F408241

General Info

Members Datasets Scaffolds Average Seq Length
326 189 326 137

Family's Representative Sequence

Representative Sequence 3300006358|Ga0068871_100198360|Ga0068871_1001983602
Length 162
Sequence MVPSQNLVSYWIRVRYHCDKRGERPYNVEVAAVMSEPTTSTILIVDDDEGVTQTFARMLKLEGFQVRTAINAESGLKVASESQPNAIILDLRMPLVDGLGFLRRLRAQQEQRATPVAIVTGDYFLEDSVANELRELGAELRFKPLWLEDLVGLARNLLRVTH

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
106 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
107 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
108 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
109 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
110 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
111 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
112 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
113 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
114 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
115 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
116 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
118 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
119 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
120 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
121 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
122 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
123 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
124 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
125 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
126 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
127 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
136 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
141 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
142 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
143 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
147 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
148 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
149 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
150 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
151 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
152 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
153 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
154 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
155 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
174 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
175 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
182 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
185 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
186 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
187 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
188 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
189 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.23
Rhizosphere 98.16
Stem 0
Stem Tuber 0
Unclassified 0.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10249579 3300003203 Bacteria 521
2 Ga0065707_10125686 3300005295 Bacteria 1988
3 Ga0065707_10330832 3300005295 Bacteria 950
4 Ga0070670_100751183 3300005331 Bacteria 879
5 Ga0068869_101302298 3300005334 Unclassified 641
6 Ga0070660_100025972 3300005339 Bacteria 4358
7 Ga0070660_101038231 3300005339 Bacteria 693
8 Ga0070692_10090847 3300005345 Bacteria 1660
9 Ga0070668_100114514 3300005347 Bacteria 2148
10 Ga0070669_100096150 3300005353 Bacteria 2228
11 Ga0070671_101137928 3300005355 Bacteria 686
12 Ga0070674_100011077 3300005356 Bacteria 5474
13 Ga0070674_100011399 3300005356 Bacteria 5413
14 Ga0070673_100038209 3300005364 Bacteria 3664
15 Ga0070673_101375862 3300005364 Bacteria 664
16 Ga0070688_100005782 3300005365 Bacteria 6538
17 Ga0070714_100249215 3300005435 Bacteria 1641
18 Ga0070711_100266943 3300005439 Bacteria 1349
19 Ga0070700_100185163 3300005441 Bacteria 1452
20 Ga0070708_100149315 3300005445 Unclassified 2173
21 Ga0070708_100195830 3300005445 Bacteria 1891
22 Ga0070708_100723590 3300005445 Unclassified 936
23 Ga0070681_10077107 3300005458 Bacteria 3291
24 Ga0070681_10339453 3300005458 Unclassified 1412
25 Ga0070681_10340302 3300005458 Bacteria 1410
26 Ga0070681_11931369 3300005458 Bacteria 518
27 Ga0068867_100029045 3300005459 Bacteria 3984
28 Ga0070706_100879302 3300005467 Bacteria 828
29 Ga0070707_100096405 3300005468 Bacteria 2865
30 Ga0070707_101308529 3300005468 Bacteria 691
31 Ga0070698_100145785 3300005471 Bacteria 2317
32 Ga0070698_100621967 3300005471 Bacteria 1021
33 Ga0070698_100802254 3300005471 Bacteria 885
34 Ga0070698_101866463 3300005471 Bacteria 554
35 Ga0070699_100004418 3300005518 Bacteria 12429
36 Ga0070699_100265041 3300005518 Bacteria 1537
37 Ga0070699_101258072 3300005518 Bacteria 679
38 Ga0070699_101540473 3300005518 Unclassified 609
39 Ga0070679_100455678 3300005530 Bacteria 1224
40 Ga0070684_101080359 3300005535 Bacteria 754
41 Ga0070697_100410372 3300005536 Bacteria 1176
42 Ga0070697_100819076 3300005536 Bacteria 824
43 Ga0070672_101699133 3300005543 Unclassified 567
44 Ga0070686_100668336 3300005544 Bacteria 825
