F408142

General Info

Members Datasets Scaffolds Average Seq Length
326 184 652 212

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10190935|Ga0070658_101909352
Length 214
Sequence MVDERRFYEAQHMGERRSAPAATRNREPIAEVLREWLPPAGVVLEIASGTGEHVLYFAERFPNLDWQPSDIHPDALASIAAWRSESAPNNVLCPLGLDAASDRWPVDRADAVLSINMVHISPWQSALGLIAGASRLLAPEAPLILYGPWFEAGVEPAASNLAFDADLKRRDPEWGLRTVEDFAAAAAPGFSLCERRTMPANNLMLLFRRTATAR

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
135 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
136 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
137 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
138 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
139 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
140 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
151 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
163 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
164 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
165 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
166 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
167 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
168 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
169 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
170 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
171 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
172 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
173 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
174 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
175 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
176 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.53
Rhizosphere 98.47
Stem 0
Stem Tuber 0
Unclassified 3.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10190935 3300005327 Bacteria 1726
2 JGI24740J21852_10047252 3300001979 Bacteria 1258
3 JGI24735J21928_10036475 3300002067 Bacteria 1442
4 Ga0070658_10064736 3300005327 Bacteria 2982
5 Ga0070658_10299761 3300005327 Bacteria 1370
6 Ga0070658_10345298 3300005327 Bacteria 1273
7 Ga0070658_10692470 3300005327 Unclassified 884
8 Ga0070658_10825462 3300005327 Bacteria 805
9 Ga0070690_100483438 3300005330 Bacteria 923
10 Ga0070670_100006874 3300005331 Bacteria 9639
11 Ga0070666_10006666 3300005335 Bacteria 7102
12 Ga0070666_10117152 3300005335 Bacteria 1845
13 Ga0070680_100010796 3300005336 Bacteria 7051
14 Ga0070680_100398758 3300005336 Bacteria 1173
15 Ga0070680_100402788 3300005336 Bacteria 1166
16 Ga0070682_100038426 3300005337 Bacteria 2936
17 Ga0070682_100206827 3300005337 Bacteria 1388
18 Ga0068868_100001134 3300005338 Bacteria 18218
19 Ga0068868_100286977 3300005338 Bacteria 1394
20 Ga0070660_100008713 3300005339 Bacteria 7101
21 Ga0070660_100036771 3300005339 Bacteria 3710
22 Ga0070660_100226822 3300005339 Bacteria 1519
23 Ga0070660_100259918 3300005339 Bacteria 1417
24 Ga0070689_100027928 3300005340 Bacteria 4260
25 Ga0070689_100141497 3300005340 Bacteria 1935
26 Ga0070691_10260411 3300005341 Bacteria 933
27 Ga0070687_100017890 3300005343 Bacteria 3269
28 Ga0070661_100040201 3300005344 Bacteria 3411
29 Ga0070661_100135461 3300005344 Bacteria 1853
30 Ga0070661_100221411 3300005344 Bacteria 1452
31 Ga0070661_100287991 3300005344 Unclassified 1276
32 Ga0070661_100302272 3300005344 Bacteria 1246
33 Ga0070692_10469252 3300005345 Bacteria 809
34 Ga0070671_100001855 3300005355 Bacteria 16117
35 Ga0070674_100024515 3300005356 Bacteria 3916
36 Ga0070673_100009612 3300005364 Bacteria 6501
37 Ga0070673_100041727 3300005364 Bacteria 3532
