F408091

General Info

Members Datasets Scaffolds Average Seq Length
325 238 294 359

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2772190715|2772642253
Length 392
Sequence SAVHPPGRAGAILEFEIRPSRHCLRDEDRHSFLDAPVFGQVFTDHMVTLRWDSERGWHDGRLEEFHNLSLPPSASVFHYGQEVFEGMKAYRQPDGSIALFRPERNAARFNASARRLAMPELPVETFLRAVELLVRQDRQWVPDGAGTSLYLRPFMIATQPTLGFTLPSNSYLFCVVASPASPYFSVRTGPPALTVWISEEYARAAPGGTGAAKAGGNYAAAFLAQRHAVEQGCDQVVWLDAAEHTWVEEMGGMNLCFVQQPTDDGPATLMTPALTGTLLPGVTRDSLLRLAARLGLGCEEGRISVAQWRKRCEAGVITEVFACGTAAVIAPVGQVRAADGGWTVGDGRPGPVTMRLREELLGIQYGRRPDDLGWLRTVCGPTEGPTSLERVC

Samples

Sample ID Description Type Environment
1 2582580736 Prauserella sp. Am3 Isolate Unclassified
2 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
3 2600255229 Lactobacillus acidophilus A 16 Isolate Rhizosphere
4 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
5 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
6 2739367653 Kocuria sp. OV113 Isolate Unclassified
7 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
8 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
9 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
10 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
11 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
12 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
13 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
14 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
15 2857727296 Kocuria sp. R-72562 Isolate Unclassified
16 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
17 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
18 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
19 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
20 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
21 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
22 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
23 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
24 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
25 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
26 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
27 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
28 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
29 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
88 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
126 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
127 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
131 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
132 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
133 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
134 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
135 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
136 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
137 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
138 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
139 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
147 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
148 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
149 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
150 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
151 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
164 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
168 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
169 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
170 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
171 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
181 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
182 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
183 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
184 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
185 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
186 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
187 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
188 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
193 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
194 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
195 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
210 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
211 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
212 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
233 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
234 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
235 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
237 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
238 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.69
Metatranscriptomes 2.77
Isolates 9.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 7.08
Rhizosphere 83.08
Stem 0
Stem Tuber 0.31
Unclassified 9.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100009196 3300005329 Bacteria 8438
2 Ga0070690_100108699 3300005330 Bacteria 1848
3 Ga0068869_100002473 3300005334 Bacteria 11147
4 Ga0068868_100081834 3300005338 Bacteria 2589
5 Ga0070691_10010652 3300005341 Bacteria 4199
