F408076

General Info

Members Datasets Scaffolds Average Seq Length
325 236 315 211

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2513237104|2513721287
Length 252
Sequence DSLSTKARRIPWNKGKLIGAKPPLRPNQVWSIRTRLLIERRPRDLALFNLAIDSKLRGCDVVALRVEDVAPNGYAVDRATVRQKKTGRPVKFELTDQTRQAVDDFLKEAGKRPGEYLFTGRRGRDRAMTTRQYARLLADWVASIGLDPRVFGTHSLRRTKATLIYRRTGNLRAVQLLLGHTKIESTVRYLGIEVDDALAIAEQVDVRNTRQSGHALPVGHQPLRAMSGLMRREKSRAIRSFRRHGRAASVAD

Samples

Sample ID Description Type Environment
1 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
2 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
3 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
4 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
5 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
6 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
7 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
8 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
9 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
10 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
88 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
127 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
128 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
129 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
130 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
131 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
132 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
135 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
136 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
137 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
138 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
140 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
141 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
142 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
143 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
144 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
151 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
157 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
158 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
159 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
168 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
169 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
173 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
174 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
177 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
178 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
179 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
180 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
183 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
188 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
189 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
190 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
205 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
206 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
207 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
208 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
209 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
210 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
222 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
223 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
224 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
225 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
226 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
227 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
228 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
229 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
230 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
231 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
232 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
233 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.92
Metatranscriptomes 0
Isolates 3.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.77
Nodule 2.77
Rhizoplane 2.46
Rhizosphere 78.15
Stem 0
Stem Tuber 0
Unclassified 1.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10034312 3300003659 Bacteria 1081
2 Ga0055539_1007459 3300003752 Bacteria 1384
3 Ga0055536_1003945 3300003781 Bacteria 7778
4 Ga0065715_10101193 3300005293 Bacteria 3229
5 Ga0065707_10181177 3300005295 Bacteria 1417
6 Ga0070658_10187966 3300005327 Bacteria 1740
7 Ga0070658_10263773 3300005327 Bacteria 1463
8 Ga0068869_100002931 3300005334 Bacteria 10356
9 Ga0068869_100185494 3300005334 Bacteria 1633
10 Ga0070666_10147225 3300005335 Bacteria 1642
11 Ga0070680_100119659 3300005336 Bacteria 2197
12 Ga0070680_100298202 3300005336 Bacteria 1367
13 Ga0070689_100868429 3300005340 Bacteria 797
14 Ga0070661_100013314 3300005344 Bacteria 5774
15 Ga0070668_100701173 3300005347 Bacteria 893
16 Ga0070675_100052977 3300005354 Bacteria 3337
17 Ga0070674_100157258 3300005356 Bacteria 1721
18 Ga0070674_100409110 3300005356 Bacteria 1110
19 Ga0070673_100198272 3300005364 Unclassified 1728
20 Ga0070688_100314319 3300005365 Bacteria 1136