45 Ga0070695_100141820 3300005545 Bacteria 1667
46 Ga0070696_100325404 3300005546 Unclassified 1184
47 Ga0070696_100715956 3300005546 Bacteria 817
48 Ga0068855_100215749 3300005563 Bacteria 2154
49 Ga0070664_100076190 3300005564 Bacteria 2882
50 Ga0068859_100065990 3300005617 Bacteria 3654
51 Ga0068859_100363655 3300005617 Bacteria 1542
52 Ga0068859_102283473 3300005617 Bacteria 597
53 Ga0068864_100500405 3300005618 Bacteria 1169
54 Ga0068866_10226077 3300005718 Unclassified 1132
55 Ga0068861_100153040 3300005719 Bacteria 1894
56 Ga0068861_100702572 3300005719 Bacteria 940
57 Ga0068858_100392813 3300005842 Bacteria 1332
58 Ga0068858_100996014 3300005842 Unclassified 821
59 Ga0068860_100509706 3300005843 Bacteria 1202
60 Ga0068862_100368369 3300005844 Bacteria 1337
61 Ga0081539_10012417 3300005985 Bacteria 6566
62 Ga0070716_100073686 3300006173 Bacteria 2015
63 Ga0070716_100616409 3300006173 Unclassified 818
64 Ga0070716_101214251 3300006173 Unclassified 606
65 Ga0097621_100639711 3300006237 Unclassified 975
66 Ga0068871_100097236 3300006358 Bacteria 2461
67 Ga0068871_100198360 3300006358 Bacteria 1732
68 Ga0068871_100615096 3300006358 Bacteria 989
69 Ga0075428_100142612 3300006844 Bacteria 2604
70 Ga0075428_101037974 3300006844 Unclassified 867
71 Ga0075430_101397050 3300006846 Unclassified 575
72 Ga0075433_10026002 3300006852 Bacteria 4952
73 Ga0075433_10039646 3300006852 Bacteria 4074
74 Ga0075434_100002495 3300006871 Bacteria 16216
75 Ga0075434_100003115 3300006871 Bacteria 14769
76 Ga0075434_100065891 3300006871 Bacteria 3607
77 Ga0075434_100080294 3300006871 Bacteria 3258
78 Ga0075434_100828845 3300006871 Bacteria 941
79 Ga0075434_101358500 3300006871 Bacteria 721
80 Ga0068865_100181952 3300006881 Bacteria 1619
81 Ga0068865_101613918 3300006881 Unclassified 583
82 Ga0075436_100001718 3300006914 Bacteria 14994
83 Ga0075436_100024319 3300006914 Bacteria 4163
84 Ga0075436_100369534 3300006914 Bacteria 1036
85 Ga0075436_100423825 3300006914 Unclassified 966
86 Ga0075436_101147824 3300006914 Bacteria 586
87 Ga0097620_100065989 3300006931 Bacteria 3654
88 Ga0097620_100363619 3300006931 Bacteria 1542
89 Ga0097620_102283694 3300006931 Bacteria 597
90 Ga0075435_100000189 3300007076 Bacteria 36888
91 Ga0075435_100006656 3300007076 Bacteria 8190
92 Ga0075435_100059349 3300007076 Bacteria 3101
93 Ga0075435_100120211 3300007076 Bacteria 2192
94 Ga0075435_100169764 3300007076 Bacteria 1840
95 Ga0075435_100176884 3300007076 Unclassified 1802
96 Ga0075435_100374421 3300007076 Bacteria 1223
97 Ga0105240_10007971 3300009093 Bacteria 15273
98 Ga0105240_10846222 3300009093 Bacteria 988
99 Ga0105240_11272178 3300009093 Unclassified 777
100 Ga0111539_10385000 3300009094 Bacteria 1633
101 Ga0105245_10020467 3300009098 Bacteria 5802
102 Ga0114129_10000973 3300009147 Bacteria 37498
103 Ga0114129_10028157 3300009147 Bacteria 7961
104 Ga0114129_10597947 3300009147 Bacteria 1430
105 Ga0105243_10023948 3300009148 Bacteria 4652
106 Ga0105243_10482396 3300009148 Bacteria 1170
107 Ga0105241_10039422 3300009174 Bacteria 3563
108 Ga0105242_10007403 3300009176 Bacteria 8452
109 Ga0105242_10737792 3300009176 Unclassified 968
110 Ga0105242_11089488 3300009176 Unclassified 812
111 Ga0105242_11994746 3300009176 Bacteria 622
112 Ga0105248_10027872 3300009177 Bacteria 6289
113 Ga0105248_10048515 3300009177 Bacteria 4763
114 Ga0105248_10104341 3300009177 Bacteria 3196
115 Ga0105248_10125905 3300009177 Bacteria 2891
116 Ga0105248_10391843 3300009177 Bacteria 1564
117 Ga0105248_10541905 3300009177 Bacteria 1313
118 Ga0105248_10559297 3300009177 Unclassified 1290
119 Ga0105248_13271008 3300009177 Unclassified 515
120 Ga0105237_10698250 3300009545 Bacteria 1021
121 Ga0105237_11555671 3300009545 Bacteria 668
122 Ga0105249_10098631 3300009553 Bacteria 2745
123 Ga0157374_10043351 3300013296 Bacteria 4156
124 Ga0157378_10771705 3300013297 Bacteria 985
125 Ga0163162_10147068 3300013306 Bacteria 2473
126 Ga0157372_10988599 3300013307 Unclassified 975
127 Ga0157372_12858407 3300013307 Unclassified 553
128 Ga0157375_10065002 3300013308 Bacteria 3635
129 Ga0157375_11136591 3300013308 Bacteria 915
130 Ga0157375_11531173 3300013308 Bacteria 787
131 Ga0163163_10500475 3300014325 Bacteria 1277
132 Ga0163163_10726482 3300014325 Bacteria 1057
133 Ga0163163_11220885 3300014325 Bacteria 814
134 Ga0157380_10035180 3300014326 Unclassified 3868
135 Ga0157380_10961448 3300014326 Unclassified 885
136 Ga0157379_10115860 3300014968 Bacteria 2409
137 Ga0157379_10219349 3300014968 Bacteria 1723
138 Ga0163161_10495944 3300017792 Bacteria 994
139 Ga0207642_10003940 3300025899 Bacteria 4735
140 Ga0207642_10370416 3300025899 Bacteria 850
141 Ga0207680_10005172 3300025903 Bacteria 6225
142 Ga0207684_10291644 3300025910 Bacteria 1407
143 Ga0207684_10567544 3300025910 Bacteria 970
144 Ga0207654_10043032 3300025911 Bacteria 2558
145 Ga0207707_10578604 3300025912 Bacteria 952
146 Ga0207707_11522182 3300025912 Bacteria 529
147 Ga0207695_10104626 3300025913 Bacteria 2819
148 Ga0207657_10952518 3300025919 Bacteria 660
149 Ga0207652_10370003 3300025921 Bacteria 1294