6 Ga0070661_100078378 3300005344 Bacteria 2437
7 Ga0070668_100010588 3300005347 Bacteria 6857
8 Ga0070669_100037935 3300005353 Bacteria 3497
9 Ga0070675_100063065 3300005354 Bacteria 3063
10 Ga0070659_100073052 3300005366 Bacteria 2730
11 Ga0070714_100001258 3300005435 Bacteria 18293
12 Ga0070714_100001791 3300005435 Bacteria 15636
13 Ga0070714_100004094 3300005435 Bacteria 10961
14 Ga0070714_100038075 3300005435 Bacteria 4043
15 Ga0070713_100040946 3300005436 Bacteria 3771
16 Ga0070710_10034896 3300005437 Bacteria 2738
17 Ga0070711_100040854 3300005439 Bacteria 3130
18 Ga0070700_100000797 3300005441 Bacteria 15442
19 Ga0070700_100079557 3300005441 Bacteria 2113
20 Ga0070708_100061020 3300005445 Bacteria 3367
21 Ga0070663_100006403 3300005455 Bacteria 7079
22 Ga0070663_100053637 3300005455 Bacteria 2879
23 Ga0070678_100021315 3300005456 Bacteria 4271
24 Ga0070662_100012686 3300005457 Bacteria 5594
25 Ga0070706_100067789 3300005467 Bacteria 3300
26 Ga0070706_100106821 3300005467 Bacteria 2604
27 Ga0070707_100003528 3300005468 Bacteria 14764
28 Ga0070707_100090076 3300005468 Bacteria 2969
29 Ga0070698_100000404 3300005471 Bacteria 45800
30 Ga0070684_100002401 3300005535 Bacteria 13813
31 Ga0070684_100292856 3300005535 Bacteria 1493
32 Ga0070672_100305096 3300005543 Bacteria 1350
33 Ga0068855_100061210 3300005563 Bacteria 4399
34 Ga0070664_100005007 3300005564 Bacteria 10616
35 Ga0070664_100106371 3300005564 Bacteria 2444
36 Ga0068857_100019695 3300005577 Bacteria 5927
37 Ga0070702_100120430 3300005615 Bacteria 1642
38 Ga0068859_100000488 3300005617 Bacteria 39249
39 Ga0068859_100195699 3300005617 Bacteria 2106
40 Ga0068864_100059155 3300005618 Bacteria 3315
41 Ga0068864_100097040 3300005618 Bacteria 2609
42 Ga0068863_100042179 3300005841 Bacteria 4335
43 Ga0068858_100015095 3300005842 Bacteria 7264
44 Ga0068858_100036987 3300005842 Bacteria 4525
45 Ga0081455_10066600 3300005937 Bacteria 3007
46 Ga0081540_1063821 3300005983 Bacteria 1741
47 Ga0070717_10117701 3300006028 Bacteria 2273
48 Ga0070716_100086398 3300006173 Bacteria 1887
49 Ga0097621_100098605 3300006237 Bacteria 2455
50 Ga0068871_100035032 3300006358 Bacteria 3987
51 Ga0075428_100001745 3300006844 Bacteria 23201
52 Ga0075431_100024652 3300006847 Bacteria 6167
53 Ga0097620_100000488 3300006931 Bacteria 39249
54 Ga0097620_100195700 3300006931 Bacteria 2106
55 Ga0105240_10023728 3300009093 Bacteria 8102
56 Ga0111539_10000515 3300009094 Bacteria 49121
57 Ga0105245_10003947 3300009098 Bacteria 13197
58 Ga0105245_10009574 3300009098 Bacteria 8452
59 Ga0105245_10481373 3300009098 Bacteria 1255
60 Ga0105247_10006153 3300009101 Bacteria 7456
61 Ga0105248_10085854 3300009177 Bacteria 3541
62 Ga0105237_10051977 3300009545 Bacteria 4115
63 Ga0105238_10098017 3300009551 Bacteria 2916
64 Ga0157370_10022882 3300013104 Bacteria 6213
65 Ga0157369_10047107 3300013105 Bacteria 4683
66 Ga0157374_10006442 3300013296 Bacteria 9966
67 Ga0157372_10000004 3300013307 Bacteria 435659
68 Ga0157372_10354025 3300013307 Bacteria 1711
69 Ga0157375_10164069 3300013308 Bacteria 2365
70 Ga0157375_10484100 3300013308 Bacteria 1402
71 Ga0163163_10006581 3300014325 Bacteria 10177
72 Ga0157377_10001444 3300014745 Bacteria 10266
73 Ga0157376_10126053 3300014969 Bacteria 2277
74 Ga0197907_10039615 3300020069 Bacteria 3654
75 Ga0197907_10200664 3300020069 Bacteria 2556
76 Ga0206355_1543145 3300020076 Bacteria 1741
77 Ga0206350_10058222 3300020080 Bacteria 2081
78 Ga0206350_10371188 3300020080 Bacteria 2719
79 Ga0206353_10510223 3300020082 Bacteria 1574
80 Ga0206353_10855062 3300020082 Bacteria 1355
81 Ga0224712_10013023 3300022467 Bacteria 2636
82 Ga0224712_10029086 3300022467 Bacteria 1981
83 Ga0207710_10015021 3300025900 Bacteria 3270
84 Ga0207688_10095199 3300025901 Bacteria 1714
85 Ga0207699_10093774 3300025906 Bacteria 1890
86 Ga0207705_10036026 3300025909 Bacteria 3542
87 Ga0207705_10236087 3300025909 Bacteria 1392
88 Ga0207695_10070934 3300025913 Bacteria 3559
89 Ga0207693_10039681 3300025915 Bacteria 3707
90 Ga0207693_10111716 3300025915 Bacteria 2143
91 Ga0207663_10023908 3300025916 Bacteria 3514
92 Ga0207646_10021135 3300025922 Bacteria 6020
93 Ga0207681_10031698 3300025923 Bacteria 3454
94 Ga0207694_10051956 3300025924 Bacteria 3177
95 Ga0207659_10005102 3300025926 Bacteria 7958
96 Ga0207687_10063988 3300025927 Bacteria 2606
97 Ga0207687_10245849 3300025927 Bacteria 1420
98 Ga0207700_10030991 3300025928 Bacteria 3794
99 Ga0207700_10055488 3300025928 Bacteria 2978
100 Ga0207700_10108138 3300025928 Bacteria 2232
101 Ga0207664_10001096 3300025929 Bacteria 18076
102 Ga0207664_10002952 3300025929 Bacteria 11298
103 Ga0207664_10008682 3300025929 Bacteria 7104
104 Ga0207664_10057416 3300025929 Bacteria 3093
105 Ga0207706_10010490 3300025933 Bacteria 8466
106 Ga0207665_10035709 3300025939 Bacteria 3301
107 Ga0207689_10011877 3300025942 Bacteria 7465
108 Ga0207661_10019347 3300025944 Bacteria 5075
109 Ga0207679_10269156 3300025945 Bacteria 1456
110 Ga0207667_10067757 3300025949 Bacteria 3718
111 Ga0207668_10152041 3300025972 Bacteria 1793