21 Ga0070709_10088159 3300005434 Bacteria 2040
22 Ga0070709_10669815 3300005434 Bacteria 805
23 Ga0070713_100015501 3300005436 Bacteria 5702
24 Ga0070710_10356338 3300005437 Bacteria 970
25 Ga0070708_100163023 3300005445 Bacteria 2078
26 Ga0070708_100824687 3300005445 Bacteria 872
27 Ga0070708_101029693 3300005445 Bacteria 772
28 Ga0070678_100840181 3300005456 Unclassified 836
29 Ga0070662_100026279 3300005457 Bacteria 4030
30 Ga0070662_100543629 3300005457 Bacteria 973
31 Ga0070681_10228762 3300005458 Bacteria 1774
32 Ga0070681_10895986 3300005458 Bacteria 805
33 Ga0070706_100380843 3300005467 Bacteria 1314
34 Ga0070707_100322777 3300005468 Bacteria 1500
35 Ga0070699_100071561 3300005518 Bacteria 3016
36 Ga0070699_100175202 3300005518 Bacteria 1902
37 Ga0070684_100004920 3300005535 Bacteria 10196
38 Ga0070684_100596072 3300005535 Bacteria 1027
39 Ga0070697_100527955 3300005536 Bacteria 1034
40 Ga0070672_100457184 3300005543 Bacteria 1100
41 Ga0068855_100905533 3300005563 Bacteria 931
42 Ga0070664_100022372 3300005564 Bacteria 5212
43 Ga0068857_100131173 3300005577 Bacteria 2260
44 Ga0068857_100161249 3300005577 Bacteria 2035
45 Ga0068854_100027316 3300005578 Bacteria 3932
46 Ga0068852_100041642 3300005616 Bacteria 3883
47 Ga0068859_100334868 3300005617 Bacteria 1608
48 Ga0068866_10136836 3300005718 Bacteria 1401
49 Ga0068861_100064701 3300005719 Bacteria 2814
50 Ga0068862_100019798 3300005844 Bacteria 5621
51 Ga0081455_10011968 3300005937 Bacteria 8684
52 Ga0081455_10024283 3300005937 Bacteria 5618
53 Ga0081455_10130382 3300005937 Bacteria 1967
54 Ga0081455_10130592 3300005937 Bacteria 1965
55 Ga0081455_10157827 3300005937 Bacteria 1742
56 Ga0081455_10452903 3300005937 Bacteria 876
57 Ga0081538_10030295 3300005981 Bacteria 3677
58 Ga0081540_1000854 3300005983 Bacteria 27659
59 Ga0081540_1031415 3300005983 Bacteria 2920
60 Ga0081540_1059806 3300005983 Bacteria 1827
61 Ga0070717_10179458 3300006028 Bacteria 1845
62 Ga0075365_10051611 3300006038 Bacteria 2717
63 Ga0075365_10134524 3300006038 Bacteria 1712
64 Ga0075365_10335137 3300006038 Bacteria 1066
65 Ga0075363_100286169 3300006048 Bacteria 954
66 Ga0075364_10004073 3300006051 Bacteria 8387
67 Ga0075364_10371067 3300006051 Bacteria 976
68 Ga0070716_100029664 3300006173 Bacteria 2960
69 Ga0070712_100022067 3300006175 Bacteria 4189
70 Ga0070712_100055174 3300006175 Bacteria 2781
71 Ga0075362_10001390 3300006177 Bacteria 7687
72 Ga0075362_10104713 3300006177 Bacteria 1326
73 Ga0075367_10062225 3300006178 Bacteria 2229
74 Ga0075367_10295460 3300006178 Bacteria 1019
75 Ga0075369_10020765 3300006186 Bacteria 2691
76 Ga0075366_10006739 3300006195 Bacteria 6309
77 Ga0075366_10416402 3300006195 Bacteria 827
78 Ga0097621_100611825 3300006237 Unclassified 997
79 Ga0075370_10294600 3300006353 Bacteria 964
80 Ga0075370_10396764 3300006353 Bacteria 827
81 Ga0068871_100275389 3300006358 Bacteria 1471
82 Ga0075428_100420406 3300006844 Bacteria 1432
83 Ga0075428_100564849 3300006844 Bacteria 1216
84 Ga0075428_100648033 3300006844 Bacteria 1126
85 Ga0075428_100759514 3300006844 Bacteria 1031
86 Ga0075430_100027091 3300006846 Bacteria 4872
87 Ga0075430_100452358 3300006846 Bacteria 1060
88 Ga0075430_100517516 3300006846 Bacteria 984
89 Ga0075431_100184910 3300006847 Bacteria 2137
90 Ga0075431_100366116 3300006847 Bacteria 1447
91 Ga0075434_100126083 3300006871 Bacteria 2577
92 Ga0075429_100146738 3300006880 Bacteria 2065
93 Ga0075429_100180946 3300006880 Bacteria 1847
94 Ga0075429_100505116 3300006880 Bacteria 1059
95 Ga0097620_100334853 3300006931 Bacteria 1608
96 Ga0105240_10125176 3300009093 Bacteria 3090
97 Ga0111539_10406919 3300009094 Bacteria 1585
98 Ga0114129_10037117 3300009147 Bacteria 6880
99 Ga0105242_10158977 3300009176 Bacteria 1976
100 Ga0105248_10085277 3300009177 Bacteria 3554
101 Ga0105237_10098715 3300009545 Bacteria 2911
102 Ga0105237_10134948 3300009545 Bacteria 2462
103 Ga0105237_10978022 3300009545 Bacteria 853
104 Ga0105238_10996853 3300009551 Bacteria 858
105 Ga0105249_10505047 3300009553 Bacteria 1255
106 Ga0105249_10826191 3300009553 Bacteria 991
107 Ga0157373_10164542 3300013100 Bacteria 1561
108 Ga0157371_10265608 3300013102 Bacteria 1238
109 Ga0157370_10754947 3300013104 Bacteria 886
110 Ga0163162_10010515 3300013306 Bacteria 9000
111 Ga0163162_10211504 3300013306 Bacteria 2069
112 Ga0157375_11253219 3300013308 Bacteria 871
113 Ga0163163_10432992 3300014325 Bacteria 1374
114 Ga0157380_10140509 3300014326 Bacteria 2074
115 Ga0182008_10342752 3300014497 Bacteria 791
116 Ga0163161_10138485 3300017792 Bacteria 1841
117 Ga0224572_1008623 3300024225 Bacteria 1889
118 Ga0209677_100278 3300025253 Bacteria 34178
119 Ga0209148_1005609 3300025254 Bacteria 2851
120 Ga0209148_1015376 3300025254 Bacteria 1337
121 Ga0209676_1000024 3300025292 Bacteria 578839
122 Ga0207697_10019046 3300025315 Bacteria 2811
123 Ga0207692_10016398 3300025898 Bacteria 3280
124 Ga0207688_10029260 3300025901 Bacteria 3032
125 Ga0207688_10133274 3300025901 Bacteria 1457
126 Ga0207699_10152883 3300025906 Bacteria 1529
127 Ga0207699_10451853 3300025906 Bacteria 922
128 Ga0207699_10656099 3300025906 Bacteria 766