150 Ga0207646_10139142 3300025922 Unclassified 2186
151 Ga0207646_10142046 3300025922 Bacteria 2163
152 Ga0207646_11050181 3300025922 Bacteria 718
153 Ga0207681_10046355 3300025923 Bacteria 2923
154 Ga0207681_10920981 3300025923 Bacteria 732
155 Ga0207650_10487268 3300025925 Bacteria 1029
156 Ga0207664_10155161 3300025929 Bacteria 1948
157 Ga0207644_10710929 3300025931 Bacteria 838
158 Ga0207706_10106784 3300025933 Bacteria 2464
159 Ga0207686_10281542 3300025934 Bacteria 1228
160 Ga0207686_10710077 3300025934 Unclassified 800
161 Ga0207686_11195570 3300025934 Bacteria 622
162 Ga0207709_10052196 3300025935 Bacteria 2510
163 Ga0207670_10777429 3300025936 Bacteria 797
164 Ga0207669_10020490 3300025937 Bacteria 3469
165 Ga0207704_10080534 3300025938 Bacteria 2103
166 Ga0207704_10366284 3300025938 Bacteria 1127
167 Ga0207704_10812046 3300025938 Bacteria 782
168 Ga0207665_10084425 3300025939 Unclassified 2191
169 Ga0207665_10256311 3300025939 Bacteria 1294
170 Ga0207665_10327693 3300025939 Bacteria 1151
171 Ga0207691_10999953 3300025940 Bacteria 698
172 Ga0207691_11078713 3300025940 Unclassified 668
173 Ga0207711_10075582 3300025941 Bacteria 2932
174 Ga0207711_10252727 3300025941 Bacteria 1619
175 Ga0207711_10439618 3300025941 Bacteria 1214
176 Ga0207711_10726718 3300025941 Bacteria 926
177 Ga0207679_11041326 3300025945 Bacteria 750
178 Ga0207679_11582528 3300025945 Bacteria 601
179 Ga0207651_10249635 3300025960 Bacteria 1451
180 Ga0207651_11437464 3300025960 Bacteria 621
181 Ga0207712_11278153 3300025961 Bacteria 656
182 Ga0207703_10115584 3300026035 Bacteria 2296
183 Ga0207703_11322926 3300026035 Bacteria 693
184 Ga0207708_10150742 3300026075 Bacteria 1830
185 Ga0207648_10025407 3300026089 Bacteria 5277
186 Ga0207648_11207190 3300026089 Bacteria 710
187 Ga0207676_10320999 3300026095 Bacteria 1422
188 Ga0207675_100015185 3300026118 Bacteria 7183
189 Ga0207675_100173170 3300026118 Bacteria 2064
190 Ga0207675_100537823 3300026118 Bacteria 1166
191 Ga0207683_10093241 3300026121 Bacteria 2683
192 Ga0268265_10017698 3300028380 Bacteria 4924
193 Ga0268265_10441269 3300028380 Bacteria 1213
194 Ga0268265_11675510 3300028380 Unclassified 641
195 Ga0268264_10663326 3300028381 Bacteria 1033
196 Ga0268264_11326909 3300028381 Bacteria 730
197 Ga0265332_10051776 3300031238 Bacteria 1763
198 Ga0307412_11853954 3300031911 Bacteria 556
199 Ga0373930_0011115 3300034816 Bacteria 1621
200 Ga0373958_0005545 3300034819 Bacteria 1923
201 Ga0373938_0010258 3300034957 Bacteria 1717
202 Ga0373928_0000667 3300035084 Bacteria 6748
203 Ga0373929_0001181 3300035085 Bacteria 5044
204 Ga0373940_0001113 3300035088 Bacteria 4680
205 Ga0373944_0034304 3300035089 Unclassified 1542
206 Ga0373949_0001022 3300035090 Bacteria 8629
207 Ga0373951_0000437 3300035091 Bacteria 12172
208 Ga0373952_0001181 3300035092 Bacteria 4766
209 Ga0373932_0000260 3300035112 Bacteria 16071
210 Ga0373936_0056182 3300035113 Unclassified 1599
211 Ga0373939_0002507 3300035114 Bacteria 4326
212 Ga0373941_0001741 3300035115 Bacteria 4674
213 Ga0373953_0077946 3300035117 Unclassified 1374
214 Ga0373953_0146625 3300035117 Unclassified 1011
215 Ga0373956_0087145 3300035119 Unclassified 1437
216 Ga0373943_0560682 3300035170 Unclassified 671
217 Ga0373946_0027920 3300035171 Bacteria 2235
218 Ga0373955_0133035 3300035172 Bacteria 1453
219 Ga0373942_0002033 3300035207 Bacteria 5023
220 Ga0373961_0000739 3300035241 Bacteria 11301
221 Ga0373962_0001391 3300035242 Bacteria 5708
222 Ga0373962_0159527 3300035242 Unclassified 743
223 Ga0373924_0006482 3300035410 Bacteria 4193
224 Ga0373924_0032754 3300035410 Bacteria 2095
225 Ga0373931_0000499 3300035691 Bacteria 16005
226 Ga0373931_0755284 3300035691 Unclassified 646
227 Ga0373935_0028970 3300035692 Bacteria 3425
228 Ga0373935_0423991 3300035692 Bacteria 958
229 Ga0373933_0837709 3300035724 Unclassified 605
230 Ga0373937_0069370 3300036401 Bacteria 3250
231 Ga0373937_1469602 3300036401 Unclassified 629
232 Ga0373925_0403921 3300037068 Bacteria 1114
233 Ga0395898_1823314 3300037466 Bacteria 529
234 Ga0436365_0088332 3300039437 Bacteria 2114
235 Ga0436363_0884371 3300039450 Bacteria 930
236 Ga0450892_006848 3300042130 Unclassified 953
237 Ga0451576_0027797 3300045051 Bacteria 6070
238 Ga0495592_0049326 3300046454 Bacteria 3129
239 Ga0495653_0836979 3300046463 Bacteria 551
240 Ga0495580_0075702 3300046472 Bacteria 2348
241 Ga0495580_0383057 3300046472 Unclassified 950
242 Ga0495582_0189227 3300046473 Bacteria 1174
243 Ga0495582_0244689 3300046473 Unclassified 1028
244 Ga0495662_0168695 3300046476 Bacteria 1079
245 Ga0495608_0033602 3300046511 Bacteria 3464
246 Ga0495628_0039770 3300046516 Bacteria 3760
247 Ga0495630_0016635 3300046517 Bacteria 5379
248 Ga0495630_0995289 3300046517 Unclassified 637
249 Ga0495652_0615276 3300046529 Bacteria 739
250 Ga0495652_0662453 3300046529 Bacteria 706
251 Ga0495640_0090722 3300046533 Bacteria 2017
252 Ga0495586_0090485 3300046535 Bacteria 1690
253 Ga0495598_0227390 3300046537 Bacteria 683
254 Ga0495645_0008814 3300046543 Bacteria 7045
255 Ga0495667_0054343 3300046559 Bacteria 2635
256 Ga0495635_0102128 3300046663 Bacteria 1960