38 Ga0070659_100021046 3300005366 Bacteria 4961
39 Ga0070659_100047040 3300005366 Bacteria 3383
40 Ga0070659_100083527 3300005366 Bacteria 2553
41 Ga0070659_100616081 3300005366 Bacteria 934
42 Ga0070667_100019601 3300005367 Bacteria 5612
43 Ga0070703_10194049 3300005406 Bacteria 793
44 Ga0070714_100024075 3300005435 Bacteria 5009
45 Ga0070713_100107749 3300005436 Bacteria 2425
46 Ga0070701_10026057 3300005438 Bacteria 2846
47 Ga0070705_100440950 3300005440 Bacteria 974
48 Ga0070663_100021227 3300005455 Bacteria 4315
49 Ga0070663_100040107 3300005455 Bacteria 3276
50 Ga0070663_100172070 3300005455 Bacteria 1675
51 Ga0070662_100010801 3300005457 Bacteria 6013
52 Ga0070662_100197031 3300005457 Bacteria 1596
53 Ga0070681_10007382 3300005458 Bacteria 10745
54 Ga0070681_10016464 3300005458 Bacteria 7382
55 Ga0070681_10360001 3300005458 Bacteria 1365
56 Ga0068867_100032060 3300005459 Bacteria 3797
57 Ga0070707_100693664 3300005468 Bacteria 981
58 Ga0070679_100031193 3300005530 Bacteria 5265
59 Ga0070679_100114833 3300005530 Bacteria 2678
60 Ga0070679_100131063 3300005530 Bacteria 2489
61 Ga0070679_100136079 3300005530 Unclassified 2438
62 Ga0070679_100246319 3300005530 Bacteria 1744
63 Ga0070684_100113622 3300005535 Bacteria 2430
64 Ga0068853_100015024 3300005539 Bacteria 6361
65 Ga0068853_100079930 3300005539 Bacteria 2860
66 Ga0070686_100086600 3300005544 Bacteria 2086
67 Ga0070686_100110424 3300005544 Bacteria 1872
68 Ga0070695_100064884 3300005545 Bacteria 2376
69 Ga0070696_100064394 3300005546 Bacteria 2568
70 Ga0070693_100034766 3300005547 Bacteria 2790
71 Ga0070693_100087174 3300005547 Bacteria 1874
72 Ga0070693_100134783 3300005547 Bacteria 1548
73 Ga0070665_100617935 3300005548 Bacteria 1097
74 Ga0068855_100606029 3300005563 Bacteria 1180
75 Ga0070664_100002424 3300005564 Bacteria 14994
76 Ga0070664_100026936 3300005564 Bacteria 4774
77 Ga0070664_100080889 3300005564 Bacteria 2799
78 Ga0070664_100184533 3300005564 Bacteria 1856
79 Ga0070664_100201833 3300005564 Bacteria 1775
80 Ga0068857_100036247 3300005577 Bacteria 4371
81 Ga0068857_100128369 3300005577 Bacteria 2285
82 Ga0068854_100041423 3300005578 Bacteria 3254
83 Ga0068856_100588966 3300005614 Bacteria 1133
84 Ga0070702_100155295 3300005615 Bacteria 1473
85 Ga0068852_100044959 3300005616 Bacteria 3754
86 Ga0068852_100078933 3300005616 Bacteria 2914
87 Ga0068852_100182325 3300005616 Bacteria 1975
88 Ga0068852_100187595 3300005616 Bacteria 1948
89 Ga0068859_100035268 3300005617 Bacteria 5020
90 Ga0068864_100033016 3300005618 Bacteria 4399
91 Ga0068866_10242475 3300005718 Bacteria 1098
92 Ga0068861_100307062 3300005719 Bacteria 1376
93 Ga0068851_10020242 3300005834 Bacteria 3219
94 Ga0068858_100019553 3300005842 Bacteria 6333
95 Ga0068858_100447555 3300005842 Bacteria 1244
96 Ga0068858_100829421 3300005842 Bacteria 903
97 Ga0068860_100073415 3300005843 Bacteria 3252
98 Ga0068862_100048154 3300005844 Bacteria 3639
99 Ga0068862_100475986 3300005844 Bacteria 1181
100 Ga0070717_10048114 3300006028 Bacteria 3497
101 Ga0070712_100340002 3300006175 Bacteria 1225
102 Ga0068871_100176445 3300006358 Bacteria 1834
103 Ga0075428_100003563 3300006844 Bacteria 17047
104 Ga0075434_100125160 3300006871 Bacteria 2588
105 Ga0075429_100096963 3300006880 Bacteria 2572
106 Ga0075429_100554755 3300006880 Bacteria 1007
107 Ga0068865_100225236 3300006881 Bacteria 1468
108 Ga0068865_100228821 3300006881 Bacteria 1457
109 Ga0075436_100002182 3300006914 Bacteria 13495
110 Ga0097620_100035268 3300006931 Bacteria 5020
111 Ga0075435_100081101 3300007076 Bacteria 2664
112 Ga0105240_10191852 3300009093 Bacteria 2402
