F408089

General Info

Members Datasets Scaffolds Average Seq Length
325 289 137 394

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2718217927|2719386074
Length 408
Sequence LKQIFLMIRVNLGSLPRRLAISLSMVLSVALVVAVLAGFLAMARGFEAALAGAGSPDIAVILGGGTNQETGSDVPAEAIRSLAAASGDTGIARNPGIARAGPGDGAGGLAMSREVVVPIDVRAADGVEQTLSLRGMDPAGPAMRQRARLSEGRLFAPGGREIVIGARLADAFPGLAVGDTVRLGAVDWWVAGHFTSGGSAFESEIWADLEAVQSAFGRQGQVQSLRVRLAGDDPQRALAALRERLSTLPGPPLAVVSEADLYAGQAERIESLIRLFGWPVALLMAIGATAGALNTMMSSVSDRAIEIATLRLLGFARLPAFAATWVEAVLLSALGAAAGGIASRLAFDGWQASTMGANNTKMAFQLVVTPDVLLTAGLLGLAVGVIGGALPALAAARLPLRAALRARG

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
7 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
8 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
9 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
10 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
11 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
12 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
13 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
14 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
15 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
16 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
17 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
18 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
19 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
20 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
21 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
22 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
23 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
24 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
25 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
26 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
27 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
28 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
29 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
30 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
31 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
32 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
33 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
34 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
35 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
36 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
37 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
38 2718217882 Rhizobium sp. N741 Isolate Nodule
39 2718217927 Rhizobium sp. N324 Isolate Nodule
40 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
41 2718218009 Rhizobium sp. N561 Isolate Nodule
42 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
43 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
44 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
45 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
46 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
47 2718218363 Rhizobium sp. N113 Isolate Nodule
48 2718218365 Rhizobium sp. N731 Isolate Nodule
49 2718218366 Rhizobium sp. N621 Isolate Nodule
50 2718218423 Rhizobium sp. N941 Isolate Nodule
51 2721755514 Rhizobium sp. N6212 Isolate Nodule
52 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
53 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
54 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
55 2721755809 Rhizobium sp. N541 Isolate Nodule
56 2721755810 Rhizobium sp. N871 Isolate Nodule
57 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
58 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
59 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
60 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
61 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
62 2728369365 Rhizobium sp. N1341 Isolate Nodule
63 2728369397 Rhizobium sp. N1314 Isolate Nodule
64 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
65 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
66 2791355256 Rhizobium sp. M10 Isolate Nodule
67 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
68 2791355260 Rhizobium sp. L9 Isolate Nodule
69 2791355261 Rhizobium sp. J15 Isolate Nodule
70 2791355262 Rhizobium sp. M1 Isolate Nodule
71 2791355263 Rhizobium chutanense C5 Isolate Nodule
72 2791355264 Rhizobium sp. S9 Isolate Nodule
73 2791355265 Rhizobium sp. H4 Isolate Nodule
74 2791355267 Rhizobium sp. L18 Isolate Nodule
75 2802429633 Rhizobium anhuiense J3 Isolate Nodule
76 2802429634 Rhizobium anhuiense S10 Isolate Nodule
77 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
78 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
79 2802429637 Rhizobium anhuiense C15 Isolate Nodule
80 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
81 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
82 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
83 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
84 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
85 2838048938 Rhizobium pisi 27/80 Isolate Nodule
86 2838061910 Rhizobium phaseoli L15 Isolate Nodule
87 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
88 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
89 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
90 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
91 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