129 Ga0207705_10213754 3300025909 Bacteria 1463
130 Ga0207684_10085246 3300025910 Bacteria 2691
131 Ga0207684_10632654 3300025910 Bacteria 912
132 Ga0207684_11006757 3300025910 Bacteria 697
133 Ga0207707_10053554 3300025912 Bacteria 3512
134 Ga0207707_10240982 3300025912 Bacteria 1572
135 Ga0207693_10020192 3300025915 Bacteria 5299
136 Ga0207693_10148635 3300025915 Bacteria 1842
137 Ga0207693_10350453 3300025915 Bacteria 1155
138 Ga0207663_10701821 3300025916 Bacteria 801
139 Ga0207662_10378756 3300025918 Bacteria 955
140 Ga0207657_10573015 3300025919 Bacteria 882
141 Ga0207649_10407748 3300025920 Bacteria 1018
142 Ga0207652_10037519 3300025921 Bacteria 4102
143 Ga0207646_10095080 3300025922 Bacteria 2669
144 Ga0207694_10545217 3300025924 Bacteria 973
145 Ga0207659_10055829 3300025926 Bacteria 2826
146 Ga0207700_10240141 3300025928 Bacteria 1544
147 Ga0207700_10791299 3300025928 Bacteria 848
148 Ga0207690_10096246 3300025932 Bacteria 2104
149 Ga0207706_10379744 3300025933 Bacteria 1226
150 Ga0207669_10485905 3300025937 Bacteria 985
151 Ga0207665_10018218 3300025939 Bacteria 4614
152 Ga0207665_10515957 3300025939 Bacteria 925
153 Ga0207691_10223605 3300025940 Unclassified 1632
154 Ga0207661_10019840 3300025944 Bacteria 5016
155 Ga0207661_10025988 3300025944 Bacteria 4457
156 Ga0207661_11044824 3300025944 Bacteria 752
157 Ga0207679_10483865 3300025945 Bacteria 1102
158 Ga0207667_10639166 3300025949 Bacteria 1070
159 Ga0207712_10648003 3300025961 Bacteria 918
160 Ga0207639_10285478 3300026041 Bacteria 1453
161 Ga0207639_10512323 3300026041 Bacteria 1098
162 Ga0207678_10049136 3300026067 Bacteria 3645
163 Ga0207702_10414481 3300026078 Bacteria 1301
164 Ga0207702_10528323 3300026078 Bacteria 1152
165 Ga0207641_10520893 3300026088 Bacteria 1157
166 Ga0207674_10151792 3300026116 Bacteria 2273
167 Ga0207674_10178711 3300026116 Bacteria 2074
168 Ga0207675_100034590 3300026118 Bacteria 4711
169 Ga0207698_10026149 3300026142 Bacteria 4125
170 Ga0207428_10369308 3300027907 Bacteria 1054
171 Ga0268265_10392616 3300028380 Bacteria 1280
172 Ga0265332_10015910 3300031238 Bacteria 3320
173 Ga0265339_10007399 3300031249 Bacteria 7100
174 Ga0307509_10013031 3300031507 Bacteria 9871
175 Ga0316575_10193258 3300031665 Bacteria 846
176 Ga0316576_10242321 3300031727 Unclassified 1354
177 Ga0316576_10297130 3300031727 Bacteria 1207
178 Ga0316578_10048988 3300031728 Bacteria 2468
179 Ga0307516_10198504 3300031730 Bacteria 1727
180 Ga0307409_100345604 3300031995 Bacteria 1402
181 Ga0316583_10102227 3300032133 Bacteria 999
182 Ga0316585_10004367 3300032137 Bacteria 3933
183 Ga0316580_10086908 3300032139 Bacteria 956
184 Ga0373944_0102497 3300035089 Bacteria 968
185 Ga0373936_0025626 3300035113 Bacteria 2307
186 Ga0373954_0056661 3300035118 Bacteria 1845
187 Ga0373943_0035776 3300035170 Bacteria 2375
188 Ga0373946_0082068 3300035171 Bacteria 1413
189 Ga0373961_0107418 3300035241 Bacteria 911
190 Ga0316574_0229291 3300035398 Unclassified 1189
191 Ga0316574_0299424 3300035398 Bacteria 1023
192 Ga0373924_0339145 3300035410 Bacteria 669
193 Ga0373935_0045442 3300035692 Bacteria 2771
194 Ga0373927_0044944 3300035695 Bacteria 2857
195 Ga0373933_0020102 3300035724 Bacteria 3782
196 Ga0373933_0245283 3300035724 Bacteria 1153
197 Ga0373947_0178718 3300035725 Bacteria 1380
198 Ga0373937_0616056 3300036401 Bacteria 1030
199 Ga0316582_0029319 3300036647 Bacteria 3342
200 Ga0316582_0605889 3300036647 Bacteria 754
201 Ga0316584_0031411 3300036712 Bacteria 3926
202 Ga0316584_0040012 3300036712 Bacteria 3492
203 Ga0373925_0040336 3300037068 Bacteria 3456
204 Ga0373925_0333712 3300037068 Bacteria 1229
205 Ga0395898_0191124 3300037466 Bacteria 1956
206 Ga0395905_0371780 3300037471 Bacteria 1323
207 Ga0395901_0057383 3300038443 Bacteria 4049
208 Ga0436360_0450073 3300039438 Bacteria 1015
209 Ga0436360_1066880 3300039438 Bacteria 1318
210 Ga0436361_0805221 3300039447 Bacteria 1248
211 Ga0436361_0924718 3300039447 Bacteria 1127
212 Ga0466971_0065929 3300044719 Bacteria 1640
213 Ga0466970_0373674 3300044765 Bacteria 811
214 Ga0466959_0418762 3300045049 Bacteria 909
215 Ga0466958_0553513 3300045836 Bacteria 747
216 Ga0466967_0179952 3300045976 Bacteria 1994
217 Ga0495629_0059828 3300046459 Bacteria 2663
218 Ga0495629_0063536 3300046459 Bacteria 2578
219 Ga0495629_0349821 3300046459 Bacteria 1008
220 Ga0495651_0567224 3300046462 Bacteria 719
221 Ga0495653_0243853 3300046463 Bacteria 1196
222 Ga0495580_0561935 3300046472 Bacteria 757
223 Ga0495639_0015069 3300046475 Bacteria 3352
224 Ga0495608_0117209 3300046511 Bacteria 1709
225 Ga0495618_0510681 3300046514 Bacteria 723
226 Ga0495628_0693251 3300046516 Bacteria 720
227 Ga0495630_0398422 3300046517 Bacteria 1054
228 Ga0495666_0015263 3300046526 Bacteria 3826
229 Ga0495665_0138330 3300046531 Bacteria 1273
230 Ga0495640_0105263 3300046533 Bacteria 1848
231 Ga0495667_0049453 3300046559 Bacteria 2776
232 Ga0495634_0024988 3300046642 Bacteria 4187
233 Ga0495588_0041287 3300046674 Bacteria 2355
234 Ga0495669_0229760 3300046684 Bacteria 890
235 Ga0495624_0023494 3300046690 Bacteria 4065
