Unclassified 645
43 Ga0070674_100004933 3300005356 Bacteria 7648
44 Ga0070659_100368488 3300005366 Bacteria 1208
45 Ga0070667_100000035 3300005367 Bacteria 173461
46 Ga0070667_100005221 3300005367 Bacteria 10854
47 Ga0070667_101324173 3300005367 Bacteria 675
48 Ga0070667_101490851 3300005367 Bacteria 635
49 Ga0070663_100009261 3300005455 Bacteria 6092
50 Ga0070678_100007498 3300005456 Bacteria 6478
51 Ga0070662_100003187 3300005457 Bacteria 10196
52 Ga0070662_100305064 3300005457 Bacteria 1294
53 Ga0070662_101177392 3300005457 Bacteria 659
54 Ga0068853_100008080 3300005539 Bacteria 8441
55 Ga0068853_100331425 3300005539 Bacteria 1412
56 Ga0070672_100077827 3300005543 Bacteria 2653
57 Ga0070665_100840519 3300005548 Bacteria 931
58 Ga0070664_100121726 3300005564 Bacteria 2285
59 Ga0068857_100109767 3300005577 Bacteria 2479
60 Ga0068857_100237961 3300005577 Bacteria 1666
61 Ga0068854_100000051 3300005578 Bacteria 86667
62 Ga0068854_100036629 3300005578 Bacteria 3441
63 Ga0068856_100008621 3300005614 Bacteria 9916
64 Ga0068852_100515573 3300005616 Bacteria 1192
65 Ga0068852_100637643 3300005616 Bacteria 1072
66 Ga0068852_100873100 3300005616 Bacteria 916
67 Ga0068852_101153698 3300005616 Bacteria 795
68 Ga0068859_100002190 3300005617 Bacteria 19848
69 Ga0068859_100283695 3300005617 Bacteria 1749
70 Ga0068864_100000042 3300005618 Bacteria 162930
71 Ga0068864_100000861 3300005618 Bacteria 25572
72 Ga0068861_100002413 3300005719 Bacteria 12172
73 Ga0068851_10129505 3300005834 Bacteria 1363
74 Ga0068863_100001950 3300005841 Bacteria 20502
75 Ga0068863_100026727 3300005841 Bacteria 5503
76 Ga0068858_100000465 3300005842 Bacteria 42293
77 Ga0068860_100000106 3300005843 Bacteria 133556
78 Ga0068860_100332267 3300005843 Bacteria 1493
79 Ga0068862_100000005 3300005844 Bacteria 350713
80 Ga0068862_100000677 3300005844 Bacteria 34813
81 Ga0068862_100323134 3300005844 Bacteria 1425
82 Ga0097621_100020039 3300006237 Bacteria 5149
83 Ga0068865_100277064 3300006881 Bacteria 1334
84 Ga0097620_100002190 3300006931 Bacteria 19848
85 Ga0097620_100283708 3300006931 Bacteria 1749
86 Ga0105251_10009288 3300009011 Bacteria 5822
87 Ga0114129_10116752 3300009147 Bacteria 3677
88 Ga0105243_10092224 3300009148 Bacteria 2497
89 Ga0105241_10314105 3300009174 Bacteria 1349
90 Ga0105248_10000171 3300009177 Bacteria 75565
91 Ga0105248_10375099 3300009177 Bacteria 1601
92 Ga0105237_10002989 3300009545 Bacteria 20424
93 Ga0105237_10046738 3300009545 Bacteria 4354
94 Ga0105238_10020860 3300009551 Bacteria 6675
95 Ga0105238_10266463 3300009551 Bacteria 1693
96 Ga0105148_100086 3300009978 Bacteria 14695
97 Ga0105239_10000061 3300010375 Bacteria 154661
98 Ga0105239_10696174 3300010375 Bacteria 1162
99 Ga0105239_10857415 3300010375 Bacteria 1042
100 Ga0157373_10018144 3300013100 Bacteria 5125
101 Ga0157373_10077309 3300013100 Bacteria 2348
102 Ga0157373_10221824 3300013100 Bacteria 1334
103 Ga0157371_10031118 3300013102 Bacteria 3845
104 Ga0157371_10110145 3300013102 Bacteria 1955
105 Ga0157371_10203926 3300013102 Bacteria 1418
106 Ga0157371_10337127 3300013102 Bacteria 1096
107 Ga0157369_10214837 3300013105 Bacteria 2014
108 Ga0157374_10021559 3300013296 Bacteria 5735
109 Ga0157372_10033614 3300013307 Bacteria 5635
110 Ga0157372_10629058 3300013307 Bacteria 1250
111 Ga0157372_10649250 3300013307 Bacteria 1229
112 Ga0157372_10683702 3300013307 Bacteria 1194
113 Ga0157372_10699514 3300013307 Bacteria 1179
114 Ga0163163_10013144 3300014325 Bacteria 7565
115 Ga0157380_10006098 3300014326 Bacteria 8448
116 Ga0157380_10173524 3300014326 Bacteria 1886
117 Ga0157379_10613519 3300014968 Bacteria 1016
118 Ga0163161_10003807 3300017792 Bacteria 10577
119 Ga0163161_10272792 3300017792 Bacteria 1324
120 Ga0213875_10000323 3300021388 Bacteria 45327
121 Ga0207656_10079009 3300025321 Bacteria 1475
122 Ga0207713_1034815 3300025735 Bacteria 2182
123 Ga0207680_10053938 3300025903 Bacteria 2416
124 Ga0207647_10000195 3300025904 Bacteria 49520
125 Ga0207647_10003079 3300025904 Bacteria 12537
126 Ga0207647_10011660 3300025904 Bacteria 6155
127 Ga0207647_10189258 3300025904 Bacteria 1193
128 Ga0207645_10160816 3300025907 Bacteria 1469
129 Ga0207705_10001763 3300025909 Bacteria 17086
130 Ga0207705_10182371 3300025909 Bacteria 1585
131 Ga0207705_10599319 3300025909 Bacteria 857
132 Ga0207705_10794718 3300025909 Bacteria 734