92 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
93 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
94 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
95 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
96 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
97 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
98 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
99 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
100 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
101 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
102 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
103 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
104 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
105 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
106 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
107 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
108 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
109 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
110 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
111 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
112 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
113 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
114 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
115 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
116 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
117 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
118 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
119 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
120 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
121 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
122 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
123 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
124 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
125 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
126 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
127 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
128 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
129 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
130 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
131 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
132 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
133 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
134 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
135 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
136 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
137 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
138 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
139 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
140 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
141 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
142 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
143 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
144 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
145 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
146 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
147 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
148 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
149 2933599457 Rhizobium phaseoli M3 Isolate Nodule
150 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
151 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
152 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
153 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
154 2936381700 Rhizobium chutanense C16 Isolate Unclassified
155 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
156 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
157 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
158 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
159 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
160 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
161 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
162 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
163 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
164 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
165 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
166 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
167 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
168 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
169 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
170 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
171 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
172 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
173 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
174 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
175 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
176 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
177 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
178 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
179 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
180 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
181 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
182 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
183 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
184 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
185 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
186 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
187 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
188 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
189 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
191 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
192 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
193 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
194 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
195 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
196 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
197 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
199 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
200 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
203 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
204 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
205 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
206 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
207 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
208 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
209 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
210 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
211 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
212 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
213 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
214 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
215 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
216 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
217 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
218 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
219 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
220 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
221 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
222 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
223 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
224 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
225 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
226 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
227 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
228 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
229 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
230 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
231 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
232 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
233 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
234 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
235 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
236 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
237 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
238 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
239 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
240 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
241 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
242 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
243 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
244 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
245 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
246 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
247 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
248 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
249 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
250 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
251 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
252 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
253 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
254 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
255 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
256 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
257 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
258 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
259 8005275841 Rhizobium sp. N4311 Isolate Nodule
260 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
261 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
262 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
263 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
264 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
265 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
266 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
267 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
268 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
269 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
270 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
271 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
272 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
273 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
274 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
275 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
276 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
277 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