112 Ga0207703_10016876 3300026035 Bacteria 5695
113 Ga0207703_10242079 3300026035 Bacteria 1622
114 Ga0207678_10000897 3300026067 Bacteria 27312
115 Ga0207678_10079758 3300026067 Bacteria 2802
116 Ga0207708_10009002 3300026075 Bacteria 7390
117 Ga0207702_10024639 3300026078 Bacteria 4993
118 Ga0207641_10114187 3300026088 Bacteria 2399
119 Ga0207648_10218912 3300026089 Bacteria 1692
120 Ga0207676_10045696 3300026095 Bacteria 3385
121 Ga0207676_10121834 3300026095 Bacteria 2201
122 Ga0207674_10028698 3300026116 Bacteria 5869
123 Ga0207683_10035637 3300026121 Bacteria 4328
124 Ga0207428_10053843 3300027907 Bacteria 3207
125 Ga0265334_10021756 3300028573 Bacteria 2618
126 Ga0307515_10050020 3300028794 Bacteria 6269
127 Ga0265338_10001359 3300028800 Bacteria 39843
128 Ga0307511_10051992 3300030521 Bacteria 3273
129 Ga0307516_10041079 3300031730 Bacteria 4600
130 Ga0307518_10001495 3300031838 Bacteria 17352
131 Ga0307416_100033925 3300032002 Bacteria 3877
132 Ga0307416_100078451 3300032002 Bacteria 2779
133 Ga0307415_100109725 3300032126 Bacteria 2045
134 Ga0307507_10060472 3300033179 Bacteria 3536
135 Ga0373926_0075059 3300035083 Bacteria 1245
136 Ga0373934_0000188 3300035086 Bacteria 22728
137 Ga0373944_0087428 3300035089 Bacteria 1037
138 Ga0373945_0048890 3300035116 Bacteria 1550
139 Ga0373953_0000066 3300035117 Bacteria 26358
140 Ga0373954_0024760 3300035118 Bacteria 2738
141 Ga0373956_0000657 3300035119 Bacteria 14200
142 Ga0373957_0000118 3300035120 Bacteria 19159
143 Ga0373946_0124844 3300035171 Bacteria 1178
144 Ga0373955_0000007 3300035172 Bacteria 87917
145 Ga0373955_0172005 3300035172 Bacteria 1282
146 Ga0373924_0002619 3300035410 Bacteria 6073
147 Ga0373933_0000002 3300035724 Bacteria 151785
148 Ga0373937_0000014 3300036401 Bacteria 151785
149 Ga0395900_0036055 3300037418 Bacteria 5097
150 Ga0395900_0166818 3300037418 Bacteria 2244
151 Ga0395898_0003904 3300037466 Bacteria 16464
152 Ga0400489_37299 3300039093 Bacteria 63307
153 Ga0451797_1200563 3300041453 Bacteria 3258
154 Ga0451841_0647760 3300041498 Bacteria 3023
155 Ga0451843_0915212 3300041509 Bacteria 1592
156 Ga0451577_0000117 3300042876 Bacteria 174690
157 Ga0451577_0000704 3300042876 Bacteria 52305
158 Ga0451577_0001136 3300042876 Bacteria 37745
159 Ga0451577_0005440 3300042876 Bacteria 13052
160 Ga0451577_0009307 3300042876 Bacteria 9471
161 Ga0451577_0044871 3300042876 Bacteria 3956
162 Ga0451577_0089356 3300042876 Bacteria 2749
163 Ga0451577_0128899 3300042876 Bacteria 2268
164 Ga0451577_0226251 3300042876 Bacteria 1691
165 Ga0466972_0003299 3300044658 Bacteria 7996
166 Ga0466972_0005914 3300044658 Bacteria 6137
167 Ga0466972_0042313 3300044658 Bacteria 2215
168 Ga0466966_0182600 3300044684 Bacteria 1273
169 Ga0466963_0145636 3300044694 Bacteria 1643
170 Ga0453684_0000502 3300044712 Bacteria 153452
171 Ga0453684_0001053 3300044712 Bacteria 87876
172 Ga0453684_0003175 3300044712 Bacteria 37731
173 Ga0453684_0004746 3300044712 Bacteria 28076
174 Ga0453684_0011307 3300044712 Bacteria 15005
175 Ga0453684_0088397 3300044712 Bacteria 3837
176 Ga0466971_0016434 3300044719 Bacteria 3267
177 Ga0451576_0000722 3300045051 Bacteria 66562
178 Ga0466958_0052482 3300045836 Bacteria 2472
179 Ga0466967_0000128 3300045976 Bacteria 28888
180 Ga0466967_0039423 3300045976 Bacteria 4061
181 Ga0495617_028738 3300046452 Bacteria 1869
182 Ga0495592_0000077 3300046454 Bacteria 85837
183 Ga0495603_0001969 3300046455 Bacteria 12103
184 Ga0495629_0058147 3300046459 Bacteria 2703
185 Ga0495641_0108517 3300046461 Bacteria 1239
186 Ga0495651_0000019 3300046462 Bacteria 120970
187 Ga0495651_0205980 3300046462 Bacteria 1373
188 Ga0495653_0001268 3300046463 Bacteria 19539
189 Ga0495580_0116109 3300046472 Bacteria 1859
190 Ga0495639_0165274 3300046475 Bacteria 1072
191 Ga0495662_0041138 3300046476 Bacteria 2232
192 Ga0495664_0050503 3300046477 Bacteria 2470
193 Ga0495594_0001386 3300046499 Bacteria 12574
194 Ga0495608_0000028 3300046511 Bacteria 151829
195 Ga0495628_0001918 3300046516 Bacteria 18867
196 Ga0495652_0000031 3300046529 Bacteria 151765
197 Ga0495587_0000023 3300046536 Bacteria 151763
198 Ga0495587_0007052 3300046536 Bacteria 7294
199 Ga0495598_0002899 3300046537 Unclassified 3590
200 Ga0495645_0028940 3300046543 Bacteria 4026
201 Ga0495622_0000362 3300046557 Bacteria 31762
202 Ga0495667_0000913 3300046559 Bacteria 19089
203 Ga0495634_0060226 3300046642 Bacteria 2526
204 Ga0495611_0005996 3300046648 Bacteria 5184
205 Ga0495635_0019113 3300046663 Bacteria 4782
206 Ga0495635_0137086 3300046663 Bacteria 1668
207 Ga0495588_0106897 3300046674 Bacteria 1473
208 Ga0495657_0000022 3300046675 Bacteria 151837
209 Ga0495599_0000174 3300046678 Bacteria 42332
210 Ga0495599_0001578 3300046678 Bacteria 13138
211 Ga0495623_0000199 3300046679 Bacteria 38030
212 Ga0495646_0013984 3300046680 Bacteria 5101
213 Ga0495658_0224768 3300046683 Bacteria 1176
214 Ga0495600_0024669 3300046809 Bacteria 3871
215 Ga0495600_0107798 3300046809 Bacteria 1814
216 Ga0495604_0000022 3300047317 Bacteria 151744
217 Ga0495676_0363310 3300047321 Bacteria 966
