F408141

General Info

Members Datasets Scaffolds Average Seq Length
326 225 652 74

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10146845|Ga0070658_101468452
Length 81
Sequence MGSFSIWHWLIVLVIVLLVFGTKKLKNIGQDLGGAVKGFKDGMKEGSTPDTPVPPASQVTASQGPLGSDKNTIDVEARNKS

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
86 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
135 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
136 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
137 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
138 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
139 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
140 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
143 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
144 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
152 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
153 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
154 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
155 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
156 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
157 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
158 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
167 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
168 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
169 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
184 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
189 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
192 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
199 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
200 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
201 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
213 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
214 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
215 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
216 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
217 2547132512 Azospira oryzae 6a3 Isolate Unclassified
218 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
219 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
220 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
221 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
222 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
223 639633007 Azoarcus olearius BH72 Isolate Unclassified
224 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
225 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.48
Metatranscriptomes 1.84
Isolates 3.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.37
Nodule 0.92
Rhizoplane 1.53
Rhizosphere 91.1
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10146845 3300005327 Bacteria 1972
2 Ga0006778J45830_1034936 3300003162 Bacteria 1145
3 Ga0006777J48905_1039068 3300003308 Bacteria 1069
4 Ga0055534_1001298 3300003784 Bacteria 10117
5 Ga0058860_11909201 3300004801 Bacteria 518
6 Ga0065707_10263648 3300005295 Bacteria 1090
7 Ga0070676_10400491 3300005328 Bacteria 955
8 Ga0070676_11571386 3300005328 Bacteria 508
9 Ga0070683_100360918 3300005329 Bacteria 1384
10 Ga0070670_100011770 3300005331 Bacteria 7483
11 Ga0070670_101693806 3300005331 Bacteria 582