113 Ga0111539_10183078 3300009094 Bacteria 2447
114 Ga0105245_10076287 3300009098 Bacteria 3053
115 Ga0105245_10229356 3300009098 Bacteria 1795
116 Ga0105247_10432974 3300009101 Bacteria 944
117 Ga0114129_10497901 3300009147 Bacteria 1592
118 Ga0105243_10204712 3300009148 Bacteria 1733
119 Ga0105241_10453372 3300009174 Bacteria 1135
120 Ga0105241_10959031 3300009174 Unclassified 798
121 Ga0105248_10013326 3300009177 Bacteria 9049
122 Ga0105248_10039123 3300009177 Bacteria 5311
123 Ga0105248_10091258 3300009177 Bacteria 3431
124 Ga0105238_10017853 3300009551 Bacteria 7213
125 Ga0105249_10054591 3300009553 Bacteria 3654
126 Ga0105249_10135238 3300009553 Bacteria 2358
127 Ga0105239_10034127 3300010375 Bacteria 5586
128 Ga0105246_10522287 3300011119 Bacteria 1012
129 Ga0157373_10001899 3300013100 Bacteria 15862
130 Ga0157373_10002987 3300013100 Bacteria 12790
131 Ga0157373_10014261 3300013100 Bacteria 5830
132 Ga0157371_10080388 3300013102 Bacteria 2308
133 Ga0157370_10030530 3300013104 Bacteria 5280
134 Ga0157370_10052159 3300013104 Bacteria 3905
135 Ga0157370_10266640 3300013104 Bacteria 1582
136 Ga0157370_10309131 3300013104 Bacteria 1459
137 Ga0157369_10097016 3300013105 Unclassified 3144
138 Ga0157369_10762209 3300013105 Bacteria 995
139 Ga0157374_10413614 3300013296 Bacteria 1346
140 Ga0157374_11006013 3300013296 Bacteria 853
141 Ga0157378_10059861 3300013297 Bacteria 3399
142 Ga0157378_10437508 3300013297 Bacteria 1295
143 Ga0157372_10099009 3300013307 Bacteria 3326
144 Ga0157372_10299463 3300013307 Bacteria 1871
145 Ga0157377_10028776 3300014745 Bacteria 2993
146 Ga0157379_10026180 3300014968 Bacteria 5190
147 Ga0157379_10063298 3300014968 Bacteria 3308
148 Ga0207653_10016670 3300025885 Bacteria 2308
149 Ga0207642_10197237 3300025899 Bacteria 1109
150 Ga0207688_10063428 3300025901 Bacteria 2084
151 Ga0207680_10000835 3300025903 Bacteria 14534
152 Ga0207680_10145850 3300025903 Bacteria 1573
153 Ga0207647_10000721 3300025904 Bacteria 25921
154 Ga0207647_10146109 3300025904 Bacteria 1384
155 Ga0207705_10000358 3300025909 Bacteria 41389
156 Ga0207705_10009577 3300025909 Bacteria 7047
157 Ga0207705_10029514 3300025909 Plasmid 3909
158 Ga0207705_10073179 3300025909 Unclassified 2486
159 Ga0207705_10153155 3300025909 Bacteria 1728
160 Ga0207705_10180652 3300025909 Bacteria 1592
161 Ga0207654_10238497 3300025911 Bacteria 1214
162 Ga0207707_10068445 3300025912 Bacteria 3093
163 Ga0207707_10117576 3300025912 Bacteria 2324
164 Ga0207695_10077027 3300025913 Bacteria 3389
165 Ga0207660_10308525 3300025917 Bacteria 1261
166 Ga0207662_10345381 3300025918 Bacteria 998
167 Ga0207657_10004307 3300025919 Bacteria 15083
168 Ga0207657_10006343 3300025919 Bacteria 12284
169 Ga0207657_10009578 3300025919 Bacteria 9725
170 Ga0207657_10011947 3300025919 Bacteria 8594
171 Ga0207657_10016991 3300025919 Bacteria 6999
172 Ga0207657_10029311 3300025919 Bacteria 5012
173 Ga0207657_10305428 3300025919 Bacteria 1260
174 Ga0207649_10026988 3300025920 Bacteria 3366
175 Ga0207649_10198804 3300025920 Bacteria 1415
176 Ga0207649_10232399 3300025920 Bacteria 1319
177 Ga0207649_10415999 3300025920 Bacteria 1009
178 Ga0207652_10052973 3300025921 Bacteria 3485
179 Ga0207652_10056143 3300025921 Bacteria 3389
180 Ga0207652_10200976 3300025921 Bacteria 1793
181 Ga0207652_10560460 3300025921 Bacteria 1026
182 Ga0207652_10605835 3300025921 Bacteria 982
183 Ga0207650_10093975 3300025925 Bacteria 2296
184 Ga0207687_10165854 3300025927 Bacteria 1699
185 Ga0207700_10009802 3300025928 Bacteria 6007
186 Ga0207700_10093398 3300025928 Bacteria 2381
