F408285

General Info

Members Datasets Scaffolds Average Seq Length
326 240 652 140

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10326587|Ga0105241_103265873
Length 168
Sequence MSVSHNANRPGDERRCKRLRQVQSNGETEMRFMMLMIPRGYEAAAPGTMPPADAVAAMMKYNEALKEAGVLITLDGLHPPSMGARVSFPGGKPVVTDGPFTEAKEVLGGYWMIEVNSKEEAIAWARKCPASNNEIIDIRQVQEMADFPPDVQEAAAGFAELQAGSGKN

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
78 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
121 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
122 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
123 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
124 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
125 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
131 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
132 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
133 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
135 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
136 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
137 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
165 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
166 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
167 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
168 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
169 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
170 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
171 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
172 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
173 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
174 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
175 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
179 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
180 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
181 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
182 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
183 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
184 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
185 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
186 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
187 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
188 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
189 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
190 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
191 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
192 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
193 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
194 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
197 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
198 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
199 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
205 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
206 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
207 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
213 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
214 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
215 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
220 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
221 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
222 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
229 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
230 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
231 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
232 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
233 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
234 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
235 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
236 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
237 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
238 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
239 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
240 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.98
Nodule 0
Rhizoplane 1.53
Rhizosphere 86.81
Stem 0
Stem Tuber 0
Unclassified 0.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_10326587 3300009174 Bacteria 1325
2 Ga0055526_1012772 3300003771 Bacteria 3626
3 Ga0065712_10227794 3300005290 Bacteria 1021