218 Ga0495680_0001555 3300047322 Bacteria 24556
219 Ga0495680_0027141 3300047322 Bacteria 4708
220 Ga0495687_001372 3300047443 Bacteria 22510
221 Ga0495684_0025721 3300047471 Bacteria 4522
222 Ga0495593_0106378 3300047673 Bacteria 1435
223 Ga0495602_0000169 3300048088 Bacteria 60858
224 Ga0495602_0206931 3300048088 Bacteria 1493
225 Ga0496102_0000013 3300048905 Bacteria 311668
226 Ga0496102_0082618 3300048905 Bacteria 2963
227 Ga0496103_0001975 3300048906 Bacteria 13260
228 Ga0496104_0004728 3300048907 Bacteria 11855
229 Ga0496104_0021106 3300048907 Bacteria 5975
230 Ga0496105_0002527 3300048908 Bacteria 13274
231 Ga0496105_0014316 3300048908 Bacteria 6313
232 Ga0496106_0290735 3300048909 Bacteria 1310
233 Ga0496108_0002432 3300048911 Bacteria 14881
234 Ga0496108_0027105 3300048911 Bacteria 4727
235 Ga0496108_0138541 3300048911 Bacteria 2096
236 Ga0496109_0046609 3300048912 Bacteria 3938
237 Ga0496109_0064085 3300048912 Bacteria 3362
238 Ga0496110_0078688 3300048913 Bacteria 2935
239 Ga0496110_0468057 3300048913 Bacteria 1148
240 Ga0496111_0010499 3300048914 Bacteria 6219
241 Ga0496111_0030391 3300048914 Bacteria 3840
242 Ga0496112_0033261 3300048915 Bacteria 5011
243 Ga0496113_0002226 3300048916 Bacteria 11196
244 Ga0496114_0008040 3300048917 Bacteria 8351
245 Ga0496114_0050849 3300048917 Bacteria 3450
246 Ga0496115_0128170 3300048918 Bacteria 2091
247 Ga0496118_0015526 3300048921 Bacteria 7045
248 Ga0496119_0000022 3300048922 Bacteria 269878
249 Ga0496120_0001243 3300048923 Bacteria 32177
250 Ga0501031_0008017 3300049568 Bacteria 6877
251 Ga0501032_0035836 3300049569 Bacteria 3390
252 Ga0501033_0135574 3300049570 Bacteria 1781
253 Ga0501033_0199573 3300049570 Bacteria 1429
254 Ga0501034_0002149 3300049571 Bacteria 24475
255 Ga0501034_0017338 3300049571 Bacteria 7387
256 Ga0501034_0047208 3300049571 Bacteria 4350
257 Ga0501034_0222182 3300049571 Bacteria 1841
258 Ga0501036_0000840 3300049572 Bacteria 22836
259 Ga0501036_0141986 3300049572 Bacteria 2026
260 Ga0501037_0170071 3300049573 Bacteria 1549
261 Ga0501038_0000326 3300049574 Bacteria 40997
262 Ga0501038_0008669 3300049574 Bacteria 9337
263 Ga0501038_0021148 3300049574 Bacteria 5845
264 Ga0501042_0033496 3300049578 Bacteria 3642
265 Ga0501043_0018454 3300049579 Bacteria 5471
266 Ga0501043_0021404 3300049579 Bacteria 5069
267 Ga0501043_0318545 3300049579 Bacteria 1186
268 Ga0501046_0043351 3300049580 Bacteria 3582
269 Ga0501046_0129547 3300049580 Bacteria 1914
270 Ga0501047_0006152 3300049581 Bacteria 11284
271 Ga0501047_0029604 3300049581 Bacteria 5279
272 Ga0501047_0147324 3300049581 Bacteria 2230
273 Ga0501048_0000557 3300049582 Bacteria 26386
274 Ga0501048_0017755 3300049582 Bacteria 5236
275 Ga0501048_0255598 3300049582 Bacteria 1244
276 Ga0501070_0241554 3300049586 Bacteria 1478
277 Ga0501072_0003361 3300049588 Bacteria 12029
278 Ga0501083_0038475 3300049744 Bacteria 3251
279 Ga0501035_0015862 3300049822 Bacteria 6951
280 Ga0501035_0033158 3300049822 Bacteria 4697
281 Ga0501044_0002652 3300049823 Bacteria 20346
282 Ga0501044_0020408 3300049823 Bacteria 7075
283 Ga0501044_0028682 3300049823 Bacteria 5872
284 Ga0501044_0046121 3300049823 Bacteria 4514
285 nmdc:mga0yw44_47308_c1 3300050492 Bacteria 2588
286 nmdc:mga06r32_30_c6 3300050510 Bacteria 12806
287 nmdc:mga08y16_180533_c1 3300050511 Bacteria 2192
288 nmdc:mga08x19_125298_c1 3300050514 Bacteria 1725
289 Ga0495601_0042420 3300053077 Bacteria 2854
290 Ga0495595_0021967 3300053084 Bacteria 2795
291 Ga0495595_0092604 3300053084 Bacteria 1451
292 Ga0495619_0117875 3300053085 Bacteria 1818
293 Ga0501082_0038834 3300060353 Bacteria 4106
294 Ga0501082_0184712 3300060353 Bacteria 1814

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005435 Ga0070714_100038075 Ga0070714_1000380753 285
2 3300005455 Ga0070663_100006403 Ga0070663_1000064034 285
3 3300026067 Ga0207678_10000897 Ga0207678_1000089711 285
4 3300046674 Ga0495588_0106897 Ga0495588_0106897_534_1436 285
5 3300047321 Ga0495676_0363310 Ga0495676_0363310_32_934 285
6 iso_pu_bacteria 2929226422 2929230723 287
7 3300028794 Ga0307515_10050020 Ga0307515_100500205 289
8 3300005347 Ga0070668_100010588 Ga0070668_1000105882 290
9 3300044658 Ga0466972_0003299 Ga0466972_0003299_3712_4815 291
10 3300046461 Ga0495641_0108517 Ga0495641_0108517_276_1217 298
11 3300020082 Ga0206353_10855062 Ga0206353_108550622 300
12 3300044694 Ga0466963_0145636 Ga0466963_0145636_305_1402 301
13 3300045836 Ga0466958_0052482 Ga0466958_0052482_540_1637 301
14 3300005435 Ga0070714_100001258 Ga0070714_1000012587 307
15 3300025929 Ga0207664_10001096 Ga0207664_1000109617 307
16 iso_pu_bacteria 2600255229 2601445975 308
17 3300020069 Ga0197907_10200664 Ga0197907_102006642 309
18 3300020080 Ga0206350_10058222 Ga0206350_100582221 309
19 3300020082 Ga0206353_10510223 Ga0206353_105102232 309
20 3300022467 Ga0224712_10013023 Ga0224712_100130233 309
21 3300025909 Ga0207705_10036026 Ga0207705_100360264 309
22 3300037418 Ga0395900_0166818 Ga0395900_0166818_1227_2207 310
23 3300045976 Ga0466967_0039423 Ga0466967_0039423_3065_4045 310