187 Ga0207690_10011850 3300025932 Bacteria 5213
188 Ga0207690_10024809 3300025932 Bacteria 3759
189 Ga0207690_10196514 3300025932 Bacteria 1529
190 Ga0207690_10823324 3300025932 Bacteria 768
191 Ga0207706_10670234 3300025933 Bacteria 887
192 Ga0207686_10330216 3300025934 Bacteria 1142
193 Ga0207709_10132914 3300025935 Bacteria 1698
194 Ga0207670_10045201 3300025936 Bacteria 2918
195 Ga0207669_10022152 3300025937 Bacteria 3369
196 Ga0207704_10027104 3300025938 Bacteria 3155
197 Ga0207704_10086974 3300025938 Bacteria 2040
198 Ga0207711_10000180 3300025941 Bacteria 68214
199 Ga0207711_10028841 3300025941 Bacteria 4675
200 Ga0207689_10161055 3300025942 Bacteria 1849
201 Ga0207679_10022960 3300025945 Bacteria 4257
202 Ga0207679_10029125 3300025945 Bacteria 3841
203 Ga0207679_10034548 3300025945 Bacteria 3568
204 Ga0207679_10248665 3300025945 Bacteria 1510
205 Ga0207667_10036759 3300025949 Bacteria 5243
206 Ga0207667_10082639 3300025949 Bacteria 3326
207 Ga0207651_10005501 3300025960 Bacteria 6514
208 Ga0207651_10208266 3300025960 Bacteria 1572
209 Ga0207651_10626056 3300025960 Bacteria 943
210 Ga0207712_10128652 3300025961 Bacteria 1927
211 Ga0207640_10042763 3300025981 Bacteria 2891
212 Ga0207640_10057737 3300025981 Bacteria 2554
213 Ga0207640_10202420 3300025981 Bacteria 1505
214 Ga0207658_10008833 3300025986 Bacteria 6837
215 Ga0207658_10126910 3300025986 Bacteria 2043
216 Ga0207677_10006623 3300026023 Bacteria 6354
217 Ga0207677_10284223 3300026023 Bacteria 1359
218 Ga0207703_10004732 3300026035 Bacteria 11107
219 Ga0207639_10048365 3300026041 Bacteria 3219
220 Ga0207678_10018378 3300026067 Bacteria 6138
221 Ga0207678_10049190 3300026067 Bacteria 3643
222 Ga0207678_10056315 3300026067 Bacteria 3384
223 Ga0207678_10179676 3300026067 Bacteria 1807
224 Ga0207702_10016603 3300026078 Bacteria 6092
225 Ga0207702_10041084 3300026078 Bacteria 3877
226 Ga0207648_10550004 3300026089 Bacteria 1060
227 Ga0207648_10827543 3300026089 Bacteria 863
228 Ga0207676_10054631 3300026095 Bacteria 3131
229 Ga0207674_10001662 3300026116 Bacteria 28614
230 Ga0207674_10003404 3300026116 Bacteria 19500
231 Ga0207674_10135987 3300026116 Bacteria 2420
232 Ga0207675_101038232 3300026118 Bacteria 839
233 Ga0207698_10003075 3300026142 Bacteria 10003
234 Ga0207698_10005264 3300026142 Bacteria 7956
235 Ga0207698_10064988 3300026142 Bacteria 2863
236 Ga0207698_10283731 3300026142 Bacteria 1533
237 Ga0207698_10859343 3300026142 Bacteria 913
238 Ga0207698_10907717 3300026142 Bacteria 888
239 Ga0207698_11090853 3300026142 Bacteria 811
240 Ga0207428_10000488 3300027907 Bacteria 47436
241 Ga0207428_10421723 3300027907 Bacteria 975
242 Ga0268266_10665867 3300028379 Bacteria 1002
243 Ga0268265_10391179 3300028380 Bacteria 1282
244 Ga0268264_10067152 3300028381 Bacteria 3026
245 Ga0268264_10079241 3300028381 Bacteria 2802
246 Ga0307410_10011982 3300031852 Bacteria 4988
247 Ga0307406_10078789 3300031901 Bacteria 2184
248 Ga0307406_10455253 3300031901 Bacteria 1028
249 Ga0307415_100384075 3300032126 Bacteria 1193
250 Ga0373950_0028069 3300034818 Bacteria 1030
251 Ga0373958_0020420 3300034819 Bacteria 1220
252 Ga0373938_0038877 3300034957 Bacteria 1050
253 Ga0373928_0005706 3300035084 Bacteria 2380
254 Ga0373939_0011107 3300035114 Bacteria 2265
255 Ga0373939_0054064 3300035114 Bacteria 1257
256 Ga0373941_0014871 3300035115 Bacteria 2088
257 Ga0373961_0140084 3300035241 Bacteria 817
258 Ga0373931_0046912 3300035691 Bacteria 2285
259 Ga0373947_0407725 3300035725 Bacteria 917
260 Ga0395899_0008824 3300037312 Bacteria 7759