4 Ga0070658_10241218 3300005327 Bacteria 1532
5 Ga0070676_10140724 3300005328 Bacteria 1536
6 Ga0070683_100557683 3300005329 Bacteria 1095
7 Ga0070683_100677417 3300005329 Bacteria 987
8 Ga0070683_100935999 3300005329 Bacteria 831
9 Ga0068868_100176145 3300005338 Bacteria 1772
10 Ga0070660_100166498 3300005339 Bacteria 1778
11 Ga0070671_100027724 3300005355 Bacteria 4664
12 Ga0070671_100650396 3300005355 Bacteria 913
13 Ga0070674_100000408 3300005356 Bacteria 21620
14 Ga0070703_10032602 3300005406 Bacteria 1583
15 Ga0070709_10012057 3300005434 Bacteria 4832
16 Ga0070709_10463481 3300005434 Bacteria 957
17 Ga0070714_100524377 3300005435 Bacteria 1132
18 Ga0070713_100001186 3300005436 Bacteria 16637
19 Ga0070713_100780770 3300005436 Bacteria 915
20 Ga0070710_10047262 3300005437 Bacteria 2400
21 Ga0070711_100008851 3300005439 Bacteria 6178
22 Ga0070700_100452008 3300005441 Bacteria 978
23 Ga0070678_100160417 3300005456 Bacteria 1821
24 Ga0070662_100266876 3300005457 Bacteria 1381
25 Ga0070681_10057575 3300005458 Bacteria 3867
26 Ga0068867_100000216 3300005459 Bacteria 37983
27 Ga0068867_100041984 3300005459 Bacteria 3343
28 Ga0068867_100241351 3300005459 Bacteria 1466
29 Ga0070679_100256152 3300005530 Bacteria 1705
30 Ga0070679_100671441 3300005530 Bacteria 979
31 Ga0070679_100759348 3300005530 Bacteria 913
32 Ga0070684_100500457 3300005535 Bacteria 1125
33 Ga0068853_100031087 3300005539 Bacteria 4514
34 Ga0070672_100281994 3300005543 Bacteria 1405
35 Ga0068855_100003442 3300005563 Bacteria 19362
36 Ga0070664_100260726 3300005564 Bacteria 1560
37 Ga0068857_101492800 3300005577 Bacteria 658
38 Ga0068854_100362395 3300005578 Bacteria 1190
39 Ga0068856_100071685 3300005614 Bacteria 3430
40 Ga0068856_101368448 3300005614 Bacteria 722
41 Ga0068859_100233198 3300005617 Bacteria 1929
42 Ga0068859_102145520 3300005617 Bacteria 617
43 Ga0068866_10001043 3300005718 Bacteria 12206
44 Ga0068858_100598073 3300005842 Bacteria 1070
45 Ga0068860_101297545 3300005843 Bacteria 749
46 Ga0068862_100003947 3300005844 Bacteria 12611
47 Ga0068862_100178016 3300005844 Bacteria 1907
48 Ga0081538_10119133 3300005981 Bacteria 1273
49 Ga0081540_1014267 3300005983 Bacteria 5102
50 Ga0070717_10607790 3300006028 Bacteria 992
51 Ga0075365_10647451 3300006038 Bacteria 747
52 Ga0075368_10255429 3300006042 Bacteria 749
53 Ga0075363_100476293 3300006048 Bacteria 740
54 Ga0075364_10233913 3300006051 Bacteria 1248
55 Ga0075432_10002159 3300006058 Bacteria 6550
56 Ga0070716_100050599 3300006173 Bacteria 2359
57 Ga0070712_100200936 3300006175 Bacteria 1566
58 Ga0075367_10031036 3300006178 Bacteria 3068
59 Ga0075367_10062335 3300006178 Bacteria 2227
60 Ga0075370_10005465 3300006353 Bacteria 6320
61 Ga0068871_100157902 3300006358 Bacteria 1938
62 Ga0075428_101544084 3300006844 Bacteria 695
63 Ga0075430_100111150 3300006846 Bacteria 2285
64 Ga0075431_101627650 3300006847 Bacteria 603
65 Ga0075433_10016255 3300006852 Bacteria 6124
66 Ga0075436_100004940 3300006914 Bacteria 9163
67 Ga0097620_100233194 3300006931 Bacteria 1929
68 Ga0097620_102145975 3300006931 Bacteria 617
69 Ga0075435_100020979 3300007076 Bacteria 5018
70 Ga0105240_10231744 3300009093 Bacteria 2146
71 Ga0105240_10871692 3300009093 Unclassified 970
72 Ga0105245_10095344 3300009098 Bacteria 2745
73 Ga0105245_10165664 3300009098 Bacteria 2101
74 Ga0105247_10387898 3300009101 Bacteria 992
75 Ga0114129_12100329 3300009147 Bacteria 681
76 Ga0105243_10398999 3300009148 Bacteria 1277
77 Ga0105241_10795810 3300009174 Bacteria 871
78 Ga0105242_10052110 3300009176 Bacteria 3338
79 Ga0105248_10118397 3300009177 Bacteria 2988
80 Ga0105237_10159912 3300009545 Bacteria 2251
81 Ga0105238_10071900 3300009551 Bacteria 3456
82 Ga0105238_10108450 3300009551 Bacteria 2758
83 Ga0105238_10378202 3300009551 Bacteria 1407
84 Ga0105239_10021101 3300010375 Bacteria 7187
85 Ga0105239_10040825 3300010375 Bacteria 5084
86 Ga0105246_10025762 3300011119 Bacteria 3835
87 Ga0105246_10160750 3300011119 Bacteria 1711
88 Ga0105246_10480727 3300011119 Bacteria 1051
89 Ga0157373_10230809 3300013100 Bacteria 1307
90 Ga0157370_10794037 3300013104 Bacteria 861
91 Ga0157369_10251334 3300013105 Bacteria 1845
92 Ga0157369_10735697 3300013105 Bacteria 1015
93 Ga0157378_10000477 3300013297 Bacteria 38086
94 Ga0157378_10318263 3300013297 Bacteria 1511
95 Ga0163162_10011321 3300013306 Bacteria 8698