236 Ga0495581_0046445 3300047315 Bacteria 2509
237 Ga0495674_0106987 3300047319 Bacteria 2374
238 Ga0495672_0028207 3300047320 Bacteria 3555
239 Ga0495676_0031835 3300047321 Bacteria 4456
240 Ga0495680_0413583 3300047322 Bacteria 929
241 Ga0495673_0122069 3300047469 Bacteria 1031
242 Ga0495684_0104767 3300047471 Bacteria 2138
243 Ga0495684_0116475 3300047471 Bacteria 2014
244 Ga0495686_0058758 3300047472 Bacteria 2396
245 Ga0495593_0301209 3300047673 Bacteria 801
246 Ga0495602_0086150 3300048088 Bacteria 2623
247 Ga0495614_0027008 3300048089 Bacteria 2475
248 Ga0496101_0154057 3300048904 Bacteria 1759
249 Ga0496102_0435139 3300048905 Bacteria 1231
250 Ga0496104_0035316 3300048907 Bacteria 4667
251 Ga0496107_0585594 3300048910 Bacteria 825
252 Ga0496108_0183438 3300048911 Bacteria 1813
253 Ga0496110_0796790 3300048913 Bacteria 849
254 Ga0496111_0402174 3300048914 Bacteria 1012
255 Ga0496112_0948929 3300048915 Bacteria 781
256 Ga0496126_0014113 3300048929 Bacteria 8089
257 Ga0496126_0056818 3300048929 Bacteria 3536
258 Ga0496126_0260776 3300048929 Bacteria 1441
259 Ga0501043_0559537 3300049579 Bacteria 849
260 Ga0501074_0241385 3300049590 Bacteria 1285
261 Ga0501077_0346840 3300049593 Bacteria 947
262 Ga0501079_0392899 3300049741 Bacteria 1088
263 nmdc:mga03683_25037_c1 3300050489 Bacteria 2340
264 nmdc:mga03683_3207_c1 3300050489 Bacteria 5230
265 nmdc:mga03n38_224137_c1 3300050490 Bacteria 983
266 nmdc:mga00v17_12122_c1 3300050491 Bacteria 4750
267 nmdc:mga0yw44_318569_c1 3300050492 Bacteria 1044
268 nmdc:mga0yw44_34488_c1 3300050492 Bacteria 2966
269 nmdc:mga0k408_4185_c1 3300050493 Bacteria 7658
270 nmdc:mga0k408_74740_c1 3300050493 Bacteria 1980
271 nmdc:mga06z11_318196_c1 3300050494 Bacteria 928
272 nmdc:mga06z11_74432_c1 3300050494 Bacteria 1806
273 nmdc:mga07m45_84936_c1 3300050496 Bacteria 1810
274 nmdc:mga05p37_200246_c1 3300050507 Bacteria 2419
275 nmdc:mga05p37_771880_c1 3300050507 Bacteria 1056
276 nmdc:mga05p37_93389_c1 3300050507 Bacteria 3707
277 nmdc:mga09592_24173_c1 3300050508 Bacteria 5024
278 nmdc:mga09592_247360_c1 3300050508 Bacteria 1545
279 nmdc:mga09592_298239_c1 3300050508 Bacteria 1397
280 nmdc:mga09592_491348_c1 3300050508 Bacteria 1057
281 nmdc:mga0qj67_186515_c1 3300050509 Bacteria 1685
282 nmdc:mga0qj67_261322_c1 3300050509 Bacteria 1404
283 nmdc:mga0qj67_305982_c1 3300050509 Bacteria 1288
284 nmdc:mga06r32_231395_c1 3300050510 Bacteria 1836
285 nmdc:mga06r32_6928_c1 3300050510 Bacteria 10194
286 nmdc:mga08y16_590261_c1 3300050511 Bacteria 1121
287 nmdc:mga0n895_95151_c1 3300050512 Bacteria 2983
288 nmdc:mga0n895_970075_c1 3300050512 Bacteria 832
289 nmdc:mga0a205_264201_c1 3300050515 Bacteria 1598
290 nmdc:mga0a205_518080_c1 3300050515 Bacteria 1049
291 nmdc:mga0a205_600777_c1 3300050515 Bacteria 953
292 nmdc:mga0sz30_7367_c1 3300050516 Bacteria 3802
293 Ga0495601_0151795 3300053077 Bacteria 1512
294 Ga0495601_0169279 3300053077 Bacteria 1428
295 Ga0495612_0037309 3300053078 Bacteria 1973
296 Ga0495619_0039285 3300053085 Bacteria 3089
297 Ga0495619_0399281 3300053085 Bacteria 949
298 Ga0495619_0454246 3300053085 Bacteria 883
299 Ga0500643_035703 3300053087 Bacteria 1489
300 Ga0500643_094365 3300053087 Bacteria 814
301 Ga0500566_0000007 3300053094 Bacteria 144968
302 Ga0500556_0001049 3300053104 Bacteria 14281
303 Ga0500572_001160 3300053111 Bacteria 7611
304 Ga0500614_008023 3300053123 Bacteria 2234
305 Ga0500559_0000620 3300053136 Bacteria 24084
306 Ga0500573_0075722 3300053140 Bacteria 1915
307 Ga0500603_000309 3300053150 Bacteria 12814
308 Ga0500616_0000028 3300053153 Bacteria 435722
309 Ga0500616_0021629 3300053153 Unclassified 3602
310 Ga0500639_000048 3300053163 Bacteria 57161
311 Ga0500645_079054 3300053730 Bacteria 939
312 Ga0500596_002086 3300053735 Bacteria 3976
313 Ga0501084_0502785 3300054114 Bacteria 1024
314 Ga0500661_026248 3300055283 Bacteria 1029
315 Ga0501082_0093453 3300060353 Bacteria 2599

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035410 Ga0373924_0339145 Ga0373924_0339145_94_603 169
2 3300046475 Ga0495639_0015069 Ga0495639_0015069_2754_3263 169
3 3300047322 Ga0495680_0413583 Ga0495680_0413583_173_682 169
4 3300053085 Ga0495619_0039285 Ga0495619_0039285_122_631 169
5 3300026041 Ga0207639_10285478 Ga0207639_102854781 177
6 3300026078 Ga0207702_10414481 Ga0207702_104144812 177
7 iso_pu_bacteria 2513237104 2513721142 178
8 3300046559 Ga0495667_0049453 Ga0495667_0049453_166_759 184
9 3300048904 Ga0496101_0154057 Ga0496101_0154057_952_1674 187
10 3300005354 Ga0070675_100052977 Ga0070675_1000529772 193
11 3300026116 Ga0207674_10178711 Ga0207674_101787112 195
12 3300005577 Ga0068857_100131173 Ga0068857_1001311732 200
13 3300025944 Ga0207661_10025988 Ga0207661_100259881 200
14 3300005327 Ga0070658_10263773 Ga0070658_102637733 201
15 3300014497 Ga0182008_10342752 Ga0182008_103427522 201
16 3300025909 Ga0207705_10213754 Ga0207705_102137543 201
17 3300046674 Ga0495588_0041287 Ga0495588_0041287_1354_1977 202
18 3300048929 Ga0496126_0056818 Ga0496126_0056818_1828_2445 202
19 3300053153 Ga0500616_0021629 Ga0500616_0021629_610_1227 202
20 3300047469 Ga0495673_0122069 Ga0495673_0122069_89_703 204