261 Ga0395899_0045303 3300037312 Bacteria 3277
262 Ga0395899_0099779 3300037312 Bacteria 2097
263 Ga0395899_0108640 3300037312 Bacteria 1996
264 Ga0395899_0132334 3300037312 Bacteria 1780
265 Ga0395900_0010635 3300037418 Bacteria 9410
266 Ga0395900_0062281 3300037418 Bacteria 3834
267 Ga0395900_0075016 3300037418 Bacteria 3476
268 Ga0395900_0511901 3300037418 Bacteria 1149
269 Ga0395900_0757501 3300037418 Bacteria 901
270 Ga0395898_0000732 3300037466 Bacteria 57501
271 Ga0395898_0055443 3300037466 Bacteria 3865
272 Ga0395898_0061014 3300037466 Bacteria 3663
273 Ga0395898_0105284 3300037466 Unclassified 2705
274 Ga0395905_0020667 3300037471 Bacteria 6232
275 Ga0395905_0025261 3300037471 Bacteria 5602
276 Ga0395905_0086334 3300037471 Bacteria 2940
277 Ga0395905_0286701 3300037471 Bacteria 1533
278 Ga0395905_0513437 3300037471 Bacteria 1099
279 Ga0395905_0772563 3300037471 Unclassified 863
280 Ga0395901_0008018 3300038443 Bacteria 10665
281 Ga0395901_0014286 3300038443 Bacteria 8083
282 Ga0395901_0036376 3300038443 Bacteria 5089
283 Ga0395901_0041035 3300038443 Unclassified 4795
284 Ga0395901_1018898 3300038443 Bacteria 803
285 Ga0439458_0001172 3300042157 Bacteria 6657
286 Ga0466966_0000004 3300044684 Bacteria 223594
287 Ga0466966_0070444 3300044684 Bacteria 2192
288 Ga0466961_0142703 3300044693 Bacteria 1499
289 Ga0466963_0060255 3300044694 Bacteria 2534
290 Ga0466963_0132943 3300044694 Bacteria 1720
291 Ga0466963_0166996 3300044694 Bacteria 1533
292 Ga0466957_0049506 3300044842 Bacteria 2555
293 Ga0466960_0091421 3300044901 Bacteria 1552
294 Ga0451576_0093104 3300045051 Bacteria 3133
295 Ga0466967_0155650 3300045976 Bacteria 2140
296 Ga0495669_0002162 3300046684 Bacteria 8074
297 Ga0496101_0213898 3300048904 Bacteria 1494
298 Ga0496102_0602431 3300048905 Bacteria 1022
299 Ga0496103_0097387 3300048906 Bacteria 1860
300 Ga0496111_0115185 3300048914 Bacteria 1982
301 Ga0496113_0723239 3300048916 Bacteria 794
302 Ga0501292_000066 3300049515 Bacteria 21599
303 Ga0501294_001209 3300049517 Bacteria 2670
304 Ga0501297_002696 3300049520 Bacteria 1727
305 Ga0501300_000462 3300049523 Bacteria 6168
306 Ga0501069_0224864 3300049585 Bacteria 1092
307 Ga0501227_020383 3300049665 Bacteria 1520
308 Ga0501228_000766 3300049666 Bacteria 2155
309 Ga0501233_006079 3300049668 Bacteria 2257
310 Ga0501236_036837 3300049670 Bacteria 797
311 Ga0501261_000042 3300049690 Bacteria 25703
312 Ga0501221_031439 3300049704 Bacteria 1109
313 Ga0501245_000026 3300049708 Bacteria 14162
314 Ga0501279_000018 3300049775 Bacteria 59107
315 Ga0501282_000014 3300049778 Bacteria 25092
316 Ga0501284_00721 3300050005 Bacteria 1703
317 nmdc:mga05p37_452538_c1 3300050507 Bacteria 1485
318 nmdc:mga05p37_456_c1 3300050507 Bacteria 44536
319 nmdc:mga09592_6064_c1 3300050508 Bacteria 9854
320 nmdc:mga09592_818877_c1 3300050508 Bacteria 787
321 nmdc:mga0qj67_704124_c1 3300050509 Unclassified 803
322 nmdc:mga08y16_50307_c1 3300050511 Bacteria 4362
323 nmdc:mga0n895_396107_c1 3300050512 Bacteria 1397
324 nmdc:mga0rr50_91268_c1 3300050513 Bacteria 2372
325 nmdc:mga08x19_4495_c1 3300050514 Bacteria 8267
326 Ga0590071_007095 3300059421 Bacteria 2653
327 Ga0070658_10190935
328 JGI24740J21852_10047252
329 JGI24735J21928_10036475
330 Ga0070658_10064736
331 Ga0070658_10299761
332 Ga0070658_10345298
333 Ga0070658_10692470
334 Ga0070658_10825462
335 Ga0070690_100483438
336 Ga0070670_100006874
337 Ga0070666_10006666
338 Ga0070666_10117152
339 Ga0070680_100010796
340 Ga0070680_100398758
341 Ga0070680_100402788
342 Ga0070682_100038426
343 Ga0070682_100206827
344 Ga0068868_100001134