257 Ga0495635_0278010 3300046663 Bacteria 1125
258 Ga0495659_0257960 3300046664 Unclassified 728
259 Ga0495623_0100888 3300046679 Bacteria 1759
260 Ga0495647_0334628 3300046681 Bacteria 687
261 Ga0495658_0010929 3300046683 Bacteria 4550
262 Ga0495669_0040661 3300046684 Bacteria 2063
263 Ga0495613_0001615 3300046689 Bacteria 17153
264 Ga0495600_0117302 3300046809 Bacteria 1732
265 Ga0495674_0085903 3300047319 Bacteria 2695
266 Ga0495684_0000581 3300047471 Bacteria 29549
267 Ga0496102_0048879 3300048905 Bacteria 3847
268 Ga0496103_0329538 3300048906 Bacteria 982
269 Ga0496114_0111831 3300048917 Bacteria 2341
270 Ga0496114_0306979 3300048917 Bacteria 1401
271 Ga0501031_0907956 3300049568 Unclassified 564
272 Ga0501032_0621253 3300049569 Bacteria 687
273 Ga0501033_0703582 3300049570 Bacteria 687
274 Ga0501034_0171287 3300049571 Bacteria 2138
275 Ga0501036_0179275 3300049572 Bacteria 1784
276 Ga0501038_1106951 3300049574 Bacteria 578
277 Ga0501042_0890965 3300049578 Bacteria 648
278 Ga0501046_0954753 3300049580 Unclassified 596
279 Ga0501067_0033115 3300049583 Bacteria 2868
280 Ga0501071_0658784 3300049587 Bacteria 806
281 Ga0501216_132070 3300049660 Bacteria 580
282 Ga0501035_1120415 3300049822 Unclassified 614
283 Ga0501044_0034532 3300049823 Bacteria 5302
284 nmdc:mga05p37_110685_c1 3300050507 Bacteria 3378
285 nmdc:mga05p37_11442_c1 3300050507 Bacteria 10566
286 nmdc:mga05p37_205172_c1 3300050507 Bacteria 2385
287 nmdc:mga05p37_2137309_c1 3300050507 Unclassified 523
288 nmdc:mga05p37_755091_c1 3300050507 Unclassified 1071
289 nmdc:mga05p37_85235_c1 3300050507 Bacteria 3893
290 nmdc:mga05p37_982672_c1 3300050507 Bacteria 899
291 nmdc:mga08y16_211260_c1 3300050511 Bacteria 2010
292 nmdc:mga08y16_216850_c1 3300050511 Bacteria 1981
293 nmdc:mga08y16_68844_c1 3300050511 Bacteria 2304
294 nmdc:mga0n895_121_c1 3300050512 Bacteria 46448
295 nmdc:mga0n895_1462025_c1 3300050512 Unclassified 651
296 nmdc:mga0n895_27791_c1 3300050512 Bacteria 5377
297 nmdc:mga0n895_309041_c1 3300050512 Bacteria 1602
298 nmdc:mga0n895_373983_c1 3300050512 Bacteria 1442
299 nmdc:mga0n895_376328_c1 3300050512 Bacteria 1437
300 nmdc:mga0n895_681735_c1 3300050512 Bacteria 1025
301 nmdc:mga0n895_90523_c1 3300050512 Bacteria 3061
302 nmdc:mga0rr50_107_c1 3300050513 Bacteria 46254
303 nmdc:mga0rr50_1340843_c1 3300050513 Bacteria 606
304 nmdc:mga0rr50_1341377_c1 3300050513 Bacteria 606
305 nmdc:mga0rr50_190192_c1 3300050513 Bacteria 1682
306 nmdc:mga0rr50_212610_c1 3300050513 Bacteria 1594
307 nmdc:mga0rr50_26985_c1 3300050513 Bacteria 4016
308 nmdc:mga0rr50_628058_c1 3300050513 Bacteria 916
309 nmdc:mga0rr50_65300_c1 3300050513 Bacteria 2756
310 nmdc:mga0rr50_673_c1 3300050513 Bacteria 18292
311 nmdc:mga08x19_108049_c1 3300050514 Bacteria 1853
312 nmdc:mga08x19_1241328_c1 3300050514 Bacteria 528
313 nmdc:mga08x19_967_c1 3300050514 Bacteria 17964
314 nmdc:mga0a205_169293_c1 3300050515 Bacteria 2080
315 nmdc:mga0a205_28219_c1 3300050515 Bacteria 5365
316 nmdc:mga0a205_32323_c1 3300050515 Bacteria 5017
317 nmdc:mga0a205_740118_c1 3300050515 Bacteria 832
318 nmdc:mga0a205_8826_c1 3300050515 Bacteria 9180
319 Ga0495601_0005915 3300053077 Bacteria 7135
320 Ga0495612_0062680 3300053078 Bacteria 1542
321 Ga0495595_0124657 3300053084 Bacteria 1256
322 Ga0495619_0000721 3300053085 Bacteria 21611
323 Ga0495619_0113475 3300053085 Unclassified 1853
324 Ga0495619_0386215 3300053085 Unclassified 967
325 Ga0501084_0467080 3300054114 Bacteria 1067
326 Ga0530510_0426028 3300061734 Bacteria 1002

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_11272178 Ga0105240_112721782 118
2 3300005356 Ga0070674_100011399 Ga0070674_1000113994 126
3 3300026121 Ga0207683_10093241 Ga0207683_100932413 126
4 3300005458 Ga0070681_10339453 Ga0070681_103394532 127
5 3300039450 Ga0436363_0884371 Ga0436363_0884371_25_420 127
6 3300049583 Ga0501067_0033115 Ga0501067_0033115_1401_1808 127
7 3300013297 Ga0157378_10771705 Ga0157378_107717052 128
8 3300035089 Ga0373944_0034304 Ga0373944_0034304_310_708 128
9 3300035113 Ga0373936_0056182 Ga0373936_0056182_112_510 128
10 3300035117 Ga0373953_0146625 Ga0373953_0146625_584_982 128
11 3300035119 Ga0373956_0087145 Ga0373956_0087145_790_1188 128
12 3300035170 Ga0373943_0560682 Ga0373943_0560682_108_506 128
13 3300035171 Ga0373946_0027920 Ga0373946_0027920_1338_1736 128
14 3300035410 Ga0373924_0006482 Ga0373924_0006482_1162_1560 128
15 3300035692 Ga0373935_0028970 Ga0373935_0028970_2561_2959 128
16 3300035724 Ga0373933_0837709 Ga0373933_0837709_185_583 128
17 3300036401 Ga0373937_1469602 Ga0373937_1469602_120_518 128
18 3300037068 Ga0373925_0403921 Ga0373925_0403921_458_856 128
19 3300046454 Ga0495592_0049326 Ga0495592_0049326_865_1263 128
20 3300046463 Ga0495653_0836979 Ga0495653_0836979_19_417 128
21 3300046472 Ga0495580_0075702 Ga0495580_0075702_1256_1654 128
22 3300046472 Ga0495580_0383057 Ga0495580_0383057_528_926 128
23 3300046476 Ga0495662_0168695 Ga0495662_0168695_671_1069 128
24 3300046511 Ga0495608_0033602 Ga0495608_0033602_1492_1890 128
25 3300046516 Ga0495628_0039770 Ga0495628_0039770_2412_2810 128