133 Ga0207654_10019316 3300025911 Bacteria 3595
134 Ga0207654_10275515 3300025911 Bacteria 1136
135 Ga0207695_10013684 3300025913 Bacteria 9657
136 Ga0207671_10005232 3300025914 Bacteria 12051
137 Ga0207671_10746045 3300025914 Bacteria 778
138 Ga0207657_10008571 3300025919 Bacteria 10361
139 Ga0207657_10009826 3300025919 Bacteria 9585
140 Ga0207657_10321694 3300025919 Bacteria 1223
141 Ga0207657_10769920 3300025919 Bacteria 745
142 Ga0207649_10011858 3300025920 Bacteria 4821
143 Ga0207649_10222954 3300025920 Bacteria 1344
144 Ga0207681_10000003 3300025923 Bacteria 713245
145 Ga0207681_10014843 3300025923 Bacteria 4851
146 Ga0207681_10019678 3300025923 Bacteria 4269
147 Ga0207694_10129588 3300025924 Bacteria 2021
148 Ga0207694_10474608 3300025924 Bacteria 1046
149 Ga0207650_10000012 3300025925 Bacteria 437889
150 Ga0207650_10015130 3300025925 Bacteria 5369
151 Ga0207659_10007049 3300025926 Bacteria 6897
152 Ga0207644_10000069 3300025931 Bacteria 75201
153 Ga0207644_10599692 3300025931 Bacteria 914
154 Ga0207690_10195924 3300025932 Bacteria 1531
155 Ga0207690_10396391 3300025932 Bacteria 1100
156 Ga0207706_10003037 3300025933 Bacteria 16179
157 Ga0207706_10126025 3300025933 Bacteria 2252
158 Ga0207706_10384653 3300025933 Bacteria 1217
159 Ga0207709_10078439 3300025935 Bacteria 2120
160 Ga0207669_10002608 3300025937 Bacteria 7711
161 Ga0207704_10263487 3300025938 Bacteria 1301
162 Ga0207691_10060811 3300025940 Bacteria 3432
163 Ga0207711_10001461 3300025941 Bacteria 22080
164 Ga0207711_10370348 3300025941 Bacteria 1328
165 Ga0207661_10926278 3300025944 Bacteria 803
166 Ga0207679_10053455 3300025945 Bacteria 2968
167 Ga0207667_10254274 3300025949 Bacteria 1797
168 Ga0207668_10000006 3300025972 Bacteria 191468
169 Ga0207668_10026421 3300025972 Bacteria 3769
170 Ga0207668_10125314 3300025972 Bacteria 1952
171 Ga0207640_10001537 3300025981 Bacteria 12441
172 Ga0207640_10013098 3300025981 Bacteria 4743
173 Ga0207640_10017027 3300025981 Bacteria 4244
174 Ga0207640_10640763 3300025981 Bacteria 904
175 Ga0207658_10000026 3300025986 Bacteria 178292
176 Ga0207658_10009247 3300025986 Bacteria 6683
177 Ga0207703_10000234 3300026035 Bacteria 63325
178 Ga0207639_10000269 3300026041 Bacteria 37143
179 Ga0207639_10012721 3300026041 Bacteria 5870
180 Ga0207639_10027130 3300026041 Bacteria 4168
181 Ga0207639_10190824 3300026041 Bacteria 1750
182 Ga0207678_10000400 3300026067 Bacteria 39732
183 Ga0207678_10001983 3300026067 Bacteria 18643
184 Ga0207702_10006623 3300026078 Bacteria 9964
185 Ga0207641_10000617 3300026088 Bacteria 38890
186 Ga0207641_10001438 3300026088 Bacteria 23396
187 Ga0207676_10000009 3300026095 Bacteria 545256
188 Ga0207676_10004386 3300026095 Bacteria 9979
189 Ga0207674_10003571 3300026116 Bacteria 18967
190 Ga0207675_100001338 3300026118 Bacteria 24709
191 Ga0207683_10026399 3300026121 Bacteria 5012
192 Ga0207698_12349426 3300026142 Bacteria 545
193 Ga0268266_10043391 3300028379 Bacteria 3843
194 Ga0268265_10000001 3300028380 Bacteria 1230727
195 Ga0268265_10000380 3300028380 Bacteria 47826
196 Ga0268265_10399614 3300028380 Bacteria 1270
197 Ga0268264_10000076 3300028381 Bacteria 255518
198 Ga0268264_10472080 3300028381 Bacteria 1219
199 Ga0307408_100003396 3300031548 Bacteria 10921
200 Ga0307408_100034106 3300031548 Bacteria 3561
201 Ga0307408_100288246 3300031548 Bacteria 1370
202 Ga0307405_10014422 3300031731 Bacteria 4250
203 Ga0307405_10017685 3300031731 Bacteria 3918
204 Ga0307405_11027322 3300031731 Bacteria 705
205 Ga0307406_10031543 3300031901 Bacteria 3228
206 Ga0307406_10232516 3300031901 Bacteria 1377
207 Ga0307412_10000933 3300031911 Bacteria 16724
208 Ga0307412_10013627 3300031911 Bacteria 4774
209 Ga0307412_10033013 3300031911 Bacteria 3285
210 Ga0307416_100090872 3300032002 Bacteria 2620
211 Ga0307416_100967713 3300032002 Bacteria 953
212 Ga0307414_10187265 3300032004 Bacteria 1671
213 Ga0307414_10619787 3300032004 Bacteria 972
214 Ga0307411_10099909 3300032005 Bacteria 2049
215 Ga0395905_0015362 3300037471 Bacteria 7277
216 Ga0395905_0325084 3300037471 Bacteria 1428
217 Ga0436364_0129444 3300037853 Bacteria 50814
218 Ga0395901_0605102 3300038443 Bacteria 1105
219 Ga0436365_0285743 3300039437 Bacteria 711
220 Ga0451789_0739190 3300041443 Bacteria 547
221 Ga0451802_0768085 3300041460 Bacteria 1834