345 Ga0068868_100286977
346 Ga0070660_100008713
347 Ga0070660_100036771
348 Ga0070660_100226822
349 Ga0070660_100259918
350 Ga0070689_100027928
351 Ga0070689_100141497
352 Ga0070691_10260411
353 Ga0070687_100017890
354 Ga0070661_100040201
355 Ga0070661_100135461
356 Ga0070661_100221411
357 Ga0070661_100287991
358 Ga0070661_100302272
359 Ga0070692_10469252
360 Ga0070671_100001855
361 Ga0070674_100024515
362 Ga0070673_100009612
363 Ga0070673_100041727
364 Ga0070659_100021046
365 Ga0070659_100047040
366 Ga0070659_100083527
367 Ga0070659_100616081
368 Ga0070667_100019601
369 Ga0070703_10194049
370 Ga0070714_100024075
371 Ga0070713_100107749
372 Ga0070701_10026057
373 Ga0070705_100440950
374 Ga0070663_100021227
375 Ga0070663_100040107
376 Ga0070663_100172070
377 Ga0070662_100010801
378 Ga0070662_100197031
379 Ga0070681_10007382
380 Ga0070681_10016464
381 Ga0070681_10360001
382 Ga0068867_100032060
383 Ga0070707_100693664
384 Ga0070679_100031193
385 Ga0070679_100114833
386 Ga0070679_100131063
387 Ga0070679_100136079
388 Ga0070679_100246319
389 Ga0070684_100113622
390 Ga0068853_100015024
391 Ga0068853_100079930
392 Ga0070686_100086600
393 Ga0070686_100110424
394 Ga0070695_100064884
395 Ga0070696_100064394
396 Ga0070693_100034766
397 Ga0070693_100087174
398 Ga0070693_100134783
399 Ga0070665_100617935
400 Ga0068855_100606029
401 Ga0070664_100002424
402 Ga0070664_100026936
403 Ga0070664_100080889
404 Ga0070664_100184533
405 Ga0070664_100201833
406 Ga0068857_100036247
407 Ga0068857_100128369
408 Ga0068854_100041423
409 Ga0068856_100588966
410 Ga0070702_100155295
411 Ga0068852_100044959
412 Ga0068852_100078933
413 Ga0068852_100182325
414 Ga0068852_100187595
415 Ga0068859_100035268
416 Ga0068864_100033016
417 Ga0068866_10242475
418 Ga0068861_100307062
419 Ga0068851_10020242
420 Ga0068858_100019553
421 Ga0068858_100447555
422 Ga0068858_100829421
423 Ga0068860_100073415
424 Ga0068862_100048154
425 Ga0068862_100475986
426 Ga0070717_10048114
427 Ga0070712_100340002
428 Ga0068871_100176445
429 Ga0075428_100003563
430 Ga0075434_100125160
431 Ga0075429_100096963
432 Ga0075429_100554755
433 Ga0068865_100225236
434 Ga0068865_100228821
435 Ga0075436_100002182
436 Ga0097620_100035268
437 Ga0075435_100081101
438 Ga0105240_10191852
439 Ga0111539_10183078
440 Ga0105245_10076287
441 Ga0105245_10229356
442 Ga0105247_10432974
443 Ga0114129_10497901
444 Ga0105243_10204712
445 Ga0105241_10453372
446 Ga0105241_10959031
447 Ga0105248_10013326
448 Ga0105248_10039123
449 Ga0105248_10091258
450 Ga0105238_10017853
451 Ga0105249_10054591
452 Ga0105249_10135238
453 Ga0105239_10034127
454 Ga0105246_10522287
455 Ga0157373_10001899
456 Ga0157373_10002987
457 Ga0157373_10014261
458 Ga0157371_10080388
459 Ga0157370_10030530
460 Ga0157370_10052159
461 Ga0157370_10266640
462 Ga0157370_10309131
463 Ga0157369_10097016
464 Ga0157369_10762209
465 Ga0157374_10413614
466 Ga0157374_11006013
467 Ga0157378_10059861
468 Ga0157378_10437508
469 Ga0157372_10099009
470 Ga0157372_10299463
471 Ga0157377_10028776
472 Ga0157379_10026180
473 Ga0157379_10063298
474 Ga0207653_10016670
475 Ga0207642_10197237
476 Ga0207688_10063428
477 Ga0207680_10000835
478 Ga0207680_10145850
479 Ga0207647_10000721
480 Ga0207647_10146109
481 Ga0207705_10000358
482 Ga0207705_10009577
483 Ga0207705_10029514
484 Ga0207705_10073179
485 Ga0207705_10153155
486 Ga0207705_10180652
487 Ga0207654_10238497
488 Ga0207707_10068445
489 Ga0207707_10117576
490 Ga0207695_10077027
491 Ga0207660_10308525
492 Ga0207662_10345381
493 Ga0207657_10004307
494 Ga0207657_10006343
495 Ga0207657_10009578