26 3300046517 Ga0495630_0016635 Ga0495630_0016635_2728_3126 128
27 3300046517 Ga0495630_0995289 Ga0495630_0995289_37_435 128
28 3300046529 Ga0495652_0615276 Ga0495652_0615276_39_437 128
29 3300046529 Ga0495652_0662453 Ga0495652_0662453_41_487 128
30 3300046533 Ga0495640_0090722 Ga0495640_0090722_1172_1570 128
31 3300046535 Ga0495586_0090485 Ga0495586_0090485_1038_1436 128
32 3300046559 Ga0495667_0054343 Ga0495667_0054343_716_1114 128
33 3300046663 Ga0495635_0278010 Ga0495635_0278010_453_851 128
34 3300046679 Ga0495623_0100888 Ga0495623_0100888_963_1409 128
35 3300046681 Ga0495647_0334628 Ga0495647_0334628_202_600 128
36 3300046689 Ga0495613_0001615 Ga0495613_0001615_12411_12809 128
37 3300046809 Ga0495600_0117302 Ga0495600_0117302_886_1284 128
38 3300047471 Ga0495684_0000581 Ga0495684_0000581_8516_8914 128
39 3300048917 Ga0496114_0111831 Ga0496114_0111831_834_1232 128
40 3300053077 Ga0495601_0005915 Ga0495601_0005915_3414_3812 128
41 3300053078 Ga0495612_0062680 Ga0495612_0062680_707_1105 128
42 3300053084 Ga0495595_0124657 Ga0495595_0124657_687_1133 128
43 3300053085 Ga0495619_0000721 Ga0495619_0000721_19816_20214 128
44 3300053085 Ga0495619_0386215 Ga0495619_0386215_138_584 128
45 3300005295 Ga0065707_10125686 Ga0065707_101256862 129
46 3300005295 Ga0065707_10330832 Ga0065707_103308322 129
47 3300005331 Ga0070670_100751183 Ga0070670_1007511832 129
48 3300005334 Ga0068869_101302298 Ga0068869_1013022981 129
49 3300005339 Ga0070660_100025972 Ga0070660_1000259724 129
50 3300005339 Ga0070660_101038231 Ga0070660_1010382311 129
51 3300005345 Ga0070692_10090847 Ga0070692_100908472 129
52 3300005347 Ga0070668_100114514 Ga0070668_1001145144 129
53 3300005353 Ga0070669_100096150 Ga0070669_1000961504 129
54 3300005355 Ga0070671_101137928 Ga0070671_1011379281 129
55 3300005356 Ga0070674_100011077 Ga0070674_1000110775 129
56 3300005364 Ga0070673_100038209 Ga0070673_1000382092 129
57 3300005364 Ga0070673_101375862 Ga0070673_1013758621 129
58 3300005365 Ga0070688_100005782 Ga0070688_1000057826 129
59 3300005441 Ga0070700_100185163 Ga0070700_1001851632 129
60 3300005445 Ga0070708_100149315 Ga0070708_1001493152 129
61 3300005445 Ga0070708_100195830 Ga0070708_1001958304 129
62 3300005445 Ga0070708_100723590 Ga0070708_1007235902 129
63 3300005458 Ga0070681_10077107 Ga0070681_100771072 129
64 3300005458 Ga0070681_10340302 Ga0070681_103403023 129
65 3300005459 Ga0068867_100029045 Ga0068867_1000290455 129
66 3300005467 Ga0070706_100879302 Ga0070706_1008793022 129
67 3300005468 Ga0070707_100096405 Ga0070707_1000964052 129
68 3300005468 Ga0070707_101308529 Ga0070707_1013085291 129
69 3300005471 Ga0070698_100145785 Ga0070698_1001457854 129
70 3300005471 Ga0070698_101866463 Ga0070698_1018664631 129
71 3300005518 Ga0070699_100265041 Ga0070699_1002650412 129
72 3300005518 Ga0070699_101258072 Ga0070699_1012580721 129
73 3300005530 Ga0070679_100455678 Ga0070679_1004556782 129
74 3300005535 Ga0070684_101080359 Ga0070684_1010803591 129
75 3300005536 Ga0070697_100819076 Ga0070697_1008190761 129
76 3300005543 Ga0070672_101699133 Ga0070672_1016991331 129
77 3300005544 Ga0070686_100668336 Ga0070686_1006683361 129
78 3300005545 Ga0070695_100141820 Ga0070695_1001418203 129
79 3300005546 Ga0070696_100325404 Ga0070696_1003254042 129
80 3300005546 Ga0070696_100715956 Ga0070696_1007159561 129
81 3300005563 Ga0068855_100215749 Ga0068855_1002157493 129
82 3300005564 Ga0070664_100076190 Ga0070664_1000761904 129
83 3300005617 Ga0068859_100065990 Ga0068859_1000659904 129
84 3300005617 Ga0068859_100363655 Ga0068859_1003636551 129
85 3300005617 Ga0068859_102283473 Ga0068859_1022834731 129
86 3300005618 Ga0068864_100500405 Ga0068864_1005004051 129
87 3300005718 Ga0068866_10226077 Ga0068866_102260772 129
88 3300005719 Ga0068861_100153040 Ga0068861_1001530402 129
89 3300005719 Ga0068861_100702572 Ga0068861_1007025721 129
90 3300005842 Ga0068858_100392813 Ga0068858_1003928132 129
91 3300005842 Ga0068858_100996014 Ga0068858_1009960142 129
92 3300005843 Ga0068860_100509706 Ga0068860_1005097062 129
93 3300005844 Ga0068862_100368369 Ga0068862_1003683692 129
94 3300006173 Ga0070716_100073686 Ga0070716_1000736862 129
95 3300006173 Ga0070716_100616409 Ga0070716_1006164092 129
96 3300006173 Ga0070716_101214251 Ga0070716_1012142511 129
97 3300006237 Ga0097621_100639711 Ga0097621_1006397112 129
98 3300006358 Ga0068871_100097236 Ga0068871_1000972362 129
99 3300006358 Ga0068871_100198360 Ga0068871_1001983602 129
100 3300006358 Ga0068871_100615096 Ga0068871_1006150961 129
101 3300006844 Ga0075428_100142612 Ga0075428_1001426124 129
102 3300006844 Ga0075428_101037974 Ga0075428_1010379742 129
103 3300006846 Ga0075430_101397050 Ga0075430_1013970501 129
104 3300006852 Ga0075433_10039646 Ga0075433_100396462 129
105 3300006871 Ga0075434_100002495 Ga0075434_1000024957 129
106 3300006871 Ga0075434_100003115 Ga0075434_10000311511 129
107 3300006871 Ga0075434_100065891 Ga0075434_1000658914 129
108 3300006871 Ga0075434_100080294 Ga0075434_1000802945 129
109 3300006871 Ga0075434_100828845 Ga0075434_1008288452 129
110 3300006881 Ga0068865_100181952 Ga0068865_1001819522 129