21 3300006028 Ga0070717_10179458 Ga0070717_101794582 205
22 3300009545 Ga0105237_10098715 Ga0105237_100987152 205
23 3300025916 Ga0207663_10701821 Ga0207663_107018211 205
24 iso_pu_bacteria 2513237104 2513721287 206
25 iso_pu_bacteria 2513237141 2513895004 206
26 iso_pu_bacteria 2524023205 2524442044 206
27 iso_pu_bacteria 2876761206 2876769562 206
28 iso_pu_bacteria 2879083081 2879084785 206
29 3300045976 Ga0466967_0179952 Ga0466967_0179952_889_1512 207
30 iso_pu_bacteria 2721755755 2723843795 207
31 iso_pu_bacteria 2903748898 2903752836 207
32 iso_pu_bacteria 2935760218 2935761023 207
33 iso_pu_bacteria 2935992306 2935999821 207
34 3300003781 Ga0055536_1003945 Ga0055536_10039452 208
35 3300005293 Ga0065715_10101193 Ga0065715_101011933 208
36 3300005336 Ga0070680_100298202 Ga0070680_1002982022 208
37 3300005458 Ga0070681_10895986 Ga0070681_108959861 208
38 3300005983 Ga0081540_1031415 Ga0081540_10314155 208
39 3300025292 Ga0209676_1000024 Ga0209676_1000024437 208
40 3300025912 Ga0207707_10240982 Ga0207707_102409822 208
41 3300025915 Ga0207693_10148635 Ga0207693_101486351 208
42 3300025928 Ga0207700_10791299 Ga0207700_107912991 208
43 3300031730 Ga0307516_10198504 Ga0307516_101985041 208
44 3300035089 Ga0373944_0102497 Ga0373944_0102497_195_821 208
45 3300035118 Ga0373954_0056661 Ga0373954_0056661_1157_1783 208
46 3300035170 Ga0373943_0035776 Ga0373943_0035776_462_1088 208
47 3300035171 Ga0373946_0082068 Ga0373946_0082068_104_730 208
48 3300035398 Ga0316574_0229291 Ga0316574_0229291_414_1040 208
49 3300035692 Ga0373935_0045442 Ga0373935_0045442_123_749 208
50 3300035724 Ga0373933_0245283 Ga0373933_0245283_358_984 208
51 3300035725 Ga0373947_0178718 Ga0373947_0178718_81_707 208
52 3300037068 Ga0373925_0040336 Ga0373925_0040336_1907_2533 208
53 3300046459 Ga0495629_0063536 Ga0495629_0063536_1801_2427 208
54 3300046463 Ga0495653_0243853 Ga0495653_0243853_427_1053 208
55 3300046511 Ga0495608_0117209 Ga0495608_0117209_958_1584 208
56 3300046514 Ga0495618_0510681 Ga0495618_0510681_70_696 208
57 3300046516 Ga0495628_0693251 Ga0495628_0693251_17_643 208
58 3300046517 Ga0495630_0398422 Ga0495630_0398422_256_882 208
59 3300046526 Ga0495666_0015263 Ga0495666_0015263_1265_1891 208
60 3300046531 Ga0495665_0138330 Ga0495665_0138330_179_805 208
61 3300046533 Ga0495640_0105263 Ga0495640_0105263_990_1616 208
62 3300046642 Ga0495634_0024988 Ga0495634_0024988_2258_2884 208
63 3300046690 Ga0495624_0023494 Ga0495624_0023494_1648_2274 208
64 3300047315 Ga0495581_0046445 Ga0495581_0046445_612_1238 208
65 3300047319 Ga0495674_0106987 Ga0495674_0106987_1657_2283 208
66 3300047320 Ga0495672_0028207 Ga0495672_0028207_734_1360 208
67 3300047321 Ga0495676_0031835 Ga0495676_0031835_3623_4249 208
68 3300047471 Ga0495684_0116475 Ga0495684_0116475_101_727 208
69 3300047472 Ga0495686_0058758 Ga0495686_0058758_459_1085 208
70 3300047673 Ga0495593_0301209 Ga0495593_0301209_60_686 208
71 3300048089 Ga0495614_0027008 Ga0495614_0027008_115_741 208
72 3300048907 Ga0496104_0035316 Ga0496104_0035316_3797_4423 208
73 3300050492 nmdc:mga0yw44_34488_c1 nmdc:mga0yw44_34488_c1_399_1025 208
74 3300053078 Ga0495612_0037309 Ga0495612_0037309_794_1420 208
75 3300005356 Ga0070674_100157258 Ga0070674_1001572582 209
76 3300005364 Ga0070673_100198272 Ga0070673_1001982721 209
77 3300005365 Ga0070688_100314319 Ga0070688_1003143192 209
78 3300005456 Ga0070678_100840181 Ga0070678_1008401812 209
79 3300006038 Ga0075365_10134524 Ga0075365_101345241 209
80 3300006051 Ga0075364_10371067 Ga0075364_103710672 209
81 3300006844 Ga0075428_100759514 Ga0075428_1007595141 209
82 3300006846 Ga0075430_100452358 Ga0075430_1004523581 209
83 3300006847 Ga0075431_100184910 Ga0075431_1001849102 209
84 3300006880 Ga0075429_100146738 Ga0075429_1001467382 209
85 3300009147 Ga0114129_10037117 Ga0114129_100371174 209
86 3300009176 Ga0105242_10158977 Ga0105242_101589771 209
87 3300025926 Ga0207659_10055829 Ga0207659_100558291 209
88 3300025937 Ga0207669_10485905 Ga0207669_104859051 209
89 3300025940 Ga0207691_10223605 Ga0207691_102236051 209
90 3300035695 Ga0373927_0044944 Ga0373927_0044944_1342_1971 209
91 3300039447 Ga0436361_0805221 Ga0436361_0805221_264_893 209
92 3300050507 nmdc:mga05p37_771880_c1 nmdc:mga05p37_771880_c1_224_853 209
93 3300050508 nmdc:mga09592_247360_c1 nmdc:mga09592_247360_c1_874_1503 209
94 3300053153 Ga0500616_0000028 Ga0500616_0000028_206029_206658 209
95 3300003752 Ga0055539_1007459 Ga0055539_10074593 210
96 3300005327 Ga0070658_10187966 Ga0070658_101879661 210
97 3300005336 Ga0070680_100119659 Ga0070680_1001196593 210
98 3300005347 Ga0070668_100701173 Ga0070668_1007011731 210
99 3300005434 Ga0070709_10669815 Ga0070709_106698151 210
100 3300005458 Ga0070681_10228762 Ga0070681_102287622 210
101 3300005563 Ga0068855_100905533 Ga0068855_1009055332 210
102 3300005981 Ga0081538_10030295 Ga0081538_100302951 210
103 3300005983 Ga0081540_1000854 Ga0081540_10008545 210
104 3300005983 Ga0081540_1059806 Ga0081540_10598063 210
105 3300006175 Ga0070712_100055174 Ga0070712_1000551744 210
106 3300006846 Ga0075430_100517516 Ga0075430_1005175162 210