24 3300050514 nmdc:mga08x19_125298_c1 nmdc:mga08x19_125298_c1_28_1005 310
25 3300044712 Ga0453684_0088397 Ga0453684_0088397_949_1968 311
26 3300049574 Ga0501038_0008669 Ga0501038_0008669_8338_9318 311
27 3300025915 Ga0207693_10111716 Ga0207693_101117162 313
28 3300032126 Ga0307415_100109725 Ga0307415_1001097252 313
29 3300042876 Ga0451577_0044871 Ga0451577_0044871_129_1154 313
30 3300035083 Ga0373926_0075059 Ga0373926_0075059_216_1208 314
31 3300035089 Ga0373944_0087428 Ga0373944_0087428_14_1006 314
32 3300048918 Ga0496115_0128170 Ga0496115_0128170_1077_2066 314
33 3300026089 Ga0207648_10218912 Ga0207648_102189122 316
34 3300046537 Ga0495598_0002899 Ga0495598_0002899_2428_3555 316
35 3300006847 Ga0075431_100024652 Ga0075431_1000246523 317
36 3300050510 nmdc:mga06r32_30_c6 nmdc:mga06r32_30_c6_3886_5013 317
37 3300028573 Ga0265334_10021756 Ga0265334_100217563 318
38 iso_pu_bacteria 2791354901 2791915599 318
39 3300037466 Ga0395898_0003904 Ga0395898_0003904_12782_13870 319
40 3300042876 Ga0451577_0000117 Ga0451577_0000117_171530_172603 319
41 3300042876 Ga0451577_0000704 Ga0451577_0000704_48519_49592 319
42 3300042876 Ga0451577_0089356 Ga0451577_0089356_1347_2420 319
43 3300042876 Ga0451577_0128899 Ga0451577_0128899_1077_2147 319
44 3300044658 Ga0466972_0042313 Ga0466972_0042313_991_2079 319
45 3300044712 Ga0453684_0001053 Ga0453684_0001053_48519_49592 319
46 3300045051 Ga0451576_0000722 Ga0451576_0000722_11020_12093 319
47 3300048913 Ga0496110_0468057 Ga0496110_0468057_60_1076 319
48 iso_pu_bacteria 2675903060 2676488960 319
49 iso_pu_bacteria 2791355253 2793281377 319
50 iso_pu_bacteria 2935390628 2935390751 319
51 iso_pu_bacteria 3006425503 3006430417 319
52 3300005564 Ga0070664_100106371 Ga0070664_1001063713 320
53 3300009093 Ga0105240_10023728 Ga0105240_100237282 320
54 3300009551 Ga0105238_10098017 Ga0105238_100980172 320
55 3300025913 Ga0207695_10070934 Ga0207695_100709342 320
56 3300025924 Ga0207694_10051956 Ga0207694_100519563 320
57 3300028800 Ga0265338_10001359 Ga0265338_100013595 320
58 3300044712 Ga0453684_0000502 Ga0453684_0000502_146092_147123 320
59 3300048916 Ga0496113_0002226 Ga0496113_0002226_9297_10394 320
60 3300060353 Ga0501082_0184712 Ga0501082_0184712_158_1258 320
61 iso_pu_bacteria 2739367653 2739602608 320
62 iso_pu_bacteria 2816332305 2817508919 320
63 iso_pu_bacteria 2857727296 2857729209 320
64 iso_pu_bacteria 2893684298 2893686699 320
65 iso_pu_bacteria 3006321560 3006322713 320
66 3300005330 Ga0070690_100108699 Ga0070690_1001086992 321
67 3300005435 Ga0070714_100001791 Ga0070714_1000017919 321
68 3300005439 Ga0070711_100040854 Ga0070711_1000408544 321
69 3300013307 Ga0157372_10000004 Ga0157372_1000000489 321
70 3300025906 Ga0207699_10093774 Ga0207699_100937742 321
71 3300025928 Ga0207700_10055488 Ga0207700_100554883 321
72 3300025929 Ga0207664_10008682 Ga0207664_100086825 321
73 3300025929 Ga0207664_10057416 Ga0207664_100574165 321
74 3300032002 Ga0307416_100078451 Ga0307416_1000784511 321
75 3300042876 Ga0451577_0005440 Ga0451577_0005440_6122_7195 321
76 3300042876 Ga0451577_0009307 Ga0451577_0009307_8095_9168 321
77 3300042876 Ga0451577_0226251 Ga0451577_0226251_86_1207 321
78 3300044712 Ga0453684_0004746 Ga0453684_0004746_18291_19364 321
79 3300044712 Ga0453684_0011307 Ga0453684_0011307_11389_12462 321
80 3300049579 Ga0501043_0318545 Ga0501043_0318545_70_1149 321
81 3300049588 Ga0501072_0003361 Ga0501072_0003361_9143_10246 321
82 3300005617 Ga0068859_100000488 Ga0068859_10000048826 322
83 3300006931 Ga0097620_100000488 Ga0097620_10000048826 322
84 3300009101 Ga0105247_10006153 Ga0105247_100061538 322
85 3300025900 Ga0207710_10015021 Ga0207710_100150212 322
86 3300030521 Ga0307511_10051992 Ga0307511_100519922 322
87 3300039093 Ga0400489_37299 Ga0400489_37299_45427_46509 322
88 3300042876 Ga0451577_0001136 Ga0451577_0001136_32969_34060 322
89 3300044712 Ga0453684_0003175 Ga0453684_0003175_3686_4777 322
90 3300048905 Ga0496102_0000013 Ga0496102_0000013_161304_162392 322
91 3300048906 Ga0496103_0001975 Ga0496103_0001975_9552_10640 322
92 3300048921 Ga0496118_0015526 Ga0496118_0015526_3836_4924 322
93 3300049568 Ga0501031_0008017 Ga0501031_0008017_631_1719 322
94 3300049571 Ga0501034_0017338 Ga0501034_0017338_5203_6291 322
95 3300049571 Ga0501034_0047208 Ga0501034_0047208_755_1873 322
96 3300049572 Ga0501036_0141986 Ga0501036_0141986_350_1438 322
97 3300049573 Ga0501037_0170071 Ga0501037_0170071_135_1223 322
98 3300049579 Ga0501043_0018454 Ga0501043_0018454_2566_3654 322
99 3300049580 Ga0501046_0043351 Ga0501046_0043351_477_1565 322
100 3300049581 Ga0501047_0029604 Ga0501047_0029604_1507_2625 322
101 3300049582 Ga0501048_0017755 Ga0501048_0017755_1488_2576 322
102 3300049586 Ga0501070_0241554 Ga0501070_0241554_120_1238 322
103 3300049744 Ga0501083_0038475 Ga0501083_0038475_2045_3133 322
104 3300049823 Ga0501044_0020408 Ga0501044_0020408_842_1960 322
105 3300050492 nmdc:mga0yw44_47308_c1 nmdc:mga0yw44_47308_c1_1049_2149 322
106 3300060353 Ga0501082_0038834 Ga0501082_0038834_1056_2144 322
107 iso_pu_bacteria 2915358134 2915362265 322
108 iso_pu_bacteria 8054472261 8054472864 322