111 3300006881 Ga0068865_101613918 Ga0068865_1016139181 129
112 3300006914 Ga0075436_100001718 Ga0075436_10000171814 129
113 3300006914 Ga0075436_100369534 Ga0075436_1003695341 129
114 3300006914 Ga0075436_100423825 Ga0075436_1004238252 129
115 3300006914 Ga0075436_101147824 Ga0075436_1011478241 129
116 3300006931 Ga0097620_100065989 Ga0097620_1000659894 129
117 3300006931 Ga0097620_100363619 Ga0097620_1003636191 129
118 3300006931 Ga0097620_102283694 Ga0097620_1022836941 129
119 3300007076 Ga0075435_100000189 Ga0075435_1000001899 129
120 3300007076 Ga0075435_100006656 Ga0075435_1000066567 129
121 3300007076 Ga0075435_100059349 Ga0075435_1000593493 129
122 3300007076 Ga0075435_100120211 Ga0075435_1001202112 129
123 3300009094 Ga0111539_10385000 Ga0111539_103850002 129
124 3300009098 Ga0105245_10020467 Ga0105245_100204676 129
125 3300009147 Ga0114129_10000973 Ga0114129_1000097323 129
126 3300009147 Ga0114129_10597947 Ga0114129_105979472 129
127 3300009148 Ga0105243_10023948 Ga0105243_100239483 129
128 3300009148 Ga0105243_10482396 Ga0105243_104823962 129
129 3300009174 Ga0105241_10039422 Ga0105241_100394222 129
130 3300009176 Ga0105242_10007403 Ga0105242_100074031 129
131 3300009176 Ga0105242_10737792 Ga0105242_107377922 129
132 3300009176 Ga0105242_11089488 Ga0105242_110894882 129
133 3300009176 Ga0105242_11994746 Ga0105242_119947461 129
134 3300009177 Ga0105248_10027872 Ga0105248_100278723 129
135 3300009177 Ga0105248_10048515 Ga0105248_100485152 129
136 3300009177 Ga0105248_10104341 Ga0105248_101043414 129
137 3300009177 Ga0105248_10125905 Ga0105248_101259054 129
138 3300009177 Ga0105248_10391843 Ga0105248_103918432 129
139 3300009177 Ga0105248_10541905 Ga0105248_105419051 129
140 3300009177 Ga0105248_10559297 Ga0105248_105592972 129
141 3300009177 Ga0105248_13271008 Ga0105248_132710081 129
142 3300009545 Ga0105237_10698250 Ga0105237_106982501 129
143 3300009545 Ga0105237_11555671 Ga0105237_115556711 129
144 3300009553 Ga0105249_10098631 Ga0105249_100986313 129
145 3300013296 Ga0157374_10043351 Ga0157374_100433512 129
146 3300013306 Ga0163162_10147068 Ga0163162_101470683 129
147 3300013307 Ga0157372_10988599 Ga0157372_109885992 129
148 3300013308 Ga0157375_10065002 Ga0157375_100650022 129
149 3300013308 Ga0157375_11136591 Ga0157375_111365912 129
150 3300013308 Ga0157375_11531173 Ga0157375_115311731 129
151 3300014325 Ga0163163_10500475 Ga0163163_105004751 129
152 3300014325 Ga0163163_10726482 Ga0163163_107264822 129
153 3300014325 Ga0163163_11220885 Ga0163163_112208852 129
154 3300014326 Ga0157380_10035180 Ga0157380_100351805 129
155 3300014968 Ga0157379_10115860 Ga0157379_101158603 129
156 3300014968 Ga0157379_10219349 Ga0157379_102193492 129
157 3300017792 Ga0163161_10495944 Ga0163161_104959442 129
158 3300025899 Ga0207642_10003940 Ga0207642_100039406 129
159 3300025899 Ga0207642_10370416 Ga0207642_103704162 129
160 3300025903 Ga0207680_10005172 Ga0207680_100051722 129
161 3300025910 Ga0207684_10291644 Ga0207684_102916443 129
162 3300025910 Ga0207684_10567544 Ga0207684_105675442 129
163 3300025911 Ga0207654_10043032 Ga0207654_100430323 129
164 3300025912 Ga0207707_10578604 Ga0207707_105786042 129
165 3300025919 Ga0207657_10952518 Ga0207657_109525182 129
166 3300025921 Ga0207652_10370003 Ga0207652_103700032 129
167 3300025922 Ga0207646_10142046 Ga0207646_101420463 129
168 3300025922 Ga0207646_11050181 Ga0207646_110501812 129
169 3300025923 Ga0207681_10046355 Ga0207681_100463553 129
170 3300025923 Ga0207681_10920981 Ga0207681_109209812 129
171 3300025925 Ga0207650_10487268 Ga0207650_104872682 129
172 3300025931 Ga0207644_10710929 Ga0207644_107109292 129
173 3300025933 Ga0207706_10106784 Ga0207706_101067843 129
174 3300025934 Ga0207686_10281542 Ga0207686_102815422 129
175 3300025934 Ga0207686_10710077 Ga0207686_107100772 129
176 3300025934 Ga0207686_11195570 Ga0207686_111955702 129
177 3300025935 Ga0207709_10052196 Ga0207709_100521963 129
178 3300025936 Ga0207670_10777429 Ga0207670_107774292 129
179 3300025937 Ga0207669_10020490 Ga0207669_100204903 129
180 3300025938 Ga0207704_10080534 Ga0207704_100805343 129
181 3300025938 Ga0207704_10366284 Ga0207704_103662842 129
182 3300025938 Ga0207704_10812046 Ga0207704_108120462 129
183 3300025939 Ga0207665_10084425 Ga0207665_100844253 129
184 3300025939 Ga0207665_10327693 Ga0207665_103276932 129
185 3300025940 Ga0207691_10999953 Ga0207691_109999531 129
186 3300025940 Ga0207691_11078713 Ga0207691_110787131 129
187 3300025941 Ga0207711_10075582 Ga0207711_100755822 129
188 3300025941 Ga0207711_10252727 Ga0207711_102527272 129
189 3300025941 Ga0207711_10439618 Ga0207711_104396182 129
190 3300025941 Ga0207711_10726718 Ga0207711_107267182 129
191 3300025945 Ga0207679_11041326 Ga0207679_110413262 129
192 3300025945 Ga0207679_11582528 Ga0207679_115825281 129
193 3300025960 Ga0207651_10249635 Ga0207651_102496352 129
194 3300025960 Ga0207651_11437464 Ga0207651_114374641 129
195 3300025961 Ga0207712_11278153 Ga0207712_112781531 129
196 3300026035 Ga0207703_10115584 Ga0207703_101155842 129
197 3300026035 Ga0207703_11322926 Ga0207703_113229261 129