107 3300006871 Ga0075434_100126083 Ga0075434_1001260833 210
108 3300009093 Ga0105240_10125176 Ga0105240_101251762 210
109 3300009553 Ga0105249_10826191 Ga0105249_108261911 210
110 3300013104 Ga0157370_10754947 Ga0157370_107549471 210
111 3300025253 Ga0209677_100278 Ga0209677_10027852 210
112 3300025254 Ga0209148_1005609 Ga0209148_10056094 210
113 3300025254 Ga0209148_1015376 Ga0209148_10153762 210
114 3300025906 Ga0207699_10451853 Ga0207699_104518531 210
115 3300025910 Ga0207684_10632654 Ga0207684_106326541 210
116 3300025921 Ga0207652_10037519 Ga0207652_100375193 210
117 3300025949 Ga0207667_10639166 Ga0207667_106391661 210
118 3300026041 Ga0207639_10512323 Ga0207639_105123231 210
119 3300031665 Ga0316575_10193258 Ga0316575_101932581 210
120 3300031727 Ga0316576_10242321 Ga0316576_102423211 210
121 3300031727 Ga0316576_10297130 Ga0316576_102971301 210
122 3300031728 Ga0316578_10048988 Ga0316578_100489883 210
123 3300031995 Ga0307409_100345604 Ga0307409_1003456042 210
124 3300032133 Ga0316583_10102227 Ga0316583_101022271 210
125 3300032137 Ga0316585_10004367 Ga0316585_100043674 210
126 3300032139 Ga0316580_10086908 Ga0316580_100869081 210
127 3300036647 Ga0316582_0029319 Ga0316582_0029319_2668_3315 210
128 3300036647 Ga0316582_0605889 Ga0316582_0605889_91_726 210
129 3300036712 Ga0316584_0031411 Ga0316584_0031411_107_754 210
130 3300037068 Ga0373925_0333712 Ga0373925_0333712_181_813 210
131 3300039438 Ga0436360_0450073 Ga0436360_0450073_204_836 210
132 3300039438 Ga0436360_1066880 Ga0436360_1066880_47_679 210
133 3300039447 Ga0436361_0924718 Ga0436361_0924718_139_771 210
134 3300044719 Ga0466971_0065929 Ga0466971_0065929_957_1589 210
135 3300044765 Ga0466970_0373674 Ga0466970_0373674_51_683 210
136 3300045049 Ga0466959_0418762 Ga0466959_0418762_113_745 210
137 3300045836 Ga0466958_0553513 Ga0466958_0553513_45_677 210
138 3300046459 Ga0495629_0349821 Ga0495629_0349821_252_884 210
139 3300046462 Ga0495651_0567224 Ga0495651_0567224_25_657 210
140 3300047471 Ga0495684_0104767 Ga0495684_0104767_352_984 210
141 3300048929 Ga0496126_0014113 Ga0496126_0014113_6411_7049 210
142 3300050512 nmdc:mga0n895_95151_c1 nmdc:mga0n895_95151_c1_507_1139 210
143 3300053085 Ga0495619_0399281 Ga0495619_0399281_91_723 210
144 3300053085 Ga0495619_0454246 Ga0495619_0454246_45_677 210
145 3300053087 Ga0500643_035703 Ga0500643_035703_551_1189 210
146 3300005295 Ga0065707_10181177 Ga0065707_101811771 211
147 3300005334 Ga0068869_100002931 Ga0068869_10000293113 211
148 3300005334 Ga0068869_100185494 Ga0068869_1001854941 211
149 3300005335 Ga0070666_10147225 Ga0070666_101472252 211
150 3300005340 Ga0070689_100868429 Ga0070689_1008684291 211
151 3300005344 Ga0070661_100013314 Ga0070661_1000133145 211
152 3300005356 Ga0070674_100409110 Ga0070674_1004091101 211
153 3300005434 Ga0070709_10088159 Ga0070709_100881592 211
154 3300005436 Ga0070713_100015501 Ga0070713_1000155016 211
155 3300005437 Ga0070710_10356338 Ga0070710_103563381 211
156 3300005445 Ga0070708_100163023 Ga0070708_1001630232 211
157 3300005445 Ga0070708_100824687 Ga0070708_1008246871 211
158 3300005445 Ga0070708_101029693 Ga0070708_1010296931 211
159 3300005457 Ga0070662_100026279 Ga0070662_1000262792 211
160 3300005457 Ga0070662_100543629 Ga0070662_1005436291 211
161 3300005467 Ga0070706_100380843 Ga0070706_1003808432 211
162 3300005468 Ga0070707_100322777 Ga0070707_1003227772 211
163 3300005518 Ga0070699_100071561 Ga0070699_1000715611 211
164 3300005518 Ga0070699_100175202 Ga0070699_1001752022 211
165 3300005535 Ga0070684_100004920 Ga0070684_1000049207 211
166 3300005535 Ga0070684_100596072 Ga0070684_1005960721 211
167 3300005536 Ga0070697_100527955 Ga0070697_1005279551 211
168 3300005543 Ga0070672_100457184 Ga0070672_1004571841 211
169 3300005564 Ga0070664_100022372 Ga0070664_1000223723 211
170 3300005577 Ga0068857_100161249 Ga0068857_1001612492 211
171 3300005578 Ga0068854_100027316 Ga0068854_1000273163 211
172 3300005616 Ga0068852_100041642 Ga0068852_1000416422 211
173 3300005617 Ga0068859_100334868 Ga0068859_1003348682 211
174 3300005718 Ga0068866_10136836 Ga0068866_101368363 211
175 3300005719 Ga0068861_100064701 Ga0068861_1000647012 211
176 3300005844 Ga0068862_100019798 Ga0068862_1000197987 211
177 3300005937 Ga0081455_10011968 Ga0081455_1001196811 211
178 3300005937 Ga0081455_10024283 Ga0081455_100242831 211
179 3300005937 Ga0081455_10130382 Ga0081455_101303822 211
180 3300005937 Ga0081455_10130592 Ga0081455_101305922 211
181 3300005937 Ga0081455_10157827 Ga0081455_101578273 211
182 3300006038 Ga0075365_10051611 Ga0075365_100516113 211
183 3300006038 Ga0075365_10335137 Ga0075365_103351372 211
184 3300006048 Ga0075363_100286169 Ga0075363_1002861691 211
185 3300006051 Ga0075364_10004073 Ga0075364_100040733 211
186 3300006173 Ga0070716_100029664 Ga0070716_1000296642 211
187 3300006175 Ga0070712_100022067 Ga0070712_1000220672 211
188 3300006177 Ga0075362_10001390 Ga0075362_100013902 211
189 3300006177 Ga0075362_10104713 Ga0075362_101047131 211
190 3300006178 Ga0075367_10062225 Ga0075367_100622252 211
191 3300006178 Ga0075367_10295460 Ga0075367_102954601 211
192 3300006186 Ga0075369_10020765 Ga0075369_100207651 211