222 Ga0451806_295426 3300041462 Bacteria 2967
223 Ga0451807_2500641 3300041486 Bacteria 2041
224 Ga0451845_0392982 3300041501 Bacteria 693
225 Ga0451849_0243155 3300041505 Bacteria 988
226 Ga0439458_0022048 3300042157 Bacteria 1477
227 Ga0466973_0107406 3300044659 Bacteria 2345
228 Ga0466966_0020439 3300044684 Bacteria 4353
229 Ga0466961_0295990 3300044693 Bacteria 989
230 Ga0466963_0239465 3300044694 Bacteria 1272
231 Ga0466971_0373601 3300044719 Bacteria 692
232 Ga0466970_0093515 3300044765 Bacteria 1633
233 Ga0466959_0072564 3300045049 Bacteria 2491
234 Ga0466958_0066211 3300045836 Bacteria 2206
235 Ga0495638_0265450 3300046460 Bacteria 939
236 Ga0495638_0307406 3300046460 Bacteria 852
237 Ga0495584_0049795 3300046491 Bacteria 2110
238 Ga0495632_0000001 3300046519 Bacteria 873295
239 Ga0495637_0000330 3300046520 Bacteria 36746
240 Ga0495643_0000020 3300046522 Bacteria 294973
241 Ga0495648_0126528 3300046524 Bacteria 1364
242 Ga0495663_0000002 3300046525 Bacteria 495384
243 Ga0495633_0000213 3300046558 Bacteria 72710
244 Ga0495633_0003218 3300046558 Bacteria 11022
245 Ga0495633_0110138 3300046558 Bacteria 1276
246 Ga0495633_0150619 3300046558 Bacteria 1074
247 Ga0495671_0000016 3300046692 Bacteria 294821
248 Ga0495687_080891 3300047443 Bacteria 1273
249 Ga0495673_0035658 3300047469 Bacteria 2289
250 Ga0495681_0003075 3300047470 Bacteria 11701
251 Ga0495686_0000197 3300047472 Bacteria 112818
252 Ga0495686_0002725 3300047472 Bacteria 16154
253 Ga0495686_0005357 3300047472 Bacteria 10149
254 Ga0495686_0029169 3300047472 Bacteria 3591
255 Ga0496100_0176740 3300048903 Bacteria 1542
256 Ga0496108_0003224 3300048911 Bacteria 13116
257 Ga0496108_0630829 3300048911 Bacteria 932
258 Ga0496110_0302406 3300048913 Bacteria 1457
259 Ga0496111_0085939 3300048914 Bacteria 2301
260 Ga0496111_0659231 3300048914 Bacteria 763
261 Ga0496113_0506537 3300048916 Bacteria 969
262 Ga0496116_0035885 3300048919 Bacteria 3478
263 Ga0496117_0084685 3300048920 Bacteria 2067
264 Ga0496117_0215805 3300048920 Bacteria 1072
265 Ga0496118_0026247 3300048921 Bacteria 4969
266 Ga0496118_0089205 3300048921 Bacteria 2130
267 Ga0496119_0072336 3300048922 Bacteria 2015
268 Ga0496121_0000192 3300048924 Bacteria 136529
269 Ga0496121_0000584 3300048924 Bacteria 68507
270 Ga0496121_0010392 3300048924 Bacteria 10509
271 Ga0496121_0071730 3300048924 Bacteria 2784
272 Ga0496122_0011471 3300048925 Bacteria 8966
273 Ga0496122_0568006 3300048925 Bacteria 537
274 Ga0496124_0086543 3300048927 Bacteria 2564
275 Ga0496124_0132276 3300048927 Bacteria 1980
276 Ga0496124_0552451 3300048927 Bacteria 760
277 Ga0496125_0001515 3300048928 Bacteria 33290
278 Ga0496125_0011116 3300048928 Bacteria 9030
279 Ga0496125_0082923 3300048928 Bacteria 2441
280 Ga0496125_0154435 3300048928 Bacteria 1570
281 Ga0496125_0328550 3300048928 Bacteria 923
282 Ga0496126_0021282 3300048929 Bacteria 6337
283 Ga0496126_0072270 3300048929 Bacteria 3069
284 Ga0496126_0236607 3300048929 Bacteria 1528
285 Ga0496126_0248848 3300048929 Bacteria 1482
286 Ga0496126_0438267 3300048929 Bacteria 1054
287 Ga0501031_0301811 3300049568 Bacteria 1038
288 Ga0501032_0199879 3300049569 Bacteria 1304
289 Ga0501043_0050154 3300049579 Bacteria 3281
290 Ga0501043_0204577 3300049579 Bacteria 1531
291 Ga0501046_0031392 3300049580 Bacteria 4306
292 Ga0501047_0001735 3300049581 Bacteria 21178
293 Ga0501047_0001840 3300049581 Bacteria 20467
294 Ga0501047_0897711 3300049581 Bacteria 700
295 Ga0501048_0079289 3300049582 Bacteria 2317
296 Ga0501223_000004 3300049663 Bacteria 141027
297 Ga0501235_000242 3300049669 Bacteria 9987
298 Ga0501236_004068 3300049670 Bacteria 1724
299 Ga0501246_000921 3300049676 Bacteria 2198
300 Ga0501225_0000003 3300049705 Bacteria 141070
301 Ga0501225_0000673 3300049705 Bacteria 10658
302 Ga0501225_0006456 3300049705 Bacteria 3423
303 Ga0501083_0839970 3300049744 Bacteria 598
304 Ga0501282_009829 3300049778 Bacteria 1026
305 Ga0501044_0101391 3300049823 Bacteria 2896
306 nmdc:mga0k408_582610_c1 3300050493 Bacteria 660
307 nmdc:mga07m45_193628_c1 3300050496 Bacteria 1182
308 Ga0500643_006760 3300053087 Bacteria 4734
309 Ga0500562_000252 3300053108 Bacteria 13785
310 Ga0500559_0004676 3300053136 Bacteria 6447
311 Ga0500559_0045313 3300053136 Bacteria 1925
312 Ga0500564_181945 3300053138 Bacteria 876
313 Ga0500624_000099 3300053157 Bacteria 42473