109 3300005441 Ga0070700_100000797 Ga0070700_1000007975 323
110 3300005937 Ga0081455_10066600 Ga0081455_100666002 323
111 3300005983 Ga0081540_1063821 Ga0081540_10638212 323
112 3300006844 Ga0075428_100001745 Ga0075428_10000174521 323
113 3300013105 Ga0157369_10047107 Ga0157369_100471073 323
114 3300020069 Ga0197907_10039615 Ga0197907_100396152 323
115 3300022467 Ga0224712_10029086 Ga0224712_100290862 323
116 3300025909 Ga0207705_10236087 Ga0207705_102360872 323
117 3300031730 Ga0307516_10041079 Ga0307516_100410792 323
118 3300035171 Ga0373946_0124844 Ga0373946_0124844_121_1152 323
119 3300044719 Ga0466971_0016434 Ga0466971_0016434_1766_2857 323
120 3300046475 Ga0495639_0165274 Ga0495639_0165274_29_1060 323
121 3300046476 Ga0495662_0041138 Ga0495662_0041138_541_1611 323
122 3300046477 Ga0495664_0050503 Ga0495664_0050503_223_1293 323
123 3300046663 Ga0495635_0137086 Ga0495635_0137086_562_1632 323
124 3300048088 Ga0495602_0206931 Ga0495602_0206931_126_1196 323
125 3300048905 Ga0496102_0082618 Ga0496102_0082618_1628_2698 323
126 3300048907 Ga0496104_0021106 Ga0496104_0021106_1118_2188 323
127 3300048908 Ga0496105_0014316 Ga0496105_0014316_1040_2110 323
128 3300048911 Ga0496108_0002432 Ga0496108_0002432_904_1974 323
129 3300048912 Ga0496109_0064085 Ga0496109_0064085_827_1897 323
130 3300048914 Ga0496111_0010499 Ga0496111_0010499_3978_5048 323
131 3300048917 Ga0496114_0050849 Ga0496114_0050849_1195_2265 323
132 3300048922 Ga0496119_0000022 Ga0496119_0000022_60466_61557 323
133 3300048923 Ga0496120_0001243 Ga0496120_0001243_4910_6001 323
134 3300049569 Ga0501032_0035836 Ga0501032_0035836_1929_3029 323
135 3300049570 Ga0501033_0199573 Ga0501033_0199573_192_1310 323
136 3300049571 Ga0501034_0002149 Ga0501034_0002149_182_1300 323
137 3300049571 Ga0501034_0222182 Ga0501034_0222182_59_1159 323
138 3300049572 Ga0501036_0000840 Ga0501036_0000840_16396_17514 323
139 3300049574 Ga0501038_0000326 Ga0501038_0000326_13299_14399 323
140 3300049574 Ga0501038_0021148 Ga0501038_0021148_1356_2474 323
141 3300049578 Ga0501042_0033496 Ga0501042_0033496_2317_3435 323
142 3300049579 Ga0501043_0021404 Ga0501043_0021404_676_1776 323
143 3300049580 Ga0501046_0129547 Ga0501046_0129547_596_1714 323
144 3300049581 Ga0501047_0006152 Ga0501047_0006152_6704_7804 323
145 3300049581 Ga0501047_0147324 Ga0501047_0147324_440_1558 323
146 3300049582 Ga0501048_0000557 Ga0501048_0000557_23757_24857 323
147 3300049582 Ga0501048_0255598 Ga0501048_0255598_111_1229 323
148 3300049822 Ga0501035_0015862 Ga0501035_0015862_442_1560 323
149 3300049822 Ga0501035_0033158 Ga0501035_0033158_150_1250 323
150 3300049823 Ga0501044_0002652 Ga0501044_0002652_9170_10288 323
151 3300049823 Ga0501044_0028682 Ga0501044_0028682_4560_5660 323
152 3300049823 Ga0501044_0046121 Ga0501044_0046121_1925_3025 323
153 iso_pu_bacteria 2582580736 2583151560 323
154 iso_pu_bacteria 2585427649 2586059480 323
155 iso_pu_bacteria 2731639228 2731905794 323
156 iso_pu_bacteria 2795385472 2795794090 323
157 iso_pu_bacteria 2799112218 2799185261 323
158 iso_pu_bacteria 2867346516 2867349042 323
159 iso_pu_bacteria 2899370129 2899371723 323
160 iso_pu_bacteria 2915768154 2915771786 323
161 iso_pu_bacteria 2917736166 2917741098 323
162 iso_pu_bacteria 8003314358 8003321923 323
163 3300005437 Ga0070710_10034896 Ga0070710_100348962 324
164 3300005467 Ga0070706_100106821 Ga0070706_1001068212 324
165 3300005468 Ga0070707_100003528 Ga0070707_1000035289 324
166 3300025922 Ga0207646_10021135 Ga0207646_100211353 324
167 3300025972 Ga0207668_10152041 Ga0207668_101520412 324
168 3300032002 Ga0307416_100033925 Ga0307416_1000339253 324
169 3300044658 Ga0466972_0005914 Ga0466972_0005914_2148_3257 324
170 3300044684 Ga0466966_0182600 Ga0466966_0182600_61_1152 324
171 3300049570 Ga0501033_0135574 Ga0501033_0135574_65_1177 324
172 iso_pu_bacteria 2855676851 2855679664 324
173 iso_pu_bacteria 2858848962 2858853160 324
174 iso_pu_bacteria 2858888857 2858895480 324
175 iso_pu_bacteria 2858895516 2858901724 324
176 3300005341 Ga0070691_10010652 Ga0070691_100106522 325
177 3300005435 Ga0070714_100004094 Ga0070714_1000040945 325
178 3300005436 Ga0070713_100040946 Ga0070713_1000409464 325
179 3300005445 Ga0070708_100061020 Ga0070708_1000610201 325
180 3300005467 Ga0070706_100067789 Ga0070706_1000677892 325
181 3300005468 Ga0070707_100090076 Ga0070707_1000900762 325
182 3300005471 Ga0070698_100000404 Ga0070698_10000040428 325
183 3300005535 Ga0070684_100292856 Ga0070684_1002928561 325
184 3300005563 Ga0068855_100061210 Ga0068855_1000612106 325
185 3300005617 Ga0068859_100195699 Ga0068859_1001956994 325
186 3300005618 Ga0068864_100097040 Ga0068864_1000970402 325
187 3300005841 Ga0068863_100042179 Ga0068863_1000421794 325
188 3300005842 Ga0068858_100015095 Ga0068858_1000150954 325
189 3300006028 Ga0070717_10117701 Ga0070717_101177012 325
190 3300006173 Ga0070716_100086398 Ga0070716_1000863983 325
191 3300006237 Ga0097621_100098605 Ga0097621_1000986052 325
192 3300006358 Ga0068871_100035032 Ga0068871_1000350322 325
193 3300006931 Ga0097620_100195700 Ga0097620_1001957002 325