198 3300026075 Ga0207708_10150742 Ga0207708_101507422 129
199 3300026089 Ga0207648_10025407 Ga0207648_100254072 129
200 3300026089 Ga0207648_11207190 Ga0207648_112071901 129
201 3300026095 Ga0207676_10320999 Ga0207676_103209993 129
202 3300026118 Ga0207675_100015185 Ga0207675_1000151854 129
203 3300026118 Ga0207675_100173170 Ga0207675_1001731703 129
204 3300026118 Ga0207675_100537823 Ga0207675_1005378232 129
205 3300028380 Ga0268265_10017698 Ga0268265_100176986 129
206 3300028380 Ga0268265_10441269 Ga0268265_104412692 129
207 3300028381 Ga0268264_10663326 Ga0268264_106633262 129
208 3300028381 Ga0268264_11326909 Ga0268264_113269092 129
209 3300031238 Ga0265332_10051776 Ga0265332_100517762 129
210 3300031911 Ga0307412_11853954 Ga0307412_118539541 129
211 3300034816 Ga0373930_0011115 Ga0373930_0011115_1066_1467 129
212 3300034819 Ga0373958_0005545 Ga0373958_0005545_1097_1498 129
213 3300034957 Ga0373938_0010258 Ga0373938_0010258_86_487 129
214 3300035084 Ga0373928_0000667 Ga0373928_0000667_5284_5685 129
215 3300035085 Ga0373929_0001181 Ga0373929_0001181_3272_3673 129
216 3300035088 Ga0373940_0001113 Ga0373940_0001113_47_448 129
217 3300035090 Ga0373949_0001022 Ga0373949_0001022_7134_7535 129
218 3300035091 Ga0373951_0000437 Ga0373951_0000437_5687_6088 129
219 3300035092 Ga0373952_0001181 Ga0373952_0001181_1313_1714 129
220 3300035112 Ga0373932_0000260 Ga0373932_0000260_11919_12320 129
221 3300035114 Ga0373939_0002507 Ga0373939_0002507_1477_1878 129
222 3300035115 Ga0373941_0001741 Ga0373941_0001741_1239_1640 129
223 3300035117 Ga0373953_0077946 Ga0373953_0077946_911_1315 129
224 3300035172 Ga0373955_0133035 Ga0373955_0133035_362_766 129
225 3300035207 Ga0373942_0002033 Ga0373942_0002033_1154_1555 129
226 3300035241 Ga0373961_0000739 Ga0373961_0000739_9572_9973 129
227 3300035242 Ga0373962_0001391 Ga0373962_0001391_4468_4869 129
228 3300035242 Ga0373962_0159527 Ga0373962_0159527_12_422 129
229 3300035410 Ga0373924_0032754 Ga0373924_0032754_1662_2066 129
230 3300035691 Ga0373931_0000499 Ga0373931_0000499_11094_11495 129
231 3300035691 Ga0373931_0755284 Ga0373931_0755284_90_518 129
232 3300035692 Ga0373935_0423991 Ga0373935_0423991_99_500 129
233 3300036401 Ga0373937_0069370 Ga0373937_0069370_2222_2626 129
234 3300039437 Ga0436365_0088332 Ga0436365_0088332_1235_1648 129
235 3300045051 Ga0451576_0027797 Ga0451576_0027797_4163_4564 129
236 3300046473 Ga0495582_0189227 Ga0495582_0189227_213_614 129
237 3300046473 Ga0495582_0244689 Ga0495582_0244689_14_415 129
238 3300046537 Ga0495598_0227390 Ga0495598_0227390_55_456 129
239 3300046543 Ga0495645_0008814 Ga0495645_0008814_6411_6815 129
240 3300046663 Ga0495635_0102128 Ga0495635_0102128_1250_1654 129
241 3300046664 Ga0495659_0257960 Ga0495659_0257960_13_423 129
242 3300046683 Ga0495658_0010929 Ga0495658_0010929_2917_3318 129
243 3300046684 Ga0495669_0040661 Ga0495669_0040661_606_1019 129
244 3300047319 Ga0495674_0085903 Ga0495674_0085903_517_921 129
245 3300048905 Ga0496102_0048879 Ga0496102_0048879_2101_2502 129
246 3300048906 Ga0496103_0329538 Ga0496103_0329538_353_754 129
247 3300048917 Ga0496114_0306979 Ga0496114_0306979_88_489 129
248 3300049568 Ga0501031_0907956 Ga0501031_0907956_28_423 129
249 3300049569 Ga0501032_0621253 Ga0501032_0621253_252_647 129
250 3300049570 Ga0501033_0703582 Ga0501033_0703582_36_431 129
251 3300049571 Ga0501034_0171287 Ga0501034_0171287_1666_2061 129
252 3300049572 Ga0501036_0179275 Ga0501036_0179275_576_971 129
253 3300049574 Ga0501038_1106951 Ga0501038_1106951_83_484 129
254 3300049578 Ga0501042_0890965 Ga0501042_0890965_191_592 129
255 3300049580 Ga0501046_0954753 Ga0501046_0954753_66_461 129
256 3300049587 Ga0501071_0658784 Ga0501071_0658784_319_720 129
257 3300049660 Ga0501216_132070 Ga0501216_132070_39_443 129
258 3300049822 Ga0501035_1120415 Ga0501035_1120415_61_456 129
259 3300049823 Ga0501044_0034532 Ga0501044_0034532_1454_1849 129
260 3300050507 nmdc:mga05p37_110685_c1 nmdc:mga05p37_110685_c1_766_1161 129
261 3300050507 nmdc:mga05p37_205172_c1 nmdc:mga05p37_205172_c1_1085_1486 129
262 3300050507 nmdc:mga05p37_755091_c1 nmdc:mga05p37_755091_c1_497_898 129
263 3300050507 nmdc:mga05p37_85235_c1 nmdc:mga05p37_85235_c1_1535_1936 129
264 3300050507 nmdc:mga05p37_982672_c1 nmdc:mga05p37_982672_c1_230_631 129
265 3300050511 nmdc:mga08y16_211260_c1 nmdc:mga08y16_211260_c1_843_1253 129
266 3300050511 nmdc:mga08y16_216850_c1 nmdc:mga08y16_216850_c1_203_604 129
267 3300050511 nmdc:mga08y16_68844_c1 nmdc:mga08y16_68844_c1_1639_2040 129
268 3300050512 nmdc:mga0n895_121_c1 nmdc:mga0n895_121_c1_30424_30825 129
269 3300050512 nmdc:mga0n895_1462025_c1 nmdc:mga0n895_1462025_c1_81_482 129
270 3300050512 nmdc:mga0n895_27791_c1 nmdc:mga0n895_27791_c1_3883_4278 129
271 3300050512 nmdc:mga0n895_376328_c1 nmdc:mga0n895_376328_c1_400_801 129
272 3300050512 nmdc:mga0n895_681735_c1 nmdc:mga0n895_681735_c1_162_563 129
273 3300050512 nmdc:mga0n895_90523_c1 nmdc:mga0n895_90523_c1_1898_2386 129
274 3300050513 nmdc:mga0rr50_107_c1 nmdc:mga0rr50_107_c1_30424_30825 129
275 3300050513 nmdc:mga0rr50_1341377_c1 nmdc:mga0rr50_1341377_c1_92_493 129