12 Ga0068869_100274878 3300005334 Bacteria 1353
13 Ga0070660_101166144 3300005339 Bacteria 653
14 Ga0070661_100458124 3300005344 Bacteria 1015
15 Ga0070661_100516271 3300005344 Bacteria 958
16 Ga0070668_100693465 3300005347 Bacteria 898
17 Ga0070669_100089884 3300005353 Bacteria 2301
18 Ga0070669_100202719 3300005353 Bacteria 1562
19 Ga0070669_101500279 3300005353 Bacteria 586
20 Ga0070675_100010632 3300005354 Bacteria 7193
21 Ga0070675_100326642 3300005354 Bacteria 1356
22 Ga0070671_100263780 3300005355 Bacteria 1464
23 Ga0070674_100305587 3300005356 Bacteria 1269
24 Ga0070673_100025252 3300005364 Bacteria 4370
25 Ga0070688_100765411 3300005365 Bacteria 753
26 Ga0070688_100796494 3300005365 Bacteria 739
27 Ga0070659_100084316 3300005366 Bacteria 2541
28 Ga0070667_100745198 3300005367 Bacteria 908
29 Ga0070714_100545081 3300005435 Bacteria 1110
30 Ga0070701_10629128 3300005438 Bacteria 714
31 Ga0070711_101716601 3300005439 Bacteria 550
32 Ga0070705_100254115 3300005440 Bacteria 1235
33 Ga0070700_101698508 3300005441 Bacteria 542
34 Ga0070708_100000226 3300005445 Bacteria 42003
35 Ga0070708_101037528 3300005445 Bacteria 768
36 Ga0070708_101037531 3300005445 Bacteria 768
37 Ga0070663_100230289 3300005455 Bacteria 1459
38 Ga0070663_101999197 3300005455 Bacteria 522
39 Ga0070678_100764738 3300005456 Bacteria 875
40 Ga0070678_102064813 3300005456 Bacteria 540
41 Ga0070662_100136388 3300005457 Bacteria 1898
42 Ga0070662_100514087 3300005457 Bacteria 1000
43 Ga0070681_10296445 3300005458 Bacteria 1527
44 Ga0068867_100000081 3300005459 Bacteria 59361
45 Ga0070685_10061469 3300005466 Bacteria 2200
46 Ga0070706_100158471 3300005467 Bacteria 2113
47 Ga0070707_100798558 3300005468 Bacteria 907
48 Ga0070698_100077819 3300005471 Bacteria 3316
49 Ga0070699_100436821 3300005518 Bacteria 1186
50 Ga0070699_100525081 3300005518 Bacteria 1076
51 Ga0070679_100432673 3300005530 Bacteria 1261
52 Ga0070697_100097670 3300005536 Bacteria 2437
53 Ga0068853_100291074 3300005539 Bacteria 1508
54 Ga0068853_101073968 3300005539 Bacteria 776
55 Ga0070686_101377649 3300005544 Bacteria 591
56 Ga0070696_100376259 3300005546 Bacteria 1106
57 Ga0070693_101300852 3300005547 Bacteria 562
58 Ga0070665_100701686 3300005548 Bacteria 1025
59 Ga0070665_102400769 3300005548 Bacteria 530
60 Ga0068855_100012627 3300005563 Bacteria 10193
61 Ga0068855_100668001 3300005563 Bacteria 1114
62 Ga0070664_101327303 3300005564 Bacteria 679
63 Ga0068852_100005075 3300005616 Bacteria 9367
64 Ga0068852_101549710 3300005616 Bacteria 685
65 Ga0068859_100080873 3300005617 Bacteria 3291
66 Ga0068859_100273662 3300005617 Bacteria 1781
67 Ga0068859_101603461 3300005617 Bacteria 719
68 Ga0068864_100044453 3300005618 Bacteria 3807
69 Ga0068864_100049509 3300005618 Bacteria 3615
70 Ga0068864_102330186 3300005618 Bacteria 542
71 Ga0068861_100119639 3300005719 Bacteria 2122
72 Ga0068861_100299736 3300005719 Bacteria 1392
73 Ga0068863_100658930 3300005841 Bacteria 1038
74 Ga0068863_102596109 3300005841 Bacteria 516
75 Ga0068858_100706928 3300005842 Bacteria 981
76 Ga0068858_100926029 3300005842 Bacteria 853
77 Ga0068862_100051766 3300005844 Bacteria 3512
78 Ga0075364_10043655 3300006051 Bacteria 2915