278 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
279 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
280 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
281 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
282 8018176218 Rhizobium sp. N122 Isolate Nodule
283 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
284 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
285 8024501048 Rhizobium sp. H4 Isolate Nodule
286 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
287 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
288 8056382006 Rhizobium croatiense 13T Isolate Nodule
289 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 42.15
Metatranscriptomes 0
Isolates 57.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.15
Nodule 50.77
Rhizoplane 0.31
Rhizosphere 16
Stem 0
Stem Tuber 0
Unclassified 18.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000150 3300001979 Bacteria 27131
2 JGI25155J39150_1000016 3300002704 Bacteria 163128
3 JGI25156J39149_1000018 3300002705 Bacteria 163121
4 JGI25156J39149_1000046 3300002705 Bacteria 102206
5 JGI25162J39368_1000476 3300002737 Bacteria 30796
6 JGI25162J39368_1000617 3300002737 Bacteria 25480
7 JGI25154J39366_1000018 3300002738 Bacteria 251612
8 JGI25157J39369_1000022 3300002741 Bacteria 163121
9 JGI25157J39369_1000215 3300002741 Bacteria 47335
10 JGI25151J46595_10016144 3300003187 Bacteria 3272
11 JGI25165J46597_1000068 3300003214 Bacteria 196201
12 JGI25165J46597_1000416 3300003214 Bacteria 44195
13 JGI25153J46596_10002208 3300003215 Bacteria 11365
14 JGI25153J46596_10008598 3300003215 Bacteria 4860
15 rootH2_10051213 3300003320 Bacteria 6345
16 rootL2_10027389 3300003322 Bacteria 12430
17 rootH1_10023802 3300003323 Bacteria 5864
18 rootH1_10085278 3300003323 Bacteria 4837
19 JGI25160J50197_1000960 3300003354 Bacteria 15108
20 Ga0055526_1000754 3300003771 Bacteria 24199
21 Ga0055524_1000796 3300003775 Bacteria 20955
22 Ga0055528_1000157 3300003790 Bacteria 56936
23 Ga0055540_1000169 3300003792 Bacteria 64875
24 Ga0065165_1016428 3300005262 Bacteria 2772
25 Ga0068856_100039726 3300005614 Bacteria 4620
26 Ga0075364_10000873 3300006051 Bacteria 15899
27 Ga0075367_10005657 3300006178 Bacteria 6236
28 Ga0123340_1052600 3300009763 Bacteria 1420
29 Ga0123341_1000070 3300009765 Bacteria 43628
30 Ga0123342_1022372 3300009766 Bacteria 4288
31 Ga0123342_1031814 3300009766 Bacteria 2523
32 Ga0123342_1036415 3300009766 Bacteria 2033
33 Ga0157369_10109631 3300013105 Bacteria 2935
34 Ga0214542_1019910 3300021321 Bacteria 5110
35 Ga0214543_1000005 3300021327 Bacteria 454523
36 Ga0209435_100017 3300025206 Bacteria 303699
37 Ga0209437_100067 3300025233 Bacteria 317685
38 Ga0209437_100104 3300025233 Bacteria 220736
39 Ga0207425_1014361 3300025245 Bacteria 1800
40 Ga0209646_1000048 3300025246 Bacteria 303808
41 Ga0209026_1000035 3300025250 Bacteria 303808
42 Ga0209148_1007450 3300025254 Bacteria 2273
43 Ga0209759_1000027 3300025256 Bacteria 303808
44 Ga0209129_1000231 3300025258 Bacteria 61668
45 Ga0209233_1000054 3300025261 Bacteria 439669
46 Ga0209233_1000088 3300025261 Bacteria 317980
47 Ga0209673_1000385 3300025273 Bacteria 79491
48 Ga0209673_1000522 3300025273 Bacteria 62876
49 Ga0209673_1003340 3300025273 Bacteria 9598
50 Ga0209025_1000058 3300025294 Bacteria 311398
51 Ga0209564_1000118 3300025295 Bacteria 205431
52 Ga0209758_1000366 3300025297 Bacteria 80263
53 Ga0209758_1004469 3300025297 Bacteria 11618
54 Ga0209050_1003720 3300025298 Bacteria 10975
55 Ga0209256_1000160 3300025299 Bacteria 138781
56 Ga0207426_1000147 3300025302 Bacteria 190586
57 Ga0209051_1000418 3300025303 Bacteria 58817
58 Ga0209051_1002327 3300025303 Bacteria 13801
59 Ga0209257_1006051 3300025304 Bacteria 8059
60 Ga0307515_10004874 3300028794 Bacteria 27441
61 Ga0307515_10019373 3300028794 Bacteria 12255
62 Ga0307513_10092430 3300031456 Bacteria 3080
63 Ga0451833_0123870 3300041491 Bacteria 3552
64 Ga0451833_1235629 3300041491 Bacteria 2124
65 Ga0451835_0054813 3300041492 Bacteria 2118
66 Ga0451835_0456438 3300041492 Bacteria 5234
67 Ga0451837_0614277 3300041494 Bacteria 6534
68 Ga0451839_0115110 3300041496 Bacteria 2620
69 Ga0451839_0350831 3300041496 Bacteria 7083
70 Ga0451841_0385381 3300041498 Bacteria 5859
71 Ga0451841_0450509 3300041498 Bacteria 1718
72 Ga0451841_1271505 3300041498 Bacteria 1402
73 Ga0451845_0131119 3300041501 Bacteria 5221
74 Ga0451845_0651627 3300041501 Bacteria 10553
75 Ga0451847_0308786 3300041503 Bacteria 2014
76 Ga0451849_0063732 3300041505 Bacteria 1356
77 Ga0451849_1369974 3300041505 Bacteria 3291
78 Ga0451851_0030315 3300041507 Bacteria 7280
79 Ga0451851_1380527 3300041507 Bacteria 3351
80 Ga0451843_0185871 3300041509 Bacteria 4722
81 Ga0451855_1824835 3300041511 Bacteria 1508
82 Ga0451853_3263199 3300041512 Bacteria 2124
83 Ga0466966_0035356 3300044684 Bacteria 3228
84 Ga0466963_0017957 3300044694 Bacteria 4414
85 Ga0466970_0023474 3300044765 Bacteria 3221
86 Ga0466957_0022216 3300044842 Bacteria 3741
87 Ga0466958_0008706 3300045836 Bacteria 5634
88 Ga0495638_0000683 3300046460 Bacteria 36875
89 Ga0495638_0122239 3300046460 Bacteria 1537
90 Ga0495605_0015772 3300046474 Bacteria 4105
91 Ga0495605_0085617 3300046474 Bacteria 1467
92 Ga0495585_0097102 3300046492 Bacteria 1580