496 Ga0207657_10011947
497 Ga0207657_10016991
498 Ga0207657_10029311
499 Ga0207657_10305428
500 Ga0207649_10026988
501 Ga0207649_10198804
502 Ga0207649_10232399
503 Ga0207649_10415999
504 Ga0207652_10052973
505 Ga0207652_10056143
506 Ga0207652_10200976
507 Ga0207652_10560460
508 Ga0207652_10605835
509 Ga0207650_10093975
510 Ga0207687_10165854
511 Ga0207700_10009802
512 Ga0207700_10093398
513 Ga0207690_10011850
514 Ga0207690_10024809
515 Ga0207690_10196514
516 Ga0207690_10823324
517 Ga0207706_10670234
518 Ga0207686_10330216
519 Ga0207709_10132914
520 Ga0207670_10045201
521 Ga0207669_10022152
522 Ga0207704_10027104
523 Ga0207704_10086974
524 Ga0207711_10000180
525 Ga0207711_10028841
526 Ga0207689_10161055
527 Ga0207679_10022960
528 Ga0207679_10029125
529 Ga0207679_10034548
530 Ga0207679_10248665
531 Ga0207667_10036759
532 Ga0207667_10082639
533 Ga0207651_10005501
534 Ga0207651_10208266
535 Ga0207651_10626056
536 Ga0207712_10128652
537 Ga0207640_10042763
538 Ga0207640_10057737
539 Ga0207640_10202420
540 Ga0207658_10008833
541 Ga0207658_10126910
542 Ga0207677_10006623
543 Ga0207677_10284223
544 Ga0207703_10004732
545 Ga0207639_10048365
546 Ga0207678_10018378
547 Ga0207678_10049190
548 Ga0207678_10056315
549 Ga0207678_10179676
550 Ga0207702_10016603
551 Ga0207702_10041084
552 Ga0207648_10550004
553 Ga0207648_10827543
554 Ga0207676_10054631
555 Ga0207674_10001662
556 Ga0207674_10003404
557 Ga0207674_10135987
558 Ga0207675_101038232
559 Ga0207698_10003075
560 Ga0207698_10005264
561 Ga0207698_10064988
562 Ga0207698_10283731
563 Ga0207698_10859343
564 Ga0207698_10907717
565 Ga0207698_11090853
566 Ga0207428_10000488
567 Ga0207428_10421723
568 Ga0268266_10665867
569 Ga0268265_10391179
570 Ga0268264_10067152
571 Ga0268264_10079241
572 Ga0307410_10011982
573 Ga0307406_10078789
574 Ga0307406_10455253
575 Ga0307415_100384075
576 Ga0373950_0028069
577 Ga0373958_0020420
578 Ga0373938_0038877
579 Ga0373928_0005706
580 Ga0373939_0011107
581 Ga0373939_0054064
582 Ga0373941_0014871
583 Ga0373961_0140084
584 Ga0373931_0046912
585 Ga0373947_0407725
586 Ga0395899_0008824
587 Ga0395899_0045303
588 Ga0395899_0099779
589 Ga0395899_0108640
590 Ga0395899_0132334
591 Ga0395900_0010635
592 Ga0395900_0062281
593 Ga0395900_0075016
594 Ga0395900_0511901
595 Ga0395900_0757501
596 Ga0395898_0000732
597 Ga0395898_0055443
598 Ga0395898_0061014
599 Ga0395898_0105284
600 Ga0395905_0020667
601 Ga0395905_0025261
602 Ga0395905_0086334
603 Ga0395905_0286701
604 Ga0395905_0513437
605 Ga0395905_0772563
606 Ga0395901_0008018
607 Ga0395901_0014286
608 Ga0395901_0036376
609 Ga0395901_0041035
610 Ga0395901_1018898
611 Ga0439458_0001172
612 Ga0466966_0000004
613 Ga0466966_0070444
614 Ga0466961_0142703
615 Ga0466963_0060255
616 Ga0466963_0132943
617 Ga0466963_0166996
618 Ga0466957_0049506
619 Ga0466960_0091421
620 Ga0451576_0093104
621 Ga0466967_0155650
622 Ga0495669_0002162
623 Ga0496101_0213898
624 Ga0496102_0602431
625 Ga0496103_0097387
626 Ga0496111_0115185
627 Ga0496113_0723239
628 Ga0501292_000066
629 Ga0501294_001209
630 Ga0501297_002696
631 Ga0501300_000462
632 Ga0501069_0224864
633 Ga0501227_020383
634 Ga0501228_000766
635 Ga0501233_006079
636 Ga0501236_036837
637 Ga0501261_000042
638 Ga0501221_031439
639 Ga0501245_000026
640 Ga0501279_000018
641 Ga0501282_000014
642 Ga0501284_00721
643 nmdc:mga05p37_452538_c1
644 nmdc:mga05p37_456_c1
645 nmdc:mga09592_6064_c1
646 nmdc:mga09592_818877_c1
647 nmdc:mga0qj67_704124_c1
648 nmdc:mga08y16_50307_c1
649 nmdc:mga0n895_396107_c1
650 nmdc:mga0rr50_91268_c1
651 nmdc:mga08x19_4495_c1
652 Ga0590071_007095