79 Ga0070716_100183937 3300006173 Bacteria 1375
80 Ga0070716_100234705 3300006173 Bacteria 1240
81 Ga0097621_100010473 3300006237 Bacteria 6789
82 Ga0075370_10124227 3300006353 Bacteria 1504
83 Ga0075370_10825258 3300006353 Bacteria 566
84 Ga0068871_100011074 3300006358 Bacteria 6610
85 Ga0075430_100686006 3300006846 Bacteria 844
86 Ga0075433_10353006 3300006852 Bacteria 1299
87 Ga0075434_100122016 3300006871 Bacteria 2622
88 Ga0075434_101470115 3300006871 Bacteria 691
89 Ga0075429_101893427 3300006880 Bacteria 517
90 Ga0068865_101007369 3300006881 Bacteria 730
91 Ga0075436_100079846 3300006914 Bacteria 2267
92 Ga0097620_100080874 3300006931 Bacteria 3291
93 Ga0097620_100273688 3300006931 Bacteria 1781
94 Ga0097620_101603567 3300006931 Bacteria 719
95 Ga0075435_100228606 3300007076 Bacteria 1580
96 Ga0105244_10530797 3300009036 Bacteria 542
97 Ga0105240_10058567 3300009093 Bacteria 4809
98 Ga0105240_11737417 3300009093 Bacteria 651
99 Ga0111539_12373362 3300009094 Bacteria 615
100 Ga0105245_12456605 3300009098 Bacteria 574
101 Ga0114129_10478208 3300009147 Bacteria 1630
102 Ga0105243_10011388 3300009148 Bacteria 6730
103 Ga0105243_11990418 3300009148 Bacteria 615
104 Ga0105249_11503362 3300009553 Bacteria 746
105 Ga0157370_10012771 3300013104 Bacteria 8686
106 Ga0157370_10031651 3300013104 Bacteria 5173
107 Ga0157369_10324471 3300013105 Bacteria 1600
108 Ga0157369_11198347 3300013105 Bacteria 775
109 Ga0157378_10082403 3300013297 Bacteria 2909
110 Ga0157378_11279908 3300013297 Bacteria 774
111 Ga0163162_10366330 3300013306 Bacteria 1574
112 Ga0157372_10064414 3300013307 Bacteria 4113
113 Ga0157372_10324849 3300013307 Bacteria 1791
114 Ga0157372_10898457 3300013307 Bacteria 1028
115 Ga0157375_11217085 3300013308 Bacteria 884
116 Ga0157380_13482030 3300014326 Bacteria 504
117 Ga0157377_10000032 3300014745 Bacteria 121003
118 Ga0163161_11372185 3300017792 Bacteria 616
119 Ga0206350_11257078 3300020080 Bacteria 596
120 Ga0206353_10823655 3300020082 Bacteria 700
121 Ga0213872_10004111 3300021361 Bacteria 7831
122 Ga0213872_10019614 3300021361 Bacteria 3114
123 Ga0209025_1056270 3300025294 Bacteria 1514
124 Ga0209564_1054424 3300025295 Bacteria 945
125 Ga0207656_10333447 3300025321 Bacteria 755
126 Ga0207682_10024574 3300025893 Bacteria 2386
127 Ga0207680_10141527 3300025903 Bacteria 1595
128 Ga0207645_10112025 3300025907 Bacteria 1767
129 Ga0207705_10119461 3300025909 Bacteria 1955
130 Ga0207705_10538983 3300025909 Bacteria 907
131 Ga0207707_10140250 3300025912 Bacteria 2114
132 Ga0207695_10085949 3300025913 Bacteria 3173
133 Ga0207657_10036278 3300025919 Bacteria 4414
134 Ga0207657_10585255 3300025919 Bacteria 871
135 Ga0207652_10223941 3300025921 Bacteria 1695
136 Ga0207646_10090285 3300025922 Bacteria 2742
137 Ga0207650_10012179 3300025925 Bacteria 5930
138 Ga0207650_10090124 3300025925 Bacteria 2341
139 Ga0207650_10586457 3300025925 Bacteria 936
140 Ga0207659_10037116 3300025926 Bacteria 3381
141 Ga0207659_10100804 3300025926 Bacteria 2176
142 Ga0207664_10771265 3300025929 Bacteria 865
143 Ga0207644_10042278 3300025931 Bacteria 3229
144 Ga0207644_10308668 3300025931 Bacteria 1277
145 Ga0207690_10326887 3300025932 Bacteria 1207
146 Ga0207706_10051181 3300025933 Bacteria 3648