93 Ga0495585_0098321 3300046492 Bacteria 1568
94 Ga0495607_0071438 3300046501 Bacteria 1935
95 Ga0495583_0002117 3300046506 Bacteria 17795
96 Ga0495606_0079237 3300046507 Bacteria 2046
97 Ga0495616_0031595 3300046513 Bacteria 2771
98 Ga0495616_0056327 3300046513 Bacteria 1942
99 Ga0495620_0014122 3300046515 Bacteria 4069
100 Ga0495620_0060959 3300046515 Bacteria 1571
101 Ga0495631_0007778 3300046518 Bacteria 5438
102 Ga0495631_0007891 3300046518 Bacteria 5388
103 Ga0495631_0070627 3300046518 Bacteria 1509
104 Ga0495643_0030007 3300046522 Bacteria 3039
105 Ga0495648_0108877 3300046524 Bacteria 1512
106 Ga0495654_0050101 3300046530 Bacteria 2042
107 Ga0495668_0060955 3300046616 Bacteria 2081
108 Ga0495668_0088121 3300046616 Bacteria 1702
109 Ga0495668_0092155 3300046616 Bacteria 1660
110 Ga0495611_0049595 3300046648 Bacteria 1889
111 Ga0495625_0006094 3300046660 Bacteria 10815
112 Ga0495625_0030223 3300046660 Bacteria 4044
113 Ga0495625_0041439 3300046660 Bacteria 3351
114 Ga0495600_0030259 3300046809 Bacteria 3507
115 Ga0495660_0023672 3300046810 Bacteria 3503
116 Ga0495660_0054730 3300046810 Bacteria 2161
117 Ga0495604_0026252 3300047317 Bacteria 4638
118 Ga0495687_027856 3300047443 Bacteria 2638
119 Ga0495681_0050728 3300047470 Bacteria 1954
120 Ga0496116_0000042 3300048919 Bacteria 330516
121 Ga0496119_0005479 3300048922 Bacteria 12138
122 Ga0496122_0004854 3300048925 Bacteria 16371
123 Ga0496123_0009982 3300048926 Bacteria 8463
124 Ga0496124_0047854 3300048927 Bacteria 3656
125 Ga0496124_0273669 3300048927 Bacteria 1235
126 Ga0496126_0000471 3300048929 Bacteria 80080
127 nmdc:mga03n38_21243_c1 3300050490 Bacteria 2609
128 nmdc:mga00v17_4021_c1 3300050491 Bacteria 7595
129 nmdc:mga0yw44_5140_c1 3300050492 Bacteria 6126
130 nmdc:mga0sz30_52973_c1 3300050516 Bacteria 1723
131 Ga0500557_000939 3300053105 Bacteria 4347
132 Ga0500569_016015 3300053109 Bacteria 1890
133 Ga0500608_030690 3300053122 Bacteria 2548
134 Ga0500618_001307 3300053125 Bacteria 11403
135 Ga0500658_0009622 3300053134 Bacteria 3563
136 Ga0500568_0000412 3300053139 Bacteria 32747
137 Ga0500616_0000871 3300053153 Bacteria 33381

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8056382006 8056386461 329
2 3300050491 nmdc:mga00v17_4021_c1 nmdc:mga00v17_4021_c1_1550_2668 343
3 3300048927 Ga0496124_0273669 Ga0496124_0273669_55_1173 347
4 iso_pu_bacteria 8018127388 8018130211 352
5 3300046460 Ga0495638_0122239 Ga0495638_0122239_22_1140 359
6 3300048929 Ga0496126_0000471 Ga0496126_0000471_70583_71701 359
7 3300048927 Ga0496124_0047854 Ga0496124_0047854_1340_2542 360
8 iso_pu_bacteria 2838048938 2838051782 365
9 iso_pu_bacteria 2842447887 2842453041 365
10 iso_pu_bacteria 2791355263 2793344112 366
11 iso_pu_bacteria 2842285085 2842285851 366
12 iso_pu_bacteria 2842402390 2842403210 366
13 iso_pu_bacteria 2842409023 2842409417 366
14 iso_pu_bacteria 2842415677 2842416070 366
15 iso_pu_bacteria 2936381700 2936388379 366
16 3300006051 Ga0075364_10000873 Ga0075364_1000087318 367
17 iso_pu_bacteria 2838022645 2838028774 367
18 iso_pu_bacteria 2838042994 2838043728 367
19 iso_pu_bacteria 2841864319 2841870657 367
20 iso_pu_bacteria 2842198810 2842204809 367
21 iso_pu_bacteria 2842363717 2842364879 367
22 iso_pu_bacteria 2842395702 2842401463 367
23 3300002737 JGI25162J39368_1000617 JGI25162J39368_10006173 368
24 3300003214 JGI25165J46597_1000416 JGI25165J46597_100041616 368
25 3300025233 Ga0209437_100104 Ga0209437_100104120 368
26 3300025261 Ga0209233_1000054 Ga0209233_100005415 368
27 iso_pu_bacteria 2838680041 2838681882 368
28 iso_pu_bacteria 2838694306 2838696453 368
29 iso_pu_bacteria 2838707686 2838710307 368
30 iso_pu_bacteria 2842077413 2842078482 368
31 iso_pu_bacteria 2842118031 2842119010 368
32 iso_pu_bacteria 2842237096 2842239719 368
33 iso_pu_bacteria 2842291075 2842292143 368
34 iso_pu_bacteria 2842317721 2842323967 368
35 iso_pu_bacteria 2842370503 2842372448 368
36 iso_pu_bacteria 2842377471 2842378540 368
37 iso_pu_bacteria 2842384541 2842385519 368
38 iso_pu_bacteria 2842495871 2842495892 368
39 iso_pu_bacteria 2791355261 2793329147 369
40 iso_pu_bacteria 2838729681 2838729691 369
41 iso_pu_bacteria 2838742623 2838743293 369
42 iso_pu_bacteria 2841851746 2841852780 369
43 iso_pu_bacteria 2842110456 2842114673 369
44 iso_pu_bacteria 2842156927 2842157038 369
45 iso_pu_bacteria 2842163707 2842167694 369
46 iso_pu_bacteria 2842180545 2842181378 369
47 iso_pu_bacteria 2842217011 2842217626 369
48 iso_pu_bacteria 2842229732 2842230570 369
49 iso_pu_bacteria 2842243621 2842244471 369
50 iso_pu_bacteria 2842257432 2842257442 369
51 iso_pu_bacteria 2842271015 2842271125 369
52 iso_pu_bacteria 2842304105 2842304755 369
53 iso_pu_bacteria 2844454524 2844458705 369
54 iso_pu_bacteria 2857516855 2857520160 369
55 iso_pu_bacteria 2919166419 2919170163 369
56 3300041491 Ga0451833_0123870 Ga0451833_0123870_2205_3407 370
57 3300041492 Ga0451835_0456438 Ga0451835_0456438_547_1749 370
58 3300041494 Ga0451837_0614277 Ga0451837_0614277_547_1749 370
59 3300041496 Ga0451839_0115110 Ga0451839_0115110_713_1915 370
60 3300041498 Ga0451841_0385381 Ga0451841_0385381_1132_2334 370
61 3300041501 Ga0451845_0131119 Ga0451845_0131119_587_1789 370
62 3300041505 Ga0451849_1369974 Ga0451849_1369974_310_1512 370