194 3300009098 Ga0105245_10003947 Ga0105245_100039474 325
195 3300009098 Ga0105245_10481373 Ga0105245_104813731 325
196 3300009177 Ga0105248_10085854 Ga0105248_100858542 325
197 3300009545 Ga0105237_10051977 Ga0105237_100519773 325
198 3300013104 Ga0157370_10022882 Ga0157370_100228824 325
199 3300013296 Ga0157374_10006442 Ga0157374_100064426 325
200 3300013307 Ga0157372_10354025 Ga0157372_103540251 325
201 3300013308 Ga0157375_10164069 Ga0157375_101640692 325
202 3300013308 Ga0157375_10484100 Ga0157375_104841001 325
203 3300014325 Ga0163163_10006581 Ga0163163_100065817 325
204 3300014969 Ga0157376_10126053 Ga0157376_101260532 325
205 3300020076 Ga0206355_1543145 Ga0206355_15431452 325
206 3300020080 Ga0206350_10371188 Ga0206350_103711882 325
207 3300025915 Ga0207693_10039681 Ga0207693_100396813 325
208 3300025916 Ga0207663_10023908 Ga0207663_100239083 325
209 3300025927 Ga0207687_10063988 Ga0207687_100639883 325
210 3300025927 Ga0207687_10245849 Ga0207687_102458491 325
211 3300025928 Ga0207700_10030991 Ga0207700_100309915 325
212 3300025928 Ga0207700_10108138 Ga0207700_101081382 325
213 3300025929 Ga0207664_10002952 Ga0207664_100029527 325
214 3300025939 Ga0207665_10035709 Ga0207665_100357093 325
215 3300025949 Ga0207667_10067757 Ga0207667_100677573 325
216 3300026035 Ga0207703_10016876 Ga0207703_100168763 325
217 3300026078 Ga0207702_10024639 Ga0207702_100246395 325
218 3300026088 Ga0207641_10114187 Ga0207641_101141873 325
219 3300026095 Ga0207676_10121834 Ga0207676_101218341 325
220 3300031838 Ga0307518_10001495 Ga0307518_100014951 325
221 3300033179 Ga0307507_10060472 Ga0307507_100604722 325
222 3300035086 Ga0373934_0000188 Ga0373934_0000188_8718_9836 325
223 3300035116 Ga0373945_0048890 Ga0373945_0048890_146_1261 325
224 3300035117 Ga0373953_0000066 Ga0373953_0000066_3175_4293 325
225 3300035118 Ga0373954_0024760 Ga0373954_0024760_29_1147 325
226 3300035119 Ga0373956_0000657 Ga0373956_0000657_8268_9386 325
227 3300035120 Ga0373957_0000118 Ga0373957_0000118_1625_2743 325
228 3300035172 Ga0373955_0000007 Ga0373955_0000007_72023_73141 325
229 3300035172 Ga0373955_0172005 Ga0373955_0172005_51_1166 325
230 3300035410 Ga0373924_0002619 Ga0373924_0002619_3545_4663 325
231 3300035724 Ga0373933_0000002 Ga0373933_0000002_135865_136983 325
232 3300036401 Ga0373937_0000014 Ga0373937_0000014_14803_15921 325
233 3300037418 Ga0395900_0036055 Ga0395900_0036055_1879_2988 325
234 3300041453 Ga0451797_1200563 Ga0451797_1200563_363_1481 325
235 3300041498 Ga0451841_0647760 Ga0451841_0647760_970_2088 325
236 3300041509 Ga0451843_0915212 Ga0451843_0915212_233_1351 325
237 3300045976 Ga0466967_0000128 Ga0466967_0000128_20681_21787 325
238 3300046452 Ga0495617_028738 Ga0495617_028738_409_1524 325
239 3300046454 Ga0495592_0000077 Ga0495592_0000077_69917_71035 325
240 3300046455 Ga0495603_0001969 Ga0495603_0001969_1641_2756 325
241 3300046462 Ga0495651_0000019 Ga0495651_0000019_14803_15921 325
242 3300046462 Ga0495651_0205980 Ga0495651_0205980_231_1346 325
243 3300046463 Ga0495653_0001268 Ga0495653_0001268_3619_4737 325
244 3300046472 Ga0495580_0116109 Ga0495580_0116109_90_1205 325
245 3300046499 Ga0495594_0001386 Ga0495594_0001386_2140_3255 325
246 3300046511 Ga0495608_0000028 Ga0495608_0000028_135857_136975 325
247 3300046516 Ga0495628_0001918 Ga0495628_0001918_1333_2451 325
248 3300046529 Ga0495652_0000031 Ga0495652_0000031_135845_136963 325
249 3300046536 Ga0495587_0000023 Ga0495587_0000023_14781_15899 325
250 3300046536 Ga0495587_0007052 Ga0495587_0007052_545_1660 325
251 3300046543 Ga0495645_0028940 Ga0495645_0028940_1535_2650 325
252 3300046557 Ga0495622_0000362 Ga0495622_0000362_9340_10455 325
253 3300046559 Ga0495667_0000913 Ga0495667_0000913_1555_2673 325
254 3300046642 Ga0495634_0060226 Ga0495634_0060226_103_1218 325
255 3300046648 Ga0495611_0005996 Ga0495611_0005996_2523_3638 325
256 3300046663 Ga0495635_0019113 Ga0495635_0019113_2308_3423 325
257 3300046675 Ga0495657_0000022 Ga0495657_0000022_135865_136983 325
258 3300046678 Ga0495599_0000174 Ga0495599_0000174_31805_32923 325
259 3300046678 Ga0495599_0001578 Ga0495599_0001578_10291_11406 325
260 3300046679 Ga0495623_0000199 Ga0495623_0000199_232_1350 325
261 3300046680 Ga0495646_0013984 Ga0495646_0013984_3609_4727 325
262 3300046809 Ga0495600_0024669 Ga0495600_0024669_1434_2552 325
263 3300046809 Ga0495600_0107798 Ga0495600_0107798_133_1248 325
264 3300047317 Ga0495604_0000022 Ga0495604_0000022_135824_136942 325
265 3300047322 Ga0495680_0001555 Ga0495680_0001555_14801_15919 325
266 3300047322 Ga0495680_0027141 Ga0495680_0027141_2350_3465 325
267 3300047443 Ga0495687_001372 Ga0495687_001372_21081_22196 325
268 3300047471 Ga0495684_0025721 Ga0495684_0025721_2031_3146 325
269 3300047673 Ga0495593_0106378 Ga0495593_0106378_52_1167 325
270 3300048088 Ga0495602_0000169 Ga0495602_0000169_14803_15921 325
271 3300048907 Ga0496104_0004728 Ga0496104_0004728_5247_6362 325
272 3300048908 Ga0496105_0002527 Ga0496105_0002527_1711_2826 325
273 3300048909 Ga0496106_0290735 Ga0496106_0290735_89_1204 325
274 3300048911 Ga0496108_0027105 Ga0496108_0027105_2888_4003 325