147 Ga0207706_10303754 3300025933 Bacteria 1390
148 Ga0207686_11751200 3300025934 Bacteria 514
149 Ga0207709_10002313 3300025935 Bacteria 12063
150 Ga0207670_10654679 3300025936 Bacteria 866
151 Ga0207669_11636525 3300025937 Bacteria 550
152 Ga0207704_11347167 3300025938 Bacteria 611
153 Ga0207665_10017348 3300025939 Bacteria 4731
154 Ga0207665_10091775 3300025939 Bacteria 2106
155 Ga0207691_10123484 3300025940 Bacteria 2292
156 Ga0207689_11002253 3300025942 Bacteria 705
157 Ga0207689_11643283 3300025942 Bacteria 534
158 Ga0207661_11993568 3300025944 Bacteria 526
159 Ga0207679_10118583 3300025945 Bacteria 2102
160 Ga0207667_10073564 3300025949 Bacteria 3551
161 Ga0207651_10010272 3300025960 Bacteria 5180
162 Ga0207651_11045066 3300025960 Bacteria 731
163 Ga0207668_10189731 3300025972 Bacteria 1628
164 Ga0207640_10693974 3300025981 Bacteria 872
165 Ga0207658_10514425 3300025986 Bacteria 1068
166 Ga0207677_10222356 3300026023 Bacteria 1515
167 Ga0207703_10279069 3300026035 Bacteria 1517
168 Ga0207703_10470615 3300026035 Bacteria 1176
169 Ga0207639_10829979 3300026041 Bacteria 862
170 Ga0207639_10917148 3300026041 Bacteria 819
171 Ga0207639_11371004 3300026041 Bacteria 664
172 Ga0207678_10098624 3300026067 Bacteria 2496
173 Ga0207641_10031678 3300026088 Bacteria 4386
174 Ga0207641_10076543 3300026088 Bacteria 2893
175 Ga0207648_10001296 3300026089 Bacteria 27908
176 Ga0207648_10863892 3300026089 Bacteria 844
177 Ga0207676_10131699 3300026095 Bacteria 2127
178 Ga0207676_10926863 3300026095 Bacteria 855
179 Ga0207676_11217783 3300026095 Bacteria 746
180 Ga0207675_100074444 3300026118 Bacteria 3178
181 Ga0207683_10050131 3300026121 Bacteria 3656
182 Ga0207683_10830606 3300026121 Bacteria 858
183 Ga0207698_10197954 3300026142 Bacteria 1796
184 Ga0207698_11959515 3300026142 Bacteria 600
185 Ga0209984_1002562 3300027424 Bacteria 2039
186 Ga0209999_1054351 3300027543 Bacteria 759
187 Ga0209983_1098728 3300027665 Bacteria 661
188 Ga0268266_10103838 3300028379 Bacteria 2509
189 Ga0268266_10556942 3300028379 Bacteria 1099
190 Ga0268266_11529550 3300028379 Bacteria 643
191 Ga0268266_11839702 3300028379 Bacteria 580
192 Ga0268265_10030225 3300028380 Bacteria 3898
193 Ga0265323_10050059 3300028653 Bacteria 1486
194 Ga0265338_10003131 3300028800 Bacteria 23632
195 Ga0265338_10155636 3300028800 Bacteria 1771
196 Ga0265324_10000147 3300029957 Bacteria 54400
197 Ga0265324_10008018 3300029957 Bacteria 4232
198 Ga0265332_10061753 3300031238 Bacteria 1602
199 Ga0265325_10025102 3300031241 Bacteria 3238
200 Ga0265325_10110727 3300031241 Bacteria 1335
201 Ga0265340_10359407 3300031247 Bacteria 643
202 Ga0265316_10032721 3300031344 Bacteria 4242
203 Ga0307408_100518879 3300031548 Bacteria 1046
204 Ga0265314_10000451 3300031711 Bacteria 54865
205 Ga0265314_10030723 3300031711 Bacteria 3973
206 Ga0265314_10033689 3300031711 Bacteria 3751
207 Ga0265314_10276472 3300031711 Bacteria 952
208 Ga0265314_10282418 3300031711 Bacteria 938
209 Ga0265342_10185236 3300031712 Bacteria 1138
210 Ga0307516_10475268 3300031730 Bacteria 905
211 Ga0307410_10341756 3300031852 Bacteria 1193
212 Ga0307409_100162568 3300031995 Bacteria 1955
213 Ga0373931_1150112 3300035691 Bacteria 530