63 3300041507 Ga0451851_1380527 Ga0451851_1380527_17_1219 370
64 3300041509 Ga0451843_0185871 Ga0451843_0185871_1288_2490 370
65 3300041511 Ga0451855_1824835 Ga0451855_1824835_289_1491 370
66 3300053139 Ga0500568_0000412 Ga0500568_0000412_16963_18165 372
67 3300053153 Ga0500616_0000871 Ga0500616_0000871_12352_13554 372
68 iso_pu_bacteria 8054558443 8054561427 372
69 3300013105 Ga0157369_10109631 Ga0157369_101096313 373
70 3300046506 Ga0495583_0002117 Ga0495583_0002117_11185_12357 373
71 iso_pu_bacteria 2515075009 2515112679 374
72 iso_pu_bacteria 8005460587 8005463349 374
73 iso_pu_bacteria 2718217997 2719665892 375
74 iso_pu_bacteria 2718218199 2720492312 375
75 iso_pu_bacteria 2838016132 2838017918 375
76 iso_pu_bacteria 2838061910 2838066207 375
77 iso_pu_bacteria 8005619151 8005622003 375
78 iso_pu_bacteria 8005626139 8005632519 375
79 3300046507 Ga0495606_0079237 Ga0495606_0079237_510_1712 376
80 3300046522 Ga0495643_0030007 Ga0495643_0030007_524_1726 376
81 3300046524 Ga0495648_0108877 Ga0495648_0108877_277_1479 376
82 3300046616 Ga0495668_0060955 Ga0495668_0060955_392_1594 376
83 3300047443 Ga0495687_027856 Ga0495687_027856_1050_2252 376
84 3300053109 Ga0500569_016015 Ga0500569_016015_178_1380 376
85 3300053134 Ga0500658_0009622 Ga0500658_0009622_609_1811 376
86 iso_pu_bacteria 2989771324 2989776422 376
87 iso_pu_bacteria 2509276021 2509392335 377
88 iso_pu_bacteria 2509276033 2509446725 377
89 iso_pu_bacteria 2529292951 2530645826 377
90 iso_pu_bacteria 2718217927 2719386074 377
91 iso_pu_bacteria 2718218232 2720613667 377
92 iso_pu_bacteria 2718218233 2720620454 377
93 iso_pu_bacteria 2718218235 2720631875 377
94 iso_pu_bacteria 2718218269 2720775603 377
95 iso_pu_bacteria 2718218423 2721399855 377
96 iso_pu_bacteria 2721755556 2723027215 377
97 iso_pu_bacteria 2721755684 2723560830 377
98 iso_pu_bacteria 2721755685 2723567422 377
99 iso_pu_bacteria 2721755809 2724038668 377
100 iso_pu_bacteria 2721755819 2724090210 377
101 iso_pu_bacteria 2721755822 2724104687 377
102 iso_pu_bacteria 2721755823 2724110495 377
103 iso_pu_bacteria 2728369352 2730108151 377
104 iso_pu_bacteria 2791355259 2793312548 377
105 iso_pu_bacteria 2791355260 2793323076 377
106 iso_pu_bacteria 2838068647 2838074497 377
107 iso_pu_bacteria 2842264693 2842265751 377
108 iso_pu_bacteria 2842311132 2842317162 377
109 iso_pu_bacteria 2842341865 2842345424 377
110 iso_pu_bacteria 2842422224 2842428126 377
111 iso_pu_bacteria 2842428310 2842429612 377
112 iso_pu_bacteria 2842434925 2842436225 377
113 iso_pu_bacteria 2842441272 2842442572 377
114 iso_pu_bacteria 2842462802 2842464033 377
115 iso_pu_bacteria 2842469257 2842470554 377
116 iso_pu_bacteria 2933599457 2933604953 377
117 iso_pu_bacteria 8005275841 8005280859 377
118 iso_pu_bacteria 8005282627 8005287565 377
119 iso_pu_bacteria 8005430974 8005431619 377
120 iso_pu_bacteria 8005497431 8005500626 377
121 iso_pu_bacteria 8005668836 8005672045 377
122 iso_pu_bacteria 8005682033 8005685922 377
123 iso_pu_bacteria 8005695170 8005696540 377
124 iso_pu_bacteria 8018176218 8018178818 377
125 3300002704 JGI25155J39150_1000016 JGI25155J39150_1000016154 378
126 3300002705 JGI25156J39149_1000018 JGI25156J39149_1000018154 378
127 3300002705 JGI25156J39149_1000046 JGI25156J39149_100004632 378
128 3300002738 JGI25154J39366_1000018 JGI25154J39366_100001816 378
129 3300002741 JGI25157J39369_1000022 JGI25157J39369_100002216 378
130 3300002741 JGI25157J39369_1000215 JGI25157J39369_100021521 378
131 3300003215 JGI25153J46596_10002208 JGI25153J46596_100022087 378
132 3300003792 Ga0055540_1000169 Ga0055540_100016919 378
133 3300025206 Ga0209435_100017 Ga0209435_10001734 378
134 3300025246 Ga0209646_1000048 Ga0209646_1000048287 378
135 3300025250 Ga0209026_1000035 Ga0209026_1000035287 378
136 3300025256 Ga0209759_1000027 Ga0209759_100002734 378
137 3300025273 Ga0209673_1000522 Ga0209673_100052258 378
138 3300025297 Ga0209758_1004469 Ga0209758_10044695 378
139 3300025298 Ga0209050_1003720 Ga0209050_100372010 378
140 3300025303 Ga0209051_1000418 Ga0209051_100041858 378
141 3300025304 Ga0209257_1006051 Ga0209257_10060518 378
142 3300050490 nmdc:mga03n38_21243_c1 nmdc:mga03n38_21243_c1_822_2033 378
143 3300053122 Ga0500608_030690 Ga0500608_030690_858_2045 378
144 iso_pu_bacteria 2513237084 2513574176 378
145 iso_pu_bacteria 2513237140 2513884832 378
146 iso_pu_bacteria 2523231067 2523469901 378
147 iso_pu_bacteria 2582581866 2585395040 378
148 iso_pu_bacteria 2615840624 2616292189 378
149 iso_pu_bacteria 2615840698 2616555739 378
150 iso_pu_bacteria 2643221634 2644192832 378
151 iso_pu_bacteria 2718217882 2719181555 378
152 iso_pu_bacteria 2718218009 2719732219 378
153 iso_pu_bacteria 2718218363 2721147647 378
154 iso_pu_bacteria 2718218365 2721159096 378
155 iso_pu_bacteria 2718218366 2721164482 378
156 iso_pu_bacteria 2721755514 2722840652 378
157 iso_pu_bacteria 2721755810 2724044975 378
158 iso_pu_bacteria 2728369365 2730164790 378
159 iso_pu_bacteria 2728369397 2730298728 378
160 iso_pu_bacteria 2791355256 2793294968 378
161 iso_pu_bacteria 2791355262 2793337295 378
162 iso_pu_bacteria 2791355264 2793349839 378
163 iso_pu_bacteria 2791355265 2793357032 378
164 iso_pu_bacteria 2791355267 2793367082 378
165 iso_pu_bacteria 2818991448 2819610861 378