314 Ga0500624_001219 3300053157 Bacteria 4599
315 Ga0500633_0379462 3300053160 Bacteria 512
316 Ga0500636_0019007 3300053177 Bacteria 4065

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300002075 JGI24738J21930_10010385 JGI24738J21930_100103854 130
2 3300046460 Ga0495638_0307406 Ga0495638_0307406_198_623 141
3 iso_pu_bacteria 2775507255 2778124435 142
4 iso_pu_bacteria 2808606401 2809061832 143
5 iso_pu_bacteria 2808606404 2809077796 143
6 iso_pu_bacteria 2808606405 2809082496 143
7 iso_pu_bacteria 2880518877 2880519985 143
8 3300005616 Ga0068852_100873100 Ga0068852_1008731002 145
9 3300049581 Ga0501047_0001840 Ga0501047_0001840_15278_15718 145
10 3300049744 Ga0501083_0839970 Ga0501083_0839970_106_546 145
11 3300053136 Ga0500559_0004676 Ga0500559_0004676_3641_4078 145
12 3300001904 JGI24736J21556_1001483 JGI24736J21556_10014834 146
13 3300001915 JGI24741J21665_1000228 JGI24741J21665_100022813 146
14 3300001979 JGI24740J21852_10008724 JGI24740J21852_100087244 146
15 3300001989 JGI24739J22299_10002767 JGI24739J22299_100027676 146
16 3300001990 JGI24737J22298_10068479 JGI24737J22298_100684792 146
17 3300002067 JGI24735J21928_10003416 JGI24735J21928_100034163 146
18 3300002075 JGI24738J21930_10007152 JGI24738J21930_100071522 146
19 3300005327 Ga0070658_10294339 Ga0070658_102943392 146
20 3300005339 Ga0070660_100006410 Ga0070660_1000064102 146
21 3300005344 Ga0070661_100059465 Ga0070661_1000594652 146
22 3300005367 Ga0070667_101324173 Ga0070667_1013241731 146
23 3300005457 Ga0070662_100305064 Ga0070662_1003050642 146
24 3300005539 Ga0068853_100331425 Ga0068853_1003314252 146
25 3300005564 Ga0070664_100121726 Ga0070664_1001217262 146
26 3300005577 Ga0068857_100237961 Ga0068857_1002379612 146
27 3300005614 Ga0068856_100008621 Ga0068856_1000086218 146
28 3300005616 Ga0068852_100515573 Ga0068852_1005155732 146
29 3300005616 Ga0068852_101153698 Ga0068852_1011536981 146
30 3300005834 Ga0068851_10129505 Ga0068851_101295053 146
31 3300009011 Ga0105251_10009288 Ga0105251_100092884 146
32 3300009545 Ga0105237_10046738 Ga0105237_100467383 146
33 3300010375 Ga0105239_10696174 Ga0105239_106961742 146
34 3300013100 Ga0157373_10018144 Ga0157373_100181445 146
35 3300013102 Ga0157371_10203926 Ga0157371_102039262 146
36 3300013102 Ga0157371_10337127 Ga0157371_103371273 146
37 3300013307 Ga0157372_10629058 Ga0157372_106290582 146
38 3300013307 Ga0157372_10699514 Ga0157372_106995142 146
39 3300014326 Ga0157380_10173524 Ga0157380_101735243 146
40 3300017792 Ga0163161_10003807 Ga0163161_100038077 146
41 3300021388 Ga0213875_10000323 Ga0213875_1000032318 146
42 3300025321 Ga0207656_10079009 Ga0207656_100790092 146
43 3300025735 Ga0207713_1034815 Ga0207713_10348154 146
44 3300025904 Ga0207647_10011660 Ga0207647_100116606 146
45 3300025909 Ga0207705_10599319 Ga0207705_105993192 146
46 3300025911 Ga0207654_10019316 Ga0207654_100193163 146
47 3300025914 Ga0207671_10746045 Ga0207671_107460452 146
48 3300025919 Ga0207657_10009826 Ga0207657_1000982610 146
49 3300025920 Ga0207649_10011858 Ga0207649_100118584 146
50 3300025944 Ga0207661_10926278 Ga0207661_109262781 146
51 3300025945 Ga0207679_10053455 Ga0207679_100534552 146
52 3300025949 Ga0207667_10254274 Ga0207667_102542743 146
53 3300025972 Ga0207668_10125314 Ga0207668_101253143 146
54 3300025981 Ga0207640_10013098 Ga0207640_100130986 146
55 3300025981 Ga0207640_10640763 Ga0207640_106407632 146
56 3300026041 Ga0207639_10000269 Ga0207639_100002695 146
57 3300026041 Ga0207639_10190824 Ga0207639_101908244 146
58 3300026067 Ga0207678_10000400 Ga0207678_1000040022 146
59 3300026078 Ga0207702_10006623 Ga0207702_100066233 146
60 3300026116 Ga0207674_10003571 Ga0207674_1000357112 146
61 3300028379 Ga0268266_10043391 Ga0268266_100433915 146
62 3300031548 Ga0307408_100003396 Ga0307408_1000033967 146
63 3300031548 Ga0307408_100034106 Ga0307408_1000341062 146
64 3300031731 Ga0307405_10014422 Ga0307405_100144222 146
65 3300031731 Ga0307405_10017685 Ga0307405_100176853 146
66 3300031901 Ga0307406_10031543 Ga0307406_100315433 146
67 3300031901 Ga0307406_10232516 Ga0307406_102325163 146
68 3300031911 Ga0307412_10000933 Ga0307412_1000093311 146
69 3300031911 Ga0307412_10033013 Ga0307412_100330133 146
70 3300032002 Ga0307416_100090872 Ga0307416_1000908722 146
71 3300032002 Ga0307416_100967713 Ga0307416_1009677131 146
72 3300032004 Ga0307414_10187265 Ga0307414_101872653 146