214 Ga0395900_0052858 3300037418 Bacteria 4182
215 Ga0395900_1495458 3300037418 Bacteria 587
216 Ga0395905_0097950 3300037471 Bacteria 2753
217 Ga0395905_0520654 3300037471 Bacteria 1090
218 Ga0395901_0257769 3300038443 Bacteria 1816
219 Ga0395901_1317879 3300038443 Bacteria 683
220 Ga0436361_0675274 3300039447 Bacteria 5014
221 Ga0436361_0921278 3300039447 Bacteria 22626
222 Ga0451847_0131925 3300041503 Bacteria 528
223 Ga0451853_0296915 3300041512 Bacteria 683
224 Ga0451577_0053325 3300042876 Bacteria 3610
225 Ga0451577_0324509 3300042876 Bacteria 1396
226 Ga0451577_0963324 3300042876 Bacteria 767
227 Ga0451577_0969502 3300042876 Bacteria 764
228 Ga0453683_0021663 3300044673 Bacteria 4101
229 Ga0453683_0125074 3300044673 Bacteria 1619
230 Ga0453683_0429000 3300044673 Bacteria 854
231 Ga0466966_0067676 3300044684 Bacteria 2243
232 Ga0466966_0180066 3300044684 Bacteria 1282
233 Ga0466961_0026415 3300044693 Bacteria 3733
234 Ga0466961_0963536 3300044693 Bacteria 507
235 Ga0466963_0288445 3300044694 Bacteria 1154
236 Ga0466963_0365678 3300044694 Bacteria 1016
237 Ga0453684_0000029 3300044712 Bacteria 757969
238 Ga0453684_0001609 3300044712 Bacteria 62038
239 Ga0453684_0006657 3300044712 Bacteria 21817
240 Ga0453684_0015507 3300044712 Bacteria 12038
241 Ga0453684_0085887 3300044712 Bacteria 3908
242 Ga0453684_0597608 3300044712 Bacteria 1210
243 Ga0453684_0636427 3300044712 Bacteria 1165
244 Ga0453684_2180375 3300044712 Bacteria 554
245 Ga0466970_0612786 3300044765 Bacteria 632
246 Ga0466957_0061317 3300044842 Bacteria 2308
247 Ga0466957_0143293 3300044842 Bacteria 1541
248 Ga0466957_0164873 3300044842 Bacteria 1441
249 Ga0466959_0531712 3300045049 Bacteria 794
250 Ga0466959_0533338 3300045049 Bacteria 792
251 Ga0451576_0137971 3300045051 Bacteria 2543
252 Ga0451576_0183089 3300045051 Bacteria 2187
253 Ga0451576_1137674 3300045051 Bacteria 816
254 Ga0451576_1986313 3300045051 Bacteria 599
255 Ga0466958_0083317 3300045836 Bacteria 1971
256 Ga0466967_0280760 3300045976 Bacteria 1598
257 Ga0466967_1203770 3300045976 Bacteria 755
258 Ga0466967_1428776 3300045976 Bacteria 689
259 Ga0466967_1711315 3300045976 Bacteria 626
260 Ga0495582_0599872 3300046473 Bacteria 637
261 Ga0495594_0472150 3300046499 Bacteria 713
262 Ga0495598_0332802 3300046537 Bacteria 581
263 Ga0495621_0017832 3300046539 Bacteria 2300
264 Ga0495658_0540356 3300046683 Bacteria 746
265 Ga0496104_0157264 3300048907 Bacteria 2181
266 Ga0496106_1494441 3300048909 Bacteria 520
267 Ga0496108_0396003 3300048911 Bacteria 1206
268 Ga0496111_0585145 3300048914 Bacteria 818
269 Ga0496112_0537312 3300048915 Bacteria 1103
270 Ga0501031_0496025 3300049568 Bacteria 788
271 Ga0501031_0606314 3300049568 Bacteria 704
272 Ga0501034_0312056 3300049571 Bacteria 1507
273 Ga0501037_0802374 3300049573 Bacteria 621
274 Ga0501039_0802117 3300049575 Bacteria 734
275 Ga0501046_0259631 3300049580 Bacteria 1277
276 Ga0501047_0002329 3300049581 Bacteria 18145
277 Ga0501047_0088318 3300049581 Bacteria 2977
278 Ga0501047_0672137 3300049581 Bacteria 854
279 Ga0501048_0502979 3300049582 Bacteria 869
280 Ga0501067_0077335 3300049583 Bacteria 1844
281 Ga0501068_0087333 3300049584 Bacteria 1920
282 Ga0501069_0002241 3300049585 Bacteria 9745