166 iso_pu_bacteria 2838668709 2838673573 378
167 iso_pu_bacteria 2838701080 2838705969 378
168 iso_pu_bacteria 2842146304 2842150821 378
169 iso_pu_bacteria 2842205361 2842205746 378
170 iso_pu_bacteria 2842250916 2842255783 378
171 iso_pu_bacteria 2842278818 2842279203 378
172 iso_pu_bacteria 2842489311 2842490312 378
173 iso_pu_bacteria 2935894831 2935897690 378
174 iso_pu_bacteria 2936367885 2936372342 378
175 iso_pu_bacteria 2936375103 2936380854 378
176 iso_pu_bacteria 3005416602 3005422485 378
177 iso_pu_bacteria 8005289223 8005293371 378
178 iso_pu_bacteria 8005301065 8005302847 378
179 iso_pu_bacteria 8005314921 8005320174 378
180 iso_pu_bacteria 8005376324 8005379581 378
181 iso_pu_bacteria 8005484373 8005487940 378
182 iso_pu_bacteria 8005645114 8005651508 378
183 iso_pu_bacteria 8005688590 8005689947 378
184 iso_pu_bacteria 8024479707 8024483174 378
185 iso_pu_bacteria 8024501048 8024501351 378
186 iso_pu_bacteria 8056375014 8056376921 378
187 iso_pu_bacteria 2508501122 2509110320 379
188 iso_pu_bacteria 2509276019 2509377286 379
189 iso_pu_bacteria 2510065019 2510133667 379
190 iso_pu_bacteria 2510461076 2510895084 379
191 iso_pu_bacteria 2510917028 2511186688 379
192 iso_pu_bacteria 2513237085 2513577663 379
193 iso_pu_bacteria 2513237093 2513629699 379
194 iso_pu_bacteria 2513237103 2513708347 379
195 iso_pu_bacteria 2513237162 2514022525 379
196 iso_pu_bacteria 2515154113 2515634157 379
197 iso_pu_bacteria 2515154114 2515640168 379
198 iso_pu_bacteria 2515154116 2515655638 379
199 iso_pu_bacteria 2515154134 2515740082 379
200 iso_pu_bacteria 2516653077 2517036398 379
201 iso_pu_bacteria 2516653085 2517076792 379
202 iso_pu_bacteria 2517093000 2517095546 379
203 iso_pu_bacteria 2517287029 2517407130 379
204 iso_pu_bacteria 2558860100 2558862189 379
205 iso_pu_bacteria 2582581299 2585233782 379
206 iso_pu_bacteria 2582581316 2585334864 379
207 iso_pu_bacteria 2585427526 2585527171 379
208 iso_pu_bacteria 2585427528 2585537900 379
209 iso_pu_bacteria 2585427593 2585835849 379
210 iso_pu_bacteria 2617270742 2617384554 379
211 iso_pu_bacteria 2667528174 2671114262 379
212 iso_pu_bacteria 2724679232 2725947920 379
213 iso_pu_bacteria 2738541333 2739032555 379
214 iso_pu_bacteria 2765235942 2766066753 379
215 iso_pu_bacteria 2802429633 2806043532 379
216 iso_pu_bacteria 2802429634 2806050536 379
217 iso_pu_bacteria 2802429635 2806057353 379
218 iso_pu_bacteria 2802429636 2806064732 379
219 iso_pu_bacteria 2802429637 2806071999 379
220 iso_pu_bacteria 2838029111 2838030632 379
221 iso_pu_bacteria 2838686498 2838687336 379
222 iso_pu_bacteria 2842475841 2842477087 379
223 iso_pu_bacteria 2842482326 2842485364 379
224 iso_pu_bacteria 2842502639 2842503884 379
225 iso_pu_bacteria 2850079185 2850085424 379
226 iso_pu_bacteria 2919408235 2919412411 379
227 iso_pu_bacteria 2933570622 2933572028 379
228 iso_pu_bacteria 2933586486 2933591047 379
229 iso_pu_bacteria 2935901341 2935905303 379
230 iso_pu_bacteria 639633055 639648903 379
231 iso_pu_bacteria 8005307578 8005312547 379
232 iso_pu_bacteria 8005556819 8005557322 379
233 iso_pu_bacteria 8005563573 8005567542 379
234 iso_pu_bacteria 8005570704 8005574616 379
235 iso_pu_bacteria 8018163183 8018166404 379
236 iso_pu_bacteria 8023680758 8023685001 379
237 iso_pu_bacteria 8057874678 8057880455 379
238 3300041505 Ga0451849_0063732 Ga0451849_0063732_40_1242 380
239 3300046474 Ga0495605_0085617 Ga0495605_0085617_179_1381 380
240 3300046492 Ga0495585_0098321 Ga0495585_0098321_188_1390 380
241 3300046513 Ga0495616_0031595 Ga0495616_0031595_783_1985 380
242 3300046515 Ga0495620_0014122 Ga0495620_0014122_864_2066 380
243 3300046518 Ga0495631_0007891 Ga0495631_0007891_4104_5306 380
244 3300046616 Ga0495668_0088121 Ga0495668_0088121_60_1262 380
245 3300046648 Ga0495611_0049595 Ga0495611_0049595_318_1520 380
246 3300046660 Ga0495625_0006094 Ga0495625_0006094_3457_4659 380
247 3300053105 Ga0500557_000939 Ga0500557_000939_703_1905 380
248 3300003323 rootH1_10023802 rootH1_100238025 381
249 3300009765 Ga0123341_1000070 Ga0123341_100007016 381
250 3300009766 Ga0123342_1022372 Ga0123342_10223721 381
251 3300028794 Ga0307515_10004874 Ga0307515_1000487418 381
252 3300031456 Ga0307513_10092430 Ga0307513_100924302 381
253 3300041491 Ga0451833_1235629 Ga0451833_1235629_773_1975 381
254 3300041492 Ga0451835_0054813 Ga0451835_0054813_549_1751 381
255 3300041496 Ga0451839_0350831 Ga0451839_0350831_368_1570 381
256 3300041498 Ga0451841_0450509 Ga0451841_0450509_368_1588 381
257 3300041498 Ga0451841_1271505 Ga0451841_1271505_70_1272 381
258 3300041501 Ga0451845_0651627 Ga0451845_0651627_368_1570 381
259 3300041503 Ga0451847_0308786 Ga0451847_0308786_127_1329 381
260 3300041507 Ga0451851_0030315 Ga0451851_0030315_345_1547 381
261 3300041512 Ga0451853_3263199 Ga0451853_3263199_773_1975 381
262 3300044684 Ga0466966_0035356 Ga0466966_0035356_1073_2269 381
263 3300046492 Ga0495585_0097102 Ga0495585_0097102_26_1228 381
264 3300046515 Ga0495620_0060959 Ga0495620_0060959_158_1360 381
265 3300046518 Ga0495631_0070627 Ga0495631_0070627_189_1391 381
266 3300046616 Ga0495668_0092155 Ga0495668_0092155_236_1438 381
267 3300046660 Ga0495625_0030223 Ga0495625_0030223_2706_3908 381
268 3300046810 Ga0495660_0023672 Ga0495660_0023672_160_1362 381