193 3300006195 Ga0075366_10006739 Ga0075366_100067395 211
194 3300006195 Ga0075366_10416402 Ga0075366_104164021 211
195 3300006237 Ga0097621_100611825 Ga0097621_1006118251 211
196 3300006353 Ga0075370_10294600 Ga0075370_102946001 211
197 3300006353 Ga0075370_10396764 Ga0075370_103967641 211
198 3300006358 Ga0068871_100275389 Ga0068871_1002753892 211
199 3300006844 Ga0075428_100420406 Ga0075428_1004204061 211
200 3300006844 Ga0075428_100564849 Ga0075428_1005648492 211
201 3300006847 Ga0075431_100366116 Ga0075431_1003661162 211
202 3300006880 Ga0075429_100180946 Ga0075429_1001809463 211
203 3300006931 Ga0097620_100334853 Ga0097620_1003348532 211
204 3300009094 Ga0111539_10406919 Ga0111539_104069192 211
205 3300009177 Ga0105248_10085277 Ga0105248_100852773 211
206 3300009545 Ga0105237_10134948 Ga0105237_101349483 211
207 3300009545 Ga0105237_10978022 Ga0105237_109780221 211
208 3300009551 Ga0105238_10996853 Ga0105238_109968531 211
209 3300009553 Ga0105249_10505047 Ga0105249_105050472 211
210 3300013100 Ga0157373_10164542 Ga0157373_101645422 211
211 3300013102 Ga0157371_10265608 Ga0157371_102656082 211
212 3300013306 Ga0163162_10010515 Ga0163162_100105153 211
213 3300013306 Ga0163162_10211504 Ga0163162_102115042 211
214 3300013308 Ga0157375_11253219 Ga0157375_112532191 211
215 3300014325 Ga0163163_10432992 Ga0163163_104329922 211
216 3300014326 Ga0157380_10140509 Ga0157380_101405093 211
217 3300017792 Ga0163161_10138485 Ga0163161_101384852 211
218 3300024225 Ga0224572_1008623 Ga0224572_10086233 211
219 3300025315 Ga0207697_10019046 Ga0207697_100190461 211
220 3300025898 Ga0207692_10016398 Ga0207692_100163985 211
221 3300025901 Ga0207688_10029260 Ga0207688_100292602 211
222 3300025901 Ga0207688_10133274 Ga0207688_101332742 211
223 3300025906 Ga0207699_10152883 Ga0207699_101528831 211
224 3300025906 Ga0207699_10656099 Ga0207699_106560991 211
225 3300025910 Ga0207684_10085246 Ga0207684_100852462 211
226 3300025910 Ga0207684_11006757 Ga0207684_110067571 211
227 3300025912 Ga0207707_10053554 Ga0207707_100535542 211
228 3300025915 Ga0207693_10020192 Ga0207693_100201924 211
229 3300025915 Ga0207693_10350453 Ga0207693_103504532 211
230 3300025918 Ga0207662_10378756 Ga0207662_103787561 211
231 3300025919 Ga0207657_10573015 Ga0207657_105730151 211
232 3300025920 Ga0207649_10407748 Ga0207649_104077482 211
233 3300025922 Ga0207646_10095080 Ga0207646_100950802 211
234 3300025924 Ga0207694_10545217 Ga0207694_105452171 211
235 3300025928 Ga0207700_10240141 Ga0207700_102401412 211
236 3300025932 Ga0207690_10096246 Ga0207690_100962462 211
237 3300025933 Ga0207706_10379744 Ga0207706_103797442 211
238 3300025939 Ga0207665_10018218 Ga0207665_100182182 211
239 3300025939 Ga0207665_10515957 Ga0207665_105159571 211
240 3300025944 Ga0207661_10019840 Ga0207661_100198404 211
241 3300025944 Ga0207661_11044824 Ga0207661_110448241 211
242 3300025945 Ga0207679_10483865 Ga0207679_104838652 211
243 3300025961 Ga0207712_10648003 Ga0207712_106480031 211
244 3300026067 Ga0207678_10049136 Ga0207678_100491363 211
245 3300026078 Ga0207702_10528323 Ga0207702_105283231 211
246 3300026088 Ga0207641_10520893 Ga0207641_105208931 211
247 3300026116 Ga0207674_10151792 Ga0207674_101517922 211
248 3300026118 Ga0207675_100034590 Ga0207675_1000345903 211
249 3300026142 Ga0207698_10026149 Ga0207698_100261494 211
250 3300027907 Ga0207428_10369308 Ga0207428_103693081 211
251 3300028380 Ga0268265_10392616 Ga0268265_103926162 211
252 3300031238 Ga0265332_10015910 Ga0265332_100159103 211
253 3300031249 Ga0265339_10007399 Ga0265339_100073991 211
254 3300031507 Ga0307509_10013031 Ga0307509_100130316 211
255 3300035113 Ga0373936_0025626 Ga0373936_0025626_1560_2195 211
256 3300035241 Ga0373961_0107418 Ga0373961_0107418_153_794 211
257 3300035398 Ga0316574_0299424 Ga0316574_0299424_66_701 211
258 3300035724 Ga0373933_0020102 Ga0373933_0020102_2443_3078 211
259 3300036401 Ga0373937_0616056 Ga0373937_0616056_357_992 211
260 3300037471 Ga0395905_0371780 Ga0395905_0371780_368_1003 211
261 3300038443 Ga0395901_0057383 Ga0395901_0057383_565_1200 211
262 3300046459 Ga0495629_0059828 Ga0495629_0059828_1149_1790 211
263 3300046472 Ga0495580_0561935 Ga0495580_0561935_22_663 211
264 3300046684 Ga0495669_0229760 Ga0495669_0229760_26_667 211
265 3300048088 Ga0495602_0086150 Ga0495602_0086150_34_669 211
266 3300048905 Ga0496102_0435139 Ga0496102_0435139_48_689 211
267 3300048910 Ga0496107_0585594 Ga0496107_0585594_97_738 211
268 3300048914 Ga0496111_0402174 Ga0496111_0402174_219_860 211
269 3300048929 Ga0496126_0260776 Ga0496126_0260776_35_691 211
270 3300049579 Ga0501043_0559537 Ga0501043_0559537_173_808 211
271 3300050489 nmdc:mga03683_25037_c1 nmdc:mga03683_25037_c1_1529_2164 211
272 3300050489 nmdc:mga03683_3207_c1 nmdc:mga03683_3207_c1_4580_5215 211
273 3300050490 nmdc:mga03n38_224137_c1 nmdc:mga03n38_224137_c1_176_811 211
274 3300050491 nmdc:mga00v17_12122_c1 nmdc:mga00v17_12122_c1_3303_3938 211
275 3300050492 nmdc:mga0yw44_318569_c1 nmdc:mga0yw44_318569_c1_237_872 211
276 3300050493 nmdc:mga0k408_4185_c1 nmdc:mga0k408_4185_c1_6378_7013 211