283 Ga0501070_0027498 3300049586 Bacteria 4771
284 Ga0501073_0022106 3300049589 Bacteria 4583
285 Ga0501074_0004392 3300049590 Bacteria 10078
286 Ga0501075_1097999 3300049591 Bacteria 604
287 Ga0501076_0147110 3300049592 Bacteria 1916
288 Ga0501198_000012 3300049649 Bacteria 113529
289 Ga0501222_000010 3300049662 Bacteria 113536
290 Ga0501079_0013000 3300049741 Bacteria 6350
291 Ga0501080_0036957 3300049742 Bacteria 4559
292 Ga0501083_0019475 3300049744 Bacteria 4727
293 Ga0501035_0103017 3300049822 Bacteria 2504
294 Ga0501035_0125637 3300049822 Bacteria 2239
295 Ga0501044_0129735 3300049823 Bacteria 2516
296 Ga0501044_0268127 3300049823 Bacteria 1644
297 nmdc:mga00v17_30220_c1 3300050491 Bacteria 3186
298 nmdc:mga0k408_33581_c1 3300050493 Bacteria 2935
299 nmdc:mga06z11_181668_c1 3300050494 Bacteria 1213
300 nmdc:mga07m45_108489_c1 3300050496 Bacteria 1597
301 nmdc:mga07m45_737386_c1 3300050496 Bacteria 566
302 nmdc:mga05p37_393809_c1 3300050507 Bacteria 1619
303 nmdc:mga0qj67_254775_c1 3300050509 Bacteria 1424
304 nmdc:mga08y16_352913_c1 3300050511 Bacteria 1510
305 nmdc:mga0n895_103117_c1 3300050512 Bacteria 2864
306 nmdc:mga0rr50_160599_c1 3300050513 Bacteria 1824
307 nmdc:mga08x19_62401_c1 3300050514 Bacteria 2416
308 nmdc:mga0a205_332555_c1 3300050515 Bacteria 1389
309 Ga0501084_0299677 3300054114 Bacteria 1358
310 Ga0587111_0206013 3300060346 Bacteria 560
311 Ga0501082_0046518 3300060353 Bacteria 3740
312 Ga0501082_0350182 3300060353 Bacteria 1288
313 Ga0466962_0496963 3300061719 Bacteria 617
314 Ga0530510_0564402 3300061734 Bacteria 865
315 2513956670 2513237150 Bacteria 6553639
316 2514044500 2513237165 Bacteria 6771773
317 2526211230 2526164512 Bacteria 4025691
318 2548848692 2547132512 Bacteria 3416496
319 2574430158 2574179768 Bacteria 4907129
320 2834642548 2834641062 Bacteria 5559922
321 2881103414 2881101125 Bacteria 4590519
322 2891635457 2891633521 Bacteria 4602265
323 2901303975 2901300506 Bacteria 8463898
324 639788502 639633007 Bacteria 4376040
325 644749181 644736347 Bacteria 6476522
326 8003402218 8003400568 Bacteria 5535898
327 Ga0070658_10146845
328 Ga0006778J45830_1034936
329 Ga0006777J48905_1039068
330 Ga0055534_1001298
331 Ga0058860_11909201
332 Ga0065707_10263648
333 Ga0070676_10400491
334 Ga0070676_11571386
335 Ga0070683_100360918
336 Ga0070670_100011770
337 Ga0070670_101693806
338 Ga0068869_100274878
339 Ga0070660_101166144
340 Ga0070661_100458124
341 Ga0070661_100516271
342 Ga0070668_100693465
343 Ga0070669_100089884
344 Ga0070669_100202719
345 Ga0070669_101500279
346 Ga0070675_100010632
347 Ga0070675_100326642
348 Ga0070671_100263780
349 Ga0070674_100305587
350 Ga0070673_100025252
351 Ga0070688_100765411
352 Ga0070688_100796494
353 Ga0070659_100084316
354 Ga0070667_100745198
355 Ga0070714_100545081
356 Ga0070701_10629128
357 Ga0070711_101716601
358 Ga0070705_100254115
359 Ga0070700_101698508
360 Ga0070708_100000226
361 Ga0070708_101037528
362 Ga0070708_101037531
363 Ga0070663_100230289
364 Ga0070663_101999197
365 Ga0070678_100764738
366 Ga0070678_102064813
367 Ga0070662_100136388
368 Ga0070662_100514087
369 Ga0070681_10296445
370 Ga0068867_100000081
371 Ga0070685_10061469
372 Ga0070706_100158471
373 Ga0070707_100798558