276 3300050513 nmdc:mga0rr50_190192_c1 nmdc:mga0rr50_190192_c1_761_1162 129
277 3300050513 nmdc:mga0rr50_26985_c1 nmdc:mga0rr50_26985_c1_1749_2144 129
278 3300050513 nmdc:mga0rr50_65300_c1 nmdc:mga0rr50_65300_c1_530_931 129
279 3300050513 nmdc:mga0rr50_673_c1 nmdc:mga0rr50_673_c1_11080_11481 129
280 3300050514 nmdc:mga08x19_108049_c1 nmdc:mga08x19_108049_c1_175_570 129
281 3300050514 nmdc:mga08x19_1241328_c1 nmdc:mga08x19_1241328_c1_96_497 129
282 3300050514 nmdc:mga08x19_967_c1 nmdc:mga08x19_967_c1_885_1286 129
283 3300050515 nmdc:mga0a205_169293_c1 nmdc:mga0a205_169293_c1_110_520 129
284 3300050515 nmdc:mga0a205_28219_c1 nmdc:mga0a205_28219_c1_3802_4203 129
285 3300050515 nmdc:mga0a205_740118_c1 nmdc:mga0a205_740118_c1_249_650 129
286 3300050515 nmdc:mga0a205_8826_c1 nmdc:mga0a205_8826_c1_4602_4997 129
287 3300053085 Ga0495619_0113475 Ga0495619_0113475_363_767 129
288 3300054114 Ga0501084_0467080 Ga0501084_0467080_620_1021 129
289 3300061734 Ga0530510_0426028 Ga0530510_0426028_375_776 129
290 3300005435 Ga0070714_100249215 Ga0070714_1002492152 130
291 3300005439 Ga0070711_100266943 Ga0070711_1002669432 130
292 3300005518 Ga0070699_101540473 Ga0070699_1015404731 130
293 3300009093 Ga0105240_10846222 Ga0105240_108462222 130
294 3300014326 Ga0157380_10961448 Ga0157380_109614482 130
295 3300025929 Ga0207664_10155161 Ga0207664_101551612 130
296 3300042130 Ga0450892_006848 Ga0450892_006848_173_589 130
297 3300005458 Ga0070681_11931369 Ga0070681_119313691 131
298 3300005471 Ga0070698_100621967 Ga0070698_1006219671 131
299 3300005471 Ga0070698_100802254 Ga0070698_1008022541 131
300 3300005518 Ga0070699_100004418 Ga0070699_10000441810 131
301 3300005536 Ga0070697_100410372 Ga0070697_1004103722 131
302 3300006871 Ga0075434_101358500 Ga0075434_1013585001 131
303 3300006914 Ga0075436_100024319 Ga0075436_1000243192 131
304 3300007076 Ga0075435_100169764 Ga0075435_1001697642 131
305 3300007076 Ga0075435_100374421 Ga0075435_1003744211 131
306 3300009093 Ga0105240_10007971 Ga0105240_100079717 131
307 3300009147 Ga0114129_10028157 Ga0114129_100281575 131
308 3300013307 Ga0157372_12858407 Ga0157372_128584071 131
309 3300025912 Ga0207707_11522182 Ga0207707_115221821 131
310 3300025913 Ga0207695_10104626 Ga0207695_101046263 131
311 3300025922 Ga0207646_10139142 Ga0207646_101391424 131
312 3300025939 Ga0207665_10256311 Ga0207665_102563111 131
313 3300028380 Ga0268265_11675510 Ga0268265_116755101 131
314 3300037466 Ga0395898_1823314 Ga0395898_1823314_51_458 131
315 3300050507 nmdc:mga05p37_11442_c1 nmdc:mga05p37_11442_c1_5437_5853 131
316 3300050507 nmdc:mga05p37_2137309_c1 nmdc:mga05p37_2137309_c1_48_464 131
317 3300050512 nmdc:mga0n895_309041_c1 nmdc:mga0n895_309041_c1_138_545 131
318 3300050512 nmdc:mga0n895_373983_c1 nmdc:mga0n895_373983_c1_543_953 131
319 3300050513 nmdc:mga0rr50_1340843_c1 nmdc:mga0rr50_1340843_c1_107_523 131
320 3300050513 nmdc:mga0rr50_212610_c1 nmdc:mga0rr50_212610_c1_109_516 131
321 3300050513 nmdc:mga0rr50_628058_c1 nmdc:mga0rr50_628058_c1_13_423 131
322 3300050515 nmdc:mga0a205_32323_c1 nmdc:mga0a205_32323_c1_1939_2355 131
323 3300003203 JGI25406J46586_10249579 JGI25406J46586_102495791 132
324 3300005985 Ga0081539_10012417 Ga0081539_100124171 132
325 3300006852 Ga0075433_10026002 Ga0075433_100260024 132
326 3300007076 Ga0075435_100176884 Ga0075435_1001768843 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

42

154

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3crn-assembly1.cif.gz_B crystal structure of response regulator receiver domain protein (chey-like) from methanospirillum hungatei jf-1 0.9363 6 129
1mb0-assembly1.cif.gz_A crystal structure of the response regulator divk at ph 8.0 in complex with mn2+ 0.9343 7 126
4jav-assembly1.cif.gz_D structural basis of a rationally rewired protein-protein interface (hk853wt and rr468mutant v13p, l14i, i17m and n21v) 0.9313 7 126
4h60-assembly1.cif.gz_A high resolution structure of vibrio cholerae chemotaxis protein chey4 crystallized in low ph (4.0) condition 0.9307 6 126
6rh1-assembly1.cif.gz_C revisiting ph-gated conformational switch. complex hk853-rr468 d53a ph 7 0.9306 7 126
ID Description Score Start End Superfamily
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9783 5 86 3.40.50.2300
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9765 7 88 3.40.50.2300
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.971 9 86 3.40.50.2300
af_P71814_19_100_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9679 9 88 3.40.50.2300
af_P0AFJ5_1_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9669 6 88 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7Y4WUL5-F1-model_v4 Response regulator 0.9984 7 126 GO:0000160
AF-A0A1F2SAK9-F1-model_v4 Response regulatory domain-containing protein 0.9984 11 126 GO:0000160
AF-A0A523DHC3-F1-model_v4 Response regulator 0.9966 5 127 GO:0000160
AF-A0A2V7ZQ07-F1-model_v4 Response regulator 0.9808 3 127 GO:0000160
AF-A0A2V8GW30-F1-model_v4 Response regulatory domain-containing protein 0.9805 3 126 GO:0000160

Feature Viewer

pLDDT pTM Quality
89.52 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map