269 3300047470 Ga0495681_0050728 Ga0495681_0050728_348_1550 381
270 3300003320 rootH2_10051213 rootH2_100512138 382
271 3300003322 rootL2_10027389 rootL2_100273893 382
272 3300025254 Ga0209148_1007450 Ga0209148_10074502 382
273 3300028794 Ga0307515_10019373 Ga0307515_100193735 382
274 3300044694 Ga0466963_0017957 Ga0466963_0017957_635_1834 382
275 3300044765 Ga0466970_0023474 Ga0466970_0023474_216_1415 382
276 3300044842 Ga0466957_0022216 Ga0466957_0022216_868_2067 382
277 3300045836 Ga0466958_0008706 Ga0466958_0008706_3070_4269 382
278 3300046809 Ga0495600_0030259 Ga0495600_0030259_1258_2457 382
279 3300047317 Ga0495604_0026252 Ga0495604_0026252_1033_2232 382
280 3300053125 Ga0500618_001307 Ga0500618_001307_858_2057 382
281 iso_pu_bacteria 2582581283 2585168590 382
282 3300001979 JGI24740J21852_10000150 JGI24740J21852_1000015027 383
283 3300002737 JGI25162J39368_1000476 JGI25162J39368_100047635 383
284 3300003187 JGI25151J46595_10016144 JGI25151J46595_100161442 383
285 3300003214 JGI25165J46597_1000068 JGI25165J46597_100006871 383
286 3300003215 JGI25153J46596_10008598 JGI25153J46596_100085982 383
287 3300003323 rootH1_10085278 rootH1_100852785 383
288 3300003354 JGI25160J50197_1000960 JGI25160J50197_10009602 383
289 3300003771 Ga0055526_1000754 Ga0055526_100075421 383
290 3300003775 Ga0055524_1000796 Ga0055524_10007967 383
291 3300003790 Ga0055528_1000157 Ga0055528_10001577 383
292 3300005262 Ga0065165_1016428 Ga0065165_10164281 383
293 3300005614 Ga0068856_100039726 Ga0068856_1000397265 383
294 3300006178 Ga0075367_10005657 Ga0075367_100056574 383
295 3300009763 Ga0123340_1052600 Ga0123340_10526001 383
296 3300009766 Ga0123342_1031814 Ga0123342_10318142 383
297 3300009766 Ga0123342_1036415 Ga0123342_10364152 383
298 3300021321 Ga0214542_1019910 Ga0214542_10199102 383
299 3300021327 Ga0214543_1000005 Ga0214543_1000005195 383
300 3300025233 Ga0209437_100067 Ga0209437_100067146 383
301 3300025245 Ga0207425_1014361 Ga0207425_10143612 383
302 3300025258 Ga0209129_1000231 Ga0209129_100023148 383
303 3300025261 Ga0209233_1000088 Ga0209233_1000088146 383
304 3300025273 Ga0209673_1000385 Ga0209673_100038564 383
305 3300025273 Ga0209673_1003340 Ga0209673_10033408 383
306 3300025294 Ga0209025_1000058 Ga0209025_100005845 383
307 3300025295 Ga0209564_1000118 Ga0209564_1000118159 383
308 3300025297 Ga0209758_1000366 Ga0209758_100036653 383
309 3300025299 Ga0209256_1000160 Ga0209256_100016085 383
310 3300025302 Ga0207426_1000147 Ga0207426_1000147155 383
311 3300025303 Ga0209051_1002327 Ga0209051_10023272 383
312 3300046460 Ga0495638_0000683 Ga0495638_0000683_29418_30620 383
313 3300046474 Ga0495605_0015772 Ga0495605_0015772_65_1267 383
314 3300046501 Ga0495607_0071438 Ga0495607_0071438_339_1541 383
315 3300046513 Ga0495616_0056327 Ga0495616_0056327_104_1306 383
316 3300046518 Ga0495631_0007778 Ga0495631_0007778_3911_5113 383
317 3300046530 Ga0495654_0050101 Ga0495654_0050101_584_1786 383
318 3300046660 Ga0495625_0041439 Ga0495625_0041439_223_1425 383
319 3300046810 Ga0495660_0054730 Ga0495660_0054730_460_1662 383
320 3300048919 Ga0496116_0000042 Ga0496116_0000042_133996_135198 383
321 3300048922 Ga0496119_0005479 Ga0496119_0005479_3419_4621 383
322 3300048925 Ga0496122_0004854 Ga0496122_0004854_10911_12122 383
323 3300048926 Ga0496123_0009982 Ga0496123_0009982_6399_7601 383
324 3300050492 nmdc:mga0yw44_5140_c1 nmdc:mga0yw44_5140_c1_1173_2375 383
325 3300050516 nmdc:mga0sz30_52973_c1 nmdc:mga0sz30_52973_c1_386_1588 383

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02687

FtsX

FtsX-like permease family

279

400

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5udf-assembly1.cif.gz_B structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.7417 44 231
5f9q-assembly1.cif.gz_A crystal structure of the extracellular domain of noncanonic abc-type transporter yknz from gram-positive bacteria 0.6986 45 231
5udf-assembly1.cif.gz_C structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.6927 44 232
5f9q-assembly1.cif.gz_A crystal structure of the extracellular domain of noncanonic abc-type transporter yknz from gram-positive bacteria 0.6921 45 231
5udf-assembly1.cif.gz_D structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.6876 33 232
ID Description Score Start End Superfamily
af_A4HXK6_1_386_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.6296 197 238 3.30.70.330
af_Q54DV6_11_142_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.6249 78 114 3.40.630.30
af_Q4DYI6_90_193_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.6243 190 245 3.30.70.330
af_A0A1D6EBG6_74_168_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.6149 196 233 3.30.70.330
af_Q10425_33_136_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.6128 196 240 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A519FWA3-F1-model_v4 deleted 0.8934 8 240
AF-K0VGF8-F1-model_v4 MacB-like periplasmic core domain-containing protein 0.885 1 250 GO:0016020
AF-A0A534H8N3-F1-model_v4 ABC transporter permease 0.8772 28 379 GO:0005886
AF-A0A534H8N3-F1-model_v4 ABC transporter permease 0.868 28 379 GO:0005886
AF-A0A539D059-F1-model_v4 ABC3 transporter permease C-terminal domain-containing protein 0.8559 34 379 GO:0005886

Feature Viewer

pLDDT pTM Quality
65.33 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map