374 Ga0070698_100077819
375 Ga0070699_100436821
376 Ga0070699_100525081
377 Ga0070679_100432673
378 Ga0070697_100097670
379 Ga0068853_100291074
380 Ga0068853_101073968
381 Ga0070686_101377649
382 Ga0070696_100376259
383 Ga0070693_101300852
384 Ga0070665_100701686
385 Ga0070665_102400769
386 Ga0068855_100012627
387 Ga0068855_100668001
388 Ga0070664_101327303
389 Ga0068852_100005075
390 Ga0068852_101549710
391 Ga0068859_100080873
392 Ga0068859_100273662
393 Ga0068859_101603461
394 Ga0068864_100044453
395 Ga0068864_100049509
396 Ga0068864_102330186
397 Ga0068861_100119639
398 Ga0068861_100299736
399 Ga0068863_100658930
400 Ga0068863_102596109
401 Ga0068858_100706928
402 Ga0068858_100926029
403 Ga0068862_100051766
404 Ga0075364_10043655
405 Ga0070716_100183937
406 Ga0070716_100234705
407 Ga0097621_100010473
408 Ga0075370_10124227
409 Ga0075370_10825258
410 Ga0068871_100011074
411 Ga0075430_100686006
412 Ga0075433_10353006
413 Ga0075434_100122016
414 Ga0075434_101470115
415 Ga0075429_101893427
416 Ga0068865_101007369
417 Ga0075436_100079846
418 Ga0097620_100080874
419 Ga0097620_100273688
420 Ga0097620_101603567
421 Ga0075435_100228606
422 Ga0105244_10530797
423 Ga0105240_10058567
424 Ga0105240_11737417
425 Ga0111539_12373362
426 Ga0105245_12456605
427 Ga0114129_10478208
428 Ga0105243_10011388
429 Ga0105243_11990418
430 Ga0105249_11503362
431 Ga0157370_10012771
432 Ga0157370_10031651
433 Ga0157369_10324471
434 Ga0157369_11198347
435 Ga0157378_10082403
436 Ga0157378_11279908
437 Ga0163162_10366330
438 Ga0157372_10064414
439 Ga0157372_10324849
440 Ga0157372_10898457
441 Ga0157375_11217085
442 Ga0157380_13482030
443 Ga0157377_10000032
444 Ga0163161_11372185
445 Ga0206350_11257078
446 Ga0206353_10823655
447 Ga0213872_10004111
448 Ga0213872_10019614
449 Ga0209025_1056270
450 Ga0209564_1054424
451 Ga0207656_10333447
452 Ga0207682_10024574
453 Ga0207680_10141527
454 Ga0207645_10112025
455 Ga0207705_10119461
456 Ga0207705_10538983
457 Ga0207707_10140250
458 Ga0207695_10085949
459 Ga0207657_10036278
460 Ga0207657_10585255
461 Ga0207652_10223941
462 Ga0207646_10090285
463 Ga0207650_10012179
464 Ga0207650_10090124
465 Ga0207650_10586457
466 Ga0207659_10037116
467 Ga0207659_10100804
468 Ga0207664_10771265
469 Ga0207644_10042278
470 Ga0207644_10308668
471 Ga0207690_10326887
472 Ga0207706_10051181
473 Ga0207706_10303754
474 Ga0207686_11751200
475 Ga0207709_10002313
476 Ga0207670_10654679
477 Ga0207669_11636525
478 Ga0207704_11347167
479 Ga0207665_10017348
480 Ga0207665_10091775
481 Ga0207691_10123484
482 Ga0207689_11002253
483 Ga0207689_11643283
484 Ga0207661_11993568
485 Ga0207679_10118583
486 Ga0207667_10073564
487 Ga0207651_10010272
488 Ga0207651_11045066
489 Ga0207668_10189731
490 Ga0207640_10693974
491 Ga0207658_10514425
492 Ga0207677_10222356
493 Ga0207703_10279069
494 Ga0207703_10470615
495 Ga0207639_10829979
496 Ga0207639_10917148
497 Ga0207639_11371004
498 Ga0207678_10098624
499 Ga0207641_10031678
500 Ga0207641_10076543
501 Ga0207648_10001296
502 Ga0207648_10863892
503 Ga0207676_10131699
504 Ga0207676_10926863
505 Ga0207676_11217783
506 Ga0207675_100074444
507 Ga0207683_10050131
508 Ga0207683_10830606
509 Ga0207698_10197954
510 Ga0207698_11959515
511 Ga0209984_1002562