73 3300032004 Ga0307414_10619787 Ga0307414_106197872 146
74 3300032005 Ga0307411_10099909 Ga0307411_100999092 146
75 3300037853 Ga0436364_0129444 Ga0436364_0129444_16937_17377 146
76 3300039437 Ga0436365_0285743 Ga0436365_0285743_225_665 146
77 3300046460 Ga0495638_0265450 Ga0495638_0265450_42_482 146
78 3300047472 Ga0495686_0002725 Ga0495686_0002725_10971_11411 146
79 3300047472 Ga0495686_0005357 Ga0495686_0005357_7675_8115 146
80 3300048911 Ga0496108_0003224 Ga0496108_0003224_4725_5177 146
81 3300048911 Ga0496108_0630829 Ga0496108_0630829_81_521 146
82 3300048913 Ga0496110_0302406 Ga0496110_0302406_732_1172 146
83 3300048914 Ga0496111_0085939 Ga0496111_0085939_1182_1622 146
84 3300048914 Ga0496111_0659231 Ga0496111_0659231_76_528 146
85 3300048916 Ga0496113_0506537 Ga0496113_0506537_221_661 146
86 3300048919 Ga0496116_0035885 Ga0496116_0035885_165_617 146
87 3300048920 Ga0496117_0215805 Ga0496117_0215805_597_1049 146
88 3300048924 Ga0496121_0000192 Ga0496121_0000192_52078_52530 146
89 3300048925 Ga0496122_0011471 Ga0496122_0011471_3483_3923 146
90 3300048925 Ga0496122_0568006 Ga0496122_0568006_60_512 146
91 3300048927 Ga0496124_0086543 Ga0496124_0086543_913_1353 146
92 3300048927 Ga0496124_0132276 Ga0496124_0132276_228_680 146
93 3300048928 Ga0496125_0001515 Ga0496125_0001515_10671_11111 146
94 3300048928 Ga0496125_0082923 Ga0496125_0082923_102_554 146
95 3300048928 Ga0496125_0154435 Ga0496125_0154435_311_754 146
96 3300048929 Ga0496126_0021282 Ga0496126_0021282_4204_4656 146
97 3300048929 Ga0496126_0438267 Ga0496126_0438267_567_1007 146
98 3300049568 Ga0501031_0301811 Ga0501031_0301811_316_759 146
99 3300053108 Ga0500562_000252 Ga0500562_000252_3749_4189 146
100 3300053138 Ga0500564_181945 Ga0500564_181945_204_644 146
101 3300053160 Ga0500633_0379462 Ga0500633_0379462_39_479 146
102 iso_pu_bacteria 2643221541 2643727849 146
103 iso_pu_bacteria 2643221605 2644039103 146
104 iso_pu_bacteria 2643221606 2644043201 146
105 iso_pu_bacteria 2643221671 2644395368 146
106 2162886007 SwRhRL2b_contig_645837 SwRhRL2b_0319.00001190 147
107 3300001989 JGI24739J22299_10081354 JGI24739J22299_100813541 147
108 3300001990 JGI24737J22298_10001502 JGI24737J22298_100015029 147
109 3300002067 JGI24735J21928_10000586 JGI24735J21928_100005869 147
110 3300002075 JGI24738J21930_10001423 JGI24738J21930_100014234 147
111 3300002077 JGI24744J21845_10000267 JGI24744J21845_100002675 147
112 3300002459 JGI24751J29686_10000195 JGI24751J29686_1000019518 147
113 3300003322 rootL2_10177419 rootL2_101774195 147
114 3300005289 Ga0065704_10008199 Ga0065704_100081994 147
115 3300005295 Ga0065707_10004914 Ga0065707_100049145 147
116 3300005295 Ga0065707_10087462 Ga0065707_100874623 147
117 3300005327 Ga0070658_10095369 Ga0070658_100953692 147
118 3300005328 Ga0070676_10163065 Ga0070676_101630652 147
119 3300005331 Ga0070670_100000033 Ga0070670_10000003357 147
120 3300005331 Ga0070670_100000639 Ga0070670_10000063926 147
121 3300005331 Ga0070670_101107550 Ga0070670_1011075501 147
122 3300005335 Ga0070666_10005633 Ga0070666_100056334 147
123 3300005335 Ga0070666_10034718 Ga0070666_100347183 147
124 3300005339 Ga0070660_100002644 Ga0070660_10000264410 147
125 3300005339 Ga0070660_100328190 Ga0070660_1003281902 147
126 3300005339 Ga0070660_100832701 Ga0070660_1008327012 147
127 3300005344 Ga0070661_100317610 Ga0070661_1003176103 147
128 3300005347 Ga0070668_100000003 Ga0070668_10000000385 147
129 3300005347 Ga0070668_100072912 Ga0070668_1000729124 147
130 3300005353 Ga0070669_100000005 Ga0070669_10000000570 147
131 3300005353 Ga0070669_100018613 Ga0070669_1000186137 147
132 3300005353 Ga0070669_100670740 Ga0070669_1006707402 147
133 3300005354 Ga0070675_100007973 Ga0070675_1000079735 147
134 3300005355 Ga0070671_100000061 Ga0070671_10000006129 147
135 3300005355 Ga0070671_100025946 Ga0070671_1000259465 147
136 3300005355 Ga0070671_101283880 Ga0070671_1012838801 147
137 3300005356 Ga0070674_100004933 Ga0070674_1000049338 147
138 3300005366 Ga0070659_100368488 Ga0070659_1003684882 147
139 3300005367 Ga0070667_100000035 Ga0070667_100000035103 147
140 3300005367 Ga0070667_100005221 Ga0070667_10000522111 147
141 3300005367 Ga0070667_101490851 Ga0070667_1014908511 147
142 3300005455 Ga0070663_100009261 Ga0070663_1000092617 147
143 3300005456 Ga0070678_100007498 Ga0070678_1000074982 147