277 3300050493 nmdc:mga0k408_74740_c1 nmdc:mga0k408_74740_c1_529_1164 211
278 3300050494 nmdc:mga06z11_318196_c1 nmdc:mga06z11_318196_c1_192_827 211
279 3300050494 nmdc:mga06z11_74432_c1 nmdc:mga06z11_74432_c1_272_907 211
280 3300050496 nmdc:mga07m45_84936_c1 nmdc:mga07m45_84936_c1_1154_1789 211
281 3300050507 nmdc:mga05p37_200246_c1 nmdc:mga05p37_200246_c1_538_1173 211
282 3300050507 nmdc:mga05p37_93389_c1 nmdc:mga05p37_93389_c1_271_906 211
283 3300050508 nmdc:mga09592_298239_c1 nmdc:mga09592_298239_c1_430_1065 211
284 3300050509 nmdc:mga0qj67_186515_c1 nmdc:mga0qj67_186515_c1_793_1428 211
285 3300050510 nmdc:mga06r32_231395_c1 nmdc:mga06r32_231395_c1_1023_1658 211
286 3300050511 nmdc:mga08y16_590261_c1 nmdc:mga08y16_590261_c1_166_801 211
287 3300050515 nmdc:mga0a205_518080_c1 nmdc:mga0a205_518080_c1_306_941 211
288 3300050516 nmdc:mga0sz30_7367_c1 nmdc:mga0sz30_7367_c1_1921_2556 211
289 3300053077 Ga0495601_0151795 Ga0495601_0151795_100_735 211
290 3300053077 Ga0495601_0169279 Ga0495601_0169279_80_715 211
291 3300053087 Ga0500643_094365 Ga0500643_094365_22_657 211
292 3300053094 Ga0500566_0000007 Ga0500566_0000007_24460_25095 211
293 3300053111 Ga0500572_001160 Ga0500572_001160_6198_6833 211
294 3300053123 Ga0500614_008023 Ga0500614_008023_196_831 211
295 3300053136 Ga0500559_0000620 Ga0500559_0000620_3712_4347 211
296 3300053140 Ga0500573_0075722 Ga0500573_0075722_207_842 211
297 3300053150 Ga0500603_000309 Ga0500603_000309_5982_6617 211
298 3300053163 Ga0500639_000048 Ga0500639_000048_50293_50928 211
299 3300053735 Ga0500596_002086 Ga0500596_002086_2883_3518 211
300 3300054114 Ga0501084_0502785 Ga0501084_0502785_278_913 211
301 3300055283 Ga0500661_026248 Ga0500661_026248_135_770 211
302 3300003659 JGI25404J52841_10034312 JGI25404J52841_100343121 212
303 3300005937 Ga0081455_10452903 Ga0081455_104529031 212
304 3300006844 Ga0075428_100648033 Ga0075428_1006480332 212
305 3300006846 Ga0075430_100027091 Ga0075430_1000270918 212
306 3300006880 Ga0075429_100505116 Ga0075429_1005051161 212
307 3300036712 Ga0316584_0040012 Ga0316584_0040012_2822_3460 212
308 3300037466 Ga0395898_0191124 Ga0395898_0191124_149_787 212
309 3300048911 Ga0496108_0183438 Ga0496108_0183438_767_1405 212
310 3300048913 Ga0496110_0796790 Ga0496110_0796790_71_709 212
311 3300048915 Ga0496112_0948929 Ga0496112_0948929_128_766 212
312 3300049590 Ga0501074_0241385 Ga0501074_0241385_85_747 212
313 3300049593 Ga0501077_0346840 Ga0501077_0346840_157_795 212
314 3300049741 Ga0501079_0392899 Ga0501079_0392899_129_767 212
315 3300050508 nmdc:mga09592_24173_c1 nmdc:mga09592_24173_c1_174_812 212
316 3300050508 nmdc:mga09592_491348_c1 nmdc:mga09592_491348_c1_149_787 212
317 3300050509 nmdc:mga0qj67_261322_c1 nmdc:mga0qj67_261322_c1_149_787 212
318 3300050509 nmdc:mga0qj67_305982_c1 nmdc:mga0qj67_305982_c1_90_728 212
319 3300050510 nmdc:mga06r32_6928_c1 nmdc:mga06r32_6928_c1_9378_10016 212
320 3300050512 nmdc:mga0n895_970075_c1 nmdc:mga0n895_970075_c1_98_736 212
321 3300050515 nmdc:mga0a205_264201_c1 nmdc:mga0a205_264201_c1_867_1553 212
322 3300050515 nmdc:mga0a205_600777_c1 nmdc:mga0a205_600777_c1_189_827 212
323 3300053104 Ga0500556_0001049 Ga0500556_0001049_11318_11956 212
324 3300053730 Ga0500645_079054 Ga0500645_079054_21_659 212
325 3300060353 Ga0501082_0093453 Ga0501082_0093453_1655_2293 212

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00589

Phage_integrase

Phage integrase family

24

195

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ytl-assembly2.cif.gz_B structure of the kow2-kow3 domain of transcription elongation factor spt5. 0.7789 82 99
5crx-assembly1.cif.gz_B-2 asymmetric dna-bending in the cre-loxp site-specific recombination synapse 0.7295 19 182
3c28-assembly1.cif.gz_B-2 crystal structure of the product synapse complex 0.7191 19 196
5hxy-assembly4.cif.gz_D crystal structure of xera recombinase 0.7139 25 212
5hxy-assembly2.cif.gz_B crystal structure of xera recombinase 0.712 28 212
ID Description Score Start End Superfamily
af_Q55C79_2_72_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.7825 80 102 3.30.40.10
1pvpB01 Mainly Alpha;Orthogonal Bundle;hpI Integrase; Chain A;Intergrase catalytic core 0.7638 25 182 1.10.443.10
af_P0ADH5_4_190_1.10.443.10 Mainly Alpha;Orthogonal Bundle;hpI Integrase; Chain A;Intergrase catalytic core 0.7104 24 199 1.10.443.10
5wwcA00 Mainly Beta;Roll;SH3 type barrels.;Chromatin protein Cren7 0.7088 84 102 2.30.30.610
af_P0A8P6_113_288_1.10.443.10 Mainly Alpha;Orthogonal Bundle;hpI Integrase; Chain A;Intergrase catalytic core 0.6997 48 211 1.10.443.10
ID Description Score Start End GO Terms
AF-A0A4R2ASQ0-F1-model_v4 Phage integrase family protein 0.9649 16 144 GO:0003677
GO:0006310
GO:0015074
AF-A0A0Q4PP80-F1-model_v4 deleted 0.9587 52 129
AF-A0A7W6FWV7-F1-model_v4 Site-specific recombinase XerC 0.9581 25 138 GO:0003677
GO:0006310
GO:0015074
AF-A0A2G1UGY9-F1-model_v4 Integrase 0.9562 22 153 GO:0003677
GO:0006310
GO:0015074
AF-A0A2G8RD01-F1-model_v4 Integrase 0.9527 31 112 GO:0003677
GO:0006310
GO:0015074

Feature Viewer

pLDDT pTM Quality
82.02 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map