512 Ga0209999_1054351
513 Ga0209983_1098728
514 Ga0268266_10103838
515 Ga0268266_10556942
516 Ga0268266_11529550
517 Ga0268266_11839702
518 Ga0268265_10030225
519 Ga0265323_10050059
520 Ga0265338_10003131
521 Ga0265338_10155636
522 Ga0265324_10000147
523 Ga0265324_10008018
524 Ga0265332_10061753
525 Ga0265325_10025102
526 Ga0265325_10110727
527 Ga0265340_10359407
528 Ga0265316_10032721
529 Ga0307408_100518879
530 Ga0265314_10000451
531 Ga0265314_10030723
532 Ga0265314_10033689
533 Ga0265314_10276472
534 Ga0265314_10282418
535 Ga0265342_10185236
536 Ga0307516_10475268
537 Ga0307410_10341756
538 Ga0307409_100162568
539 Ga0373931_1150112
540 Ga0395900_0052858
541 Ga0395900_1495458
542 Ga0395905_0097950
543 Ga0395905_0520654
544 Ga0395901_0257769
545 Ga0395901_1317879
546 Ga0436361_0675274
547 Ga0436361_0921278
548 Ga0451847_0131925
549 Ga0451853_0296915
550 Ga0451577_0053325
551 Ga0451577_0324509
552 Ga0451577_0963324
553 Ga0451577_0969502
554 Ga0453683_0021663
555 Ga0453683_0125074
556 Ga0453683_0429000
557 Ga0466966_0067676
558 Ga0466966_0180066
559 Ga0466961_0026415
560 Ga0466961_0963536
561 Ga0466963_0288445
562 Ga0466963_0365678
563 Ga0453684_0000029
564 Ga0453684_0001609
565 Ga0453684_0006657
566 Ga0453684_0015507
567 Ga0453684_0085887
568 Ga0453684_0597608
569 Ga0453684_0636427
570 Ga0453684_2180375
571 Ga0466970_0612786
572 Ga0466957_0061317
573 Ga0466957_0143293
574 Ga0466957_0164873
575 Ga0466959_0531712
576 Ga0466959_0533338
577 Ga0451576_0137971
578 Ga0451576_0183089
579 Ga0451576_1137674
580 Ga0451576_1986313
581 Ga0466958_0083317
582 Ga0466967_0280760
583 Ga0466967_1203770
584 Ga0466967_1428776
585 Ga0466967_1711315
586 Ga0495582_0599872
587 Ga0495594_0472150
588 Ga0495598_0332802
589 Ga0495621_0017832
590 Ga0495658_0540356
591 Ga0496104_0157264
592 Ga0496106_1494441
593 Ga0496108_0396003
594 Ga0496111_0585145
595 Ga0496112_0537312
596 Ga0501031_0496025
597 Ga0501031_0606314
598 Ga0501034_0312056
599 Ga0501037_0802374
600 Ga0501039_0802117
601 Ga0501046_0259631
602 Ga0501047_0002329
603 Ga0501047_0088318
604 Ga0501047_0672137
605 Ga0501048_0502979
606 Ga0501067_0077335
607 Ga0501068_0087333
608 Ga0501069_0002241
609 Ga0501070_0027498
610 Ga0501073_0022106
611 Ga0501074_0004392
612 Ga0501075_1097999
613 Ga0501076_0147110
614 Ga0501198_000012
615 Ga0501222_000010
616 Ga0501079_0013000
617 Ga0501080_0036957
618 Ga0501083_0019475
619 Ga0501035_0103017
620 Ga0501035_0125637
621 Ga0501044_0129735
622 Ga0501044_0268127
623 nmdc:mga00v17_30220_c1
624 nmdc:mga0k408_33581_c1
625 nmdc:mga06z11_181668_c1
626 nmdc:mga07m45_108489_c1
627 nmdc:mga07m45_737386_c1
628 nmdc:mga05p37_393809_c1
629 nmdc:mga0qj67_254775_c1
630 nmdc:mga08y16_352913_c1
631 nmdc:mga0n895_103117_c1
632 nmdc:mga0rr50_160599_c1
633 nmdc:mga08x19_62401_c1
634 nmdc:mga0a205_332555_c1
635 Ga0501084_0299677
636 Ga0587111_0206013
637 Ga0501082_0046518
638 Ga0501082_0350182
639 Ga0466962_0496963
640 Ga0530510_0564402
641 2513956670
642 2514044500
643 2526211230
644 2548848692
645 2574430158
646 2834642548
647 2881103414
648 2891635457
649 2901303975
650 639788502
651 644749181
652 8003402218

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02416

TatA_B_E

mttA/Hcf106 family

4

53

0.94

Map