144 3300005457 Ga0070662_100003187 Ga0070662_1000031875 147
145 3300005457 Ga0070662_101177392 Ga0070662_1011773922 147
146 3300005539 Ga0068853_100008080 Ga0068853_1000080809 147
147 3300005543 Ga0070672_100077827 Ga0070672_1000778272 147
148 3300005548 Ga0070665_100840519 Ga0070665_1008405193 147
149 3300005577 Ga0068857_100109767 Ga0068857_1001097674 147
150 3300005578 Ga0068854_100000051 Ga0068854_10000005193 147
151 3300005578 Ga0068854_100036629 Ga0068854_1000366294 147
152 3300005616 Ga0068852_100637643 Ga0068852_1006376433 147
153 3300005617 Ga0068859_100002190 Ga0068859_10000219020 147
154 3300005617 Ga0068859_100283695 Ga0068859_1002836953 147
155 3300005618 Ga0068864_100000042 Ga0068864_10000004258 147
156 3300005618 Ga0068864_100000861 Ga0068864_10000086110 147
157 3300005719 Ga0068861_100002413 Ga0068861_1000024133 147
158 3300005841 Ga0068863_100001950 Ga0068863_10000195024 147
159 3300005841 Ga0068863_100026727 Ga0068863_1000267273 147
160 3300005842 Ga0068858_100000465 Ga0068858_10000046512 147
161 3300005843 Ga0068860_100000106 Ga0068860_10000010633 147
162 3300005843 Ga0068860_100332267 Ga0068860_1003322672 147
163 3300005844 Ga0068862_100000005 Ga0068862_10000000577 147
164 3300005844 Ga0068862_100000677 Ga0068862_1000006779 147
165 3300005844 Ga0068862_100323134 Ga0068862_1003231342 147
166 3300006237 Ga0097621_100020039 Ga0097621_1000200398 147
167 3300006881 Ga0068865_100277064 Ga0068865_1002770642 147
168 3300006931 Ga0097620_100002190 Ga0097620_1000021904 147
169 3300006931 Ga0097620_100283708 Ga0097620_1002837083 147
170 3300009147 Ga0114129_10116752 Ga0114129_101167523 147
171 3300009148 Ga0105243_10092224 Ga0105243_100922244 147
172 3300009174 Ga0105241_10314105 Ga0105241_103141053 147
173 3300009177 Ga0105248_10000171 Ga0105248_1000017116 147
174 3300009177 Ga0105248_10375099 Ga0105248_103750992 147
175 3300009545 Ga0105237_10002989 Ga0105237_1000298919 147
176 3300009551 Ga0105238_10020860 Ga0105238_1002086010 147
177 3300009551 Ga0105238_10266463 Ga0105238_102664634 147
178 3300009978 Ga0105148_100086 Ga0105148_10008615 147
179 3300010375 Ga0105239_10000061 Ga0105239_1000006139 147
180 3300010375 Ga0105239_10857415 Ga0105239_108574152 147
181 3300013100 Ga0157373_10077309 Ga0157373_100773094 147
182 3300013100 Ga0157373_10221824 Ga0157373_102218242 147
183 3300013102 Ga0157371_10031118 Ga0157371_100311184 147
184 3300013102 Ga0157371_10110145 Ga0157371_101101452 147
185 3300013105 Ga0157369_10214837 Ga0157369_102148372 147
186 3300013296 Ga0157374_10021559 Ga0157374_100215595 147
187 3300013307 Ga0157372_10033614 Ga0157372_100336144 147
188 3300013307 Ga0157372_10649250 Ga0157372_106492502 147
189 3300013307 Ga0157372_10683702 Ga0157372_106837022 147
190 3300014325 Ga0163163_10013144 Ga0163163_100131444 147
191 3300014326 Ga0157380_10006098 Ga0157380_1000609810 147
192 3300014968 Ga0157379_10613519 Ga0157379_106135192 147
193 3300017792 Ga0163161_10272792 Ga0163161_102727923 147
194 3300025903 Ga0207680_10053938 Ga0207680_100539383 147
195 3300025904 Ga0207647_10000195 Ga0207647_1000019540 147
196 3300025904 Ga0207647_10003079 Ga0207647_100030793 147
197 3300025904 Ga0207647_10189258 Ga0207647_101892582 147
198 3300025907 Ga0207645_10160816 Ga0207645_101608162 147
199 3300025909 Ga0207705_10001763 Ga0207705_100017638 147
200 3300025909 Ga0207705_10182371 Ga0207705_101823714 147
201 3300025909 Ga0207705_10794718 Ga0207705_107947182 147
202 3300025911 Ga0207654_10275515 Ga0207654_102755152 147
203 3300025913 Ga0207695_10013684 Ga0207695_100136849 147
204 3300025914 Ga0207671_10005232 Ga0207671_100052327 147
205 3300025919 Ga0207657_10008571 Ga0207657_100085713 147
206 3300025919 Ga0207657_10321694 Ga0207657_103216942 147
207 3300025919 Ga0207657_10769920 Ga0207657_107699202 147
208 3300025920 Ga0207649_10222954 Ga0207649_102229542 147
209 3300025923 Ga0207681_10000003 Ga0207681_10000003243 147
210 3300025923 Ga0207681_10014843 Ga0207681_100148433 147
211 3300025923 Ga0207681_10019678 Ga0207681_100196787 147
212 3300025924 Ga0207694_10129588 Ga0207694_101295882 147
213 3300025924 Ga0207694_10474608 Ga0207694_104746082 147
214 3300025925 Ga0207650_10000012 Ga0207650_10000012251 147
215 3300025925 Ga0207650_10015130 Ga0207650_100151304 147
216 3300025926 Ga0207659_10007049 Ga0207659_100070493 147