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06080

DUF938

Protein of unknown function (DUF938)

16

209

0.97

PF13649

Methyltransf_25

Methyltransferase domain

43

140

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
8tjk-assembly1.cif.gz_B sam-dependent methyltransferase redm bound to sah 0.8798 21 209
3gwz-assembly1.cif.gz_A structure of the mitomycin 7-o-methyltransferase mmcr 0.8744 20 210
7wdq-assembly2.cif.gz_D dsyb in complex with sam 0.863 21 209
8tjj-assembly1.cif.gz_D sam-dependent methyltransferase redm bound to sam 0.8621 20 209
5i2h-assembly1.cif.gz_B crystal structure of o-methyltransferase family 2 protein plim_1147 from planctomyces limnophilus dsm 3776 complex with apigenin 0.8615 20 210
ID Description Score Start End Superfamily
af_Q7YWR7_1_204_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.961 18 209 3.40.50.150
af_Q7ZVJ8_3_201_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9583 17 208 3.40.50.150
af_Q9VLF6_13_218_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9491 15 205 3.40.50.150
af_Q7ZVJ8_3_201_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9207 17 208 3.40.50.150
af_Q66I74_7_186_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9162 25 189 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A0S8EZW2-F1-model_v4 SAM-dependent methyltransferase 1.003 18 94 GO:0008168
GO:0032259
AF-A0A7C2YJB0-F1-model_v4 DUF938 domain-containing protein 0.9897 15 210
AF-A0A4Q6A702-F1-model_v4 deleted 0.9825 15 174
AF-A0A7C2YJB0-F1-model_v4 DUF938 domain-containing protein 0.9798 15 210
AF-A0A4Q2Z977-F1-model_v4 DUF938 domain-containing protein 0.9772 15 118

Map