275 3300048911 Ga0496108_0138541 Ga0496108_0138541_99_1214 325
276 3300048912 Ga0496109_0046609 Ga0496109_0046609_548_1663 325
277 3300048913 Ga0496110_0078688 Ga0496110_0078688_1077_2192 325
278 3300048914 Ga0496111_0030391 Ga0496111_0030391_2025_3140 325
279 3300048915 Ga0496112_0033261 Ga0496112_0033261_2458_3573 325
280 3300048917 Ga0496114_0008040 Ga0496114_0008040_2806_3927 325
281 3300053077 Ga0495601_0042420 Ga0495601_0042420_1377_2492 325
282 3300053084 Ga0495595_0021967 Ga0495595_0021967_435_1553 325
283 3300053084 Ga0495595_0092604 Ga0495595_0092604_86_1201 325
284 3300053085 Ga0495619_0117875 Ga0495619_0117875_575_1690 325
285 iso_pu_bacteria 2808606522 2809591758 325
286 3300046459 Ga0495629_0058147 Ga0495629_0058147_1521_2624 326
287 iso_pu_bacteria 2869048445 2869052483 326
288 3300005329 Ga0070683_100009196 Ga0070683_1000091966 328
289 3300005334 Ga0068869_100002473 Ga0068869_1000024737 328
290 3300005338 Ga0068868_100081834 Ga0068868_1000818342 328
291 3300005344 Ga0070661_100078378 Ga0070661_1000783781 328
292 3300005353 Ga0070669_100037935 Ga0070669_1000379352 328
293 3300005354 Ga0070675_100063065 Ga0070675_1000630652 328
294 3300005366 Ga0070659_100073052 Ga0070659_1000730522 328
295 3300005441 Ga0070700_100079557 Ga0070700_1000795571 328
296 3300005455 Ga0070663_100053637 Ga0070663_1000536372 328
297 3300005456 Ga0070678_100021315 Ga0070678_1000213152 328
298 3300005457 Ga0070662_100012686 Ga0070662_1000126866 328
299 3300005535 Ga0070684_100002401 Ga0070684_1000024015 328
300 3300005543 Ga0070672_100305096 Ga0070672_1003050962 328
301 3300005564 Ga0070664_100005007 Ga0070664_1000050079 328
302 3300005577 Ga0068857_100019695 Ga0068857_1000196955 328
303 3300005615 Ga0070702_100120430 Ga0070702_1001204302 328
304 3300005618 Ga0068864_100059155 Ga0068864_1000591553 328
305 3300005842 Ga0068858_100036987 Ga0068858_1000369874 328
306 3300009094 Ga0111539_10000515 Ga0111539_1000051513 328
307 3300009098 Ga0105245_10009574 Ga0105245_100095749 328
308 3300014745 Ga0157377_10001444 Ga0157377_100014442 328
309 3300025901 Ga0207688_10095199 Ga0207688_100951992 328
310 3300025923 Ga0207681_10031698 Ga0207681_100316984 328
311 3300025926 Ga0207659_10005102 Ga0207659_100051022 328
312 3300025933 Ga0207706_10010490 Ga0207706_100104907 328
313 3300025942 Ga0207689_10011877 Ga0207689_100118778 328
314 3300025944 Ga0207661_10019347 Ga0207661_100193472 328
315 3300025945 Ga0207679_10269156 Ga0207679_102691562 328
316 3300026035 Ga0207703_10242079 Ga0207703_102420792 328
317 3300026067 Ga0207678_10079758 Ga0207678_100797582 328
318 3300026075 Ga0207708_10009002 Ga0207708_100090022 328
319 3300026095 Ga0207676_10045696 Ga0207676_100456963 328
320 3300026116 Ga0207674_10028698 Ga0207674_100286987 328
321 3300026121 Ga0207683_10035637 Ga0207683_100356372 328
322 3300027907 Ga0207428_10053843 Ga0207428_100538432 328
323 3300046683 Ga0495658_0224768 Ga0495658_0224768_29_1156 328
324 3300050511 nmdc:mga08y16_180533_c1 nmdc:mga08y16_180533_c1_799_1824 328
325 iso_pu_bacteria 2772190715 2772642253 328

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01063

Aminotran_4

Amino-transferase class IV

82

335

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ht5-assembly1.cif.gz_A-2 crystal structure of ilve a branched chain amino acid transaminase from mycobacterium tuberculosis 0.959 7 325
5u3f-assembly1.cif.gz_B structure of mycobacterium tuberculosis ilve, a branched-chain amino acid transaminase, in complex with d-cycloserine derivative 0.9589 7 325
5u3f-assembly1.cif.gz_A structure of mycobacterium tuberculosis ilve, a branched-chain amino acid transaminase, in complex with d-cycloserine derivative 0.9582 10 325
3jz6-assembly1.cif.gz_B crystal structure of mycobacterium smegmatis branched chain aminotransferase in complex with pyridoxal-5'-phosphate at 1.9 angstrom. 0.9502 3 325
3jz6-assembly1.cif.gz_B crystal structure of mycobacterium smegmatis branched chain aminotransferase in complex with pyridoxal-5'-phosphate at 1.9 angstrom. 0.9332 3 325
ID Description Score Start End Superfamily
af_Q54N47_13_190_3.30.470.10 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9762 3 141 3.30.470.10
3jz6B01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9757 3 141 3.30.470.10
af_Q2G0M4_6_168_3.30.470.10 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9733 3 141 3.30.470.10
af_P9WQ75_8_180_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9717 3 141 3.90.180.10
af_P54688_42_220_3.30.470.10 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.971 3 141 3.30.470.10
ID Description Score Start End GO Terms
AF-A0A3L7AYZ7-F1-model_v4 deleted 0.9932 13 116
AF-A0A1S6XGX8-F1-model_v4 deleted 0.9891 3 139
AF-A0A352WS16-F1-model_v4 Branched chain amino acid aminotransferase 0.9856 17 136 GO:0004084
GO:0009081
AF-A0A2V6U8L3-F1-model_v4 Branched chain amino acid aminotransferase 0.9828 3 108 GO:0004084
GO:0009081
AF-A0A831JD65-F1-model_v4 deleted 0.9791 3 141

Feature Viewer

pLDDT pTM Quality
83.53 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map