217 3300025931 Ga0207644_10000069 Ga0207644_1000006951 147
218 3300025931 Ga0207644_10599692 Ga0207644_105996923 147
219 3300025932 Ga0207690_10195924 Ga0207690_101959242 147
220 3300025932 Ga0207690_10396391 Ga0207690_103963912 147
221 3300025933 Ga0207706_10003037 Ga0207706_1000303711 147
222 3300025933 Ga0207706_10126025 Ga0207706_101260255 147
223 3300025933 Ga0207706_10384653 Ga0207706_103846532 147
224 3300025935 Ga0207709_10078439 Ga0207709_100784391 147
225 3300025937 Ga0207669_10002608 Ga0207669_100026089 147
226 3300025938 Ga0207704_10263487 Ga0207704_102634872 147
227 3300025940 Ga0207691_10060811 Ga0207691_100608113 147
228 3300025941 Ga0207711_10001461 Ga0207711_100014617 147
229 3300025941 Ga0207711_10370348 Ga0207711_103703483 147
230 3300025972 Ga0207668_10000006 Ga0207668_1000000681 147
231 3300025972 Ga0207668_10026421 Ga0207668_100264214 147
232 3300025981 Ga0207640_10001537 Ga0207640_1000153712 147
233 3300025981 Ga0207640_10017027 Ga0207640_100170272 147
234 3300025986 Ga0207658_10000026 Ga0207658_1000002628 147
235 3300025986 Ga0207658_10009247 Ga0207658_100092475 147
236 3300026035 Ga0207703_10000234 Ga0207703_1000023412 147
237 3300026041 Ga0207639_10012721 Ga0207639_100127215 147
238 3300026041 Ga0207639_10027130 Ga0207639_100271303 147
239 3300026067 Ga0207678_10001983 Ga0207678_100019838 147
240 3300026088 Ga0207641_10000617 Ga0207641_1000061724 147
241 3300026088 Ga0207641_10001438 Ga0207641_1000143819 147
242 3300026095 Ga0207676_10000009 Ga0207676_10000009240 147
243 3300026095 Ga0207676_10004386 Ga0207676_100043868 147
244 3300026118 Ga0207675_100001338 Ga0207675_10000133812 147
245 3300026121 Ga0207683_10026399 Ga0207683_100263997 147
246 3300026142 Ga0207698_12349426 Ga0207698_123494262 147
247 3300028380 Ga0268265_10000001 Ga0268265_10000001169 147
248 3300028380 Ga0268265_10000380 Ga0268265_1000038036 147
249 3300028380 Ga0268265_10399614 Ga0268265_103996142 147
250 3300028381 Ga0268264_10000076 Ga0268264_10000076159 147
251 3300028381 Ga0268264_10472080 Ga0268264_104720802 147
252 3300031548 Ga0307408_100288246 Ga0307408_1002882462 147
253 3300031731 Ga0307405_11027322 Ga0307405_110273222 147
254 3300031911 Ga0307412_10013627 Ga0307412_100136273 147
255 3300037471 Ga0395905_0015362 Ga0395905_0015362_6717_7169 147
256 3300037471 Ga0395905_0325084 Ga0395905_0325084_13_465 147
257 3300038443 Ga0395901_0605102 Ga0395901_0605102_94_546 147
258 3300041443 Ga0451789_0739190 Ga0451789_0739190_43_501 147
259 3300041460 Ga0451802_0768085 Ga0451802_0768085_921_1373 147
260 3300041462 Ga0451806_295426 Ga0451806_295426_855_1307 147
261 3300041486 Ga0451807_2500641 Ga0451807_2500641_1506_1958 147
262 3300041501 Ga0451845_0392982 Ga0451845_0392982_48_500 147
263 3300041505 Ga0451849_0243155 Ga0451849_0243155_466_918 147
264 3300042157 Ga0439458_0022048 Ga0439458_0022048_72_524 147
265 3300044659 Ga0466973_0107406 Ga0466973_0107406_824_1309 147
266 3300044684 Ga0466966_0020439 Ga0466966_0020439_3279_3731 147
267 3300044693 Ga0466961_0295990 Ga0466961_0295990_185_637 147
268 3300044694 Ga0466963_0239465 Ga0466963_0239465_113_565 147
269 3300044719 Ga0466971_0373601 Ga0466971_0373601_35_487 147
270 3300044765 Ga0466970_0093515 Ga0466970_0093515_1116_1568 147
271 3300045049 Ga0466959_0072564 Ga0466959_0072564_1394_1846 147
272 3300045836 Ga0466958_0066211 Ga0466958_0066211_705_1157 147
273 3300046491 Ga0495584_0049795 Ga0495584_0049795_720_1163 147
274 3300046519 Ga0495632_0000001 Ga0495632_0000001_199897_200340 147
275 3300046520 Ga0495637_0000330 Ga0495637_0000330_11640_12083 147
276 3300046522 Ga0495643_0000020 Ga0495643_0000020_184763_185206 147
277 3300046524 Ga0495648_0126528 Ga0495648_0126528_637_1080 147
278 3300046525 Ga0495663_0000002 Ga0495663_0000002_198227_198670 147
279 3300046558 Ga0495633_0000213 Ga0495633_0000213_32867_33310 147
280 3300046558 Ga0495633_0003218 Ga0495633_0003218_10050_10493 147
281 3300046558 Ga0495633_0110138 Ga0495633_0110138_717_1163 147
282 3300046558 Ga0495633_0150619 Ga0495633_0150619_102_545 147
283 3300046692 Ga0495671_0000016 Ga0495671_0000016_184763_185206 147
284 3300047443 Ga0495687_080891 Ga0495687_080891_526_978 147
285 3300047469 Ga0495673_0035658 Ga0495673_0035658_898_1365 147
286 3300047470 Ga0495681_0003075 Ga0495681_0003075_6783_7226 147
287 3300047472 Ga0495686_0000197 Ga0495686_0000197_32760_33227 147
288 3300047472 Ga0495686_0029169 Ga0495686_0029169_1796_2239 147
289 3300048903 Ga0496100_0176740 Ga0496100_0176740_453_905 147
290 3300048920 Ga0496117_0084685 Ga0496117_0084685_339_806 147
291 3300048921 Ga0496118_0026247 Ga0496118_0026247_2730_3197 147
292 3300048921 Ga0496118_0089205 Ga0496118_0089205_123_590 147
293 3300048922 Ga0496119_0072336 Ga0496119_0072336_806_1273 147
294 3300048924 Ga0496121_0000584 Ga0496121_0000584_27290_27757 147
295 3300048924 Ga0496121_0010392 Ga0496121_0010392_1316_1783 147
296 3300048924 Ga0496121_0071730 Ga0496121_0071730_38_505 147
297 3300048927 Ga0496124_0552451 Ga0496124_0552451_36_494 147
298 3300048928 Ga0496125_0011116 Ga0496125_0011116_1013_1471 147
299 3300048928 Ga0496125_0328550 Ga0496125_0328550_421_867 147
300 3300048929 Ga0496126_0072270 Ga0496126_0072270_417_863 147
301 3300048929 Ga0496126_0236607 Ga0496126_0236607_597_1055 147
302 3300048929 Ga0496126_0248848 Ga0496126_0248848_527_994 147
303 3300049569 Ga0501032_0199879 Ga0501032_0199879_93_554 147
304 3300049579 Ga0501043_0050154 Ga0501043_0050154_143_604 147
305 3300049579 Ga0501043_0204577 Ga0501043_0204577_985_1452 147
306 3300049580 Ga0501046_0031392 Ga0501046_0031392_17_478 147
307 3300049581 Ga0501047_0001735 Ga0501047_0001735_3914_4375 147
308 3300049581 Ga0501047_0897711 Ga0501047_0897711_99_566 147
309 3300049582 Ga0501048_0079289 Ga0501048_0079289_10_471 147
310 3300049663 Ga0501223_000004 Ga0501223_000004_136042_136485 147
311 3300049669 Ga0501235_000242 Ga0501235_000242_2584_3027 147
312 3300049670 Ga0501236_004068 Ga0501236_004068_441_884 147
313 3300049676 Ga0501246_000921 Ga0501246_000921_309_752 147
314 3300049705 Ga0501225_0000003 Ga0501225_0000003_4358_4801 147
315 3300049705 Ga0501225_0000673 Ga0501225_0000673_8425_8868 147
316 3300049705 Ga0501225_0006456 Ga0501225_0006456_2221_2664 147
317 3300049778 Ga0501282_009829 Ga0501282_009829_384_839 147
318 3300049823 Ga0501044_0101391 Ga0501044_0101391_689_1156 147
319 3300050493 nmdc:mga0k408_582610_c1 nmdc:mga0k408_582610_c1_40_498 147
320 3300050496 nmdc:mga07m45_193628_c1 nmdc:mga07m45_193628_c1_261_719 147
321 3300053087 Ga0500643_006760 Ga0500643_006760_3739_4185 147
322 3300053136 Ga0500559_0045313 Ga0500559_0045313_377_868 147
323 3300053157 Ga0500624_000099 Ga0500624_000099_25942_26388 147
324 3300053157 Ga0500624_001219 Ga0500624_001219_2420_2866 147
325 3300053177 Ga0500636_0019007 Ga0500636_0019007_3481_3927 147

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02391

MoaE

MoaE protein

7

124

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nvi-assembly1.cif.gz_E-2 orthorhombic crystal form of molybdopterin synthase 0.9578 1 145
1nvj-assembly1.cif.gz_A deletion mutant (delta 141) of molybdopterin synthase 0.9546 1 120
1nvj-assembly1.cif.gz_B deletion mutant (delta 141) of molybdopterin synthase 0.9498 1 120
1nvi-assembly1.cif.gz_E-2 orthorhombic crystal form of molybdopterin synthase 0.9447 1 145
1nvj-assembly2.cif.gz_C deletion mutant (delta 141) of molybdopterin synthase 0.9335 1 120
ID Description Score Start End Superfamily
1fmaE00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9557 2 145 3.90.1170.40
af_Q86HF4_1_145_3.90.1170.40 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.939 2 132 3.90.1170.40
1fmaE00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9362 2 145 3.90.1170.40
1nvjC00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9335 1 120 3.90.1170.40
af_Q6AY59_40_191_3.90.1170.40 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9254 2 133 3.90.1170.40
ID Description Score Start End GO Terms
AF-A0A1B6Z5U6-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.987 1 147 GO:0006777
GO:0030366
AF-A0A248LE25-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.9807 52 147 GO:0006777
GO:0030366
AF-A0A1Z5YSD3-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.9801 1 145 GO:0006777
GO:0030366
AF-A0A1W9JY99-F1-model_v4 deleted 0.9795 3 147
AF-A0A526YMD2-F1-model_v4 Molybdopterin synthase catalytic subunit (EC 2.8.1.12) (MPT synthase subunit 2) (Molybdenum cofactor biosynthesis protein E) (Molybdopterin-converting factor large subunit) (Molybdopterin-converting factor subunit 2) 0.9789 26 147 GO:0006777
GO:0030366

Feature Viewer

pLDDT pTM Quality
93.86 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map