96 Ga0163163_10147312 3300014325 Bacteria 2398
97 Ga0157380_10014708 3300014326 Bacteria 5731
98 Ga0157380_10245514 3300014326 Bacteria 1617
99 Ga0157376_11316848 3300014969 Bacteria 753
100 Ga0163161_10061871 3300017792 Bacteria 2726
101 Ga0213875_10181979 3300021388 Bacteria 987
102 Ga0209129_1001573 3300025258 Bacteria 12529
103 Ga0209565_1023232 3300025263 Bacteria 1275
104 Ga0209025_1000129 3300025294 Bacteria 198847
105 Ga0209025_1033043 3300025294 Bacteria 2402
106 Ga0209564_1001449 3300025295 Bacteria 24206
107 Ga0209758_1001266 3300025297 Bacteria 31302
108 Ga0207656_10110011 3300025321 Bacteria 1272
109 Ga0207642_10026876 3300025899 Bacteria 2349
110 Ga0207680_10235699 3300025903 Bacteria 1259
111 Ga0207699_10132270 3300025906 Bacteria 1629
112 Ga0207645_10000208 3300025907 Bacteria 48175
113 Ga0207645_10209402 3300025907 Bacteria 1284
114 Ga0207643_10199761 3300025908 Bacteria 1217
115 Ga0207654_10161569 3300025911 Bacteria 1448
116 Ga0207654_10784479 3300025911 Bacteria 688
117 Ga0207707_10019818 3300025912 Bacteria 5872
118 Ga0207695_10303298 3300025913 Bacteria 1488
119 Ga0207695_10519306 3300025913 Bacteria 1073
120 Ga0207695_10645761 3300025913 Unclassified 939
121 Ga0207660_10030322 3300025917 Bacteria 3717
122 Ga0207657_10198989 3300025919 Bacteria 1613
123 Ga0207652_10025815 3300025921 Bacteria 4888
124 Ga0207652_10779871 3300025921 Bacteria 850
125 Ga0207694_10129117 3300025924 Bacteria 2025
126 Ga0207694_10167547 3300025924 Bacteria 1777
127 Ga0207700_10707336 3300025928 Bacteria 899
128 Ga0207664_10437397 3300025929 Bacteria 1166
129 Ga0207644_10171191 3300025931 Bacteria 1695
130 Ga0207706_10000214 3300025933 Bacteria 63776
131 Ga0207686_10018331 3300025934 Bacteria 3962
132 Ga0207709_10372783 3300025935 Bacteria 1084
133 Ga0207691_10359296 3300025940 Bacteria 1245
134 Ga0207711_10008446 3300025941 Bacteria 8613
135 Ga0207661_10375866 3300025944 Bacteria 1285
136 Ga0207661_10548150 3300025944 Bacteria 1059
137 Ga0207661_11556091 3300025944 Bacteria 605
138 Ga0207667_10107282 3300025949 Bacteria 2881
139 Ga0207667_10335013 3300025949 Bacteria 1545
140 Ga0207712_10000690 3300025961 Bacteria 26074
141 Ga0207712_10039884 3300025961 Bacteria 3220
142 Ga0207712_10129566 3300025961 Bacteria 1920
143 Ga0207668_10266645 3300025972 Bacteria 1398
144 Ga0207640_10265858 3300025981 Bacteria 1339
145 Ga0207658_10337833 3300025986 Bacteria 1308
146 Ga0207703_10400696 3300026035 Bacteria 1273
147 Ga0207639_10152482 3300026041 Bacteria 1937
148 Ga0207678_10091230 3300026067 Bacteria 2604
149 Ga0207678_10123613 3300026067 Bacteria 2208
150 Ga0207708_10121687 3300026075 Bacteria 2034
151 Ga0207708_10563275 3300026075 Bacteria 962
152 Ga0207648_10000098 3300026089 Bacteria 83484
153 Ga0207648_10173702 3300026089 Bacteria 1905
154 Ga0207676_11558370 3300026095 Bacteria 658
155 Ga0207674_10000654 3300026116 Bacteria 45142
156 Ga0207683_10237049 3300026121 Bacteria 1664
157 Ga0207698_10382456 3300026142 Bacteria 1339
158 Ga0209813_10073944 3300027866 Bacteria 1114
159 Ga0268264_10007308 3300028381 Bacteria 9237
160 Ga0268264_10661537 3300028381 Bacteria 1034
161 Ga0265330_10002532 3300031235 Bacteria 9928
162 Ga0265320_10019881 3300031240 Bacteria 3657
163 Ga0265339_10000906 3300031249 Bacteria 22779
164 Ga0265316_10020207 3300031344 Bacteria 5675
165 Ga0307513_10000070 3300031456 Bacteria 139895
166 Ga0307513_10271389 3300031456 Bacteria 1479
167 Ga0265342_10074687 3300031712 Bacteria 1969
168 Ga0307406_10589086 3300031901 Bacteria 915
169 Ga0307412_11919111 3300031911 Bacteria 547
170 Ga0307416_100282235 3300032002 Bacteria 1638
171 Ga0307414_10567941 3300032004 Bacteria 1013
172 Ga0316215_1001897 3300033544 Bacteria 1980
173 Ga0373926_0093614 3300035083 Bacteria 1119
174 Ga0373934_0036372 3300035086 Bacteria 1940
175 Ga0373923_0001382 3300035111 Bacteria 6917
176 Ga0373923_0002101 3300035111 Bacteria 6035
177 Ga0373923_0168263 3300035111 Bacteria 1003
178 Ga0373953_0000985 3300035117 Bacteria 8003
179 Ga0373953_0114696 3300035117 Bacteria 1141
180 Ga0373953_0190123 3300035117 Bacteria 887
181 Ga0373954_0001160 3300035118 Bacteria 10599
182 Ga0373954_0004646 3300035118 Bacteria 5922
183 Ga0373956_0001463 3300035119 Bacteria 9760
184 Ga0373957_0010109 3300035120 Bacteria 3108
185 Ga0373943_0280193 3300035170 Bacteria 942
186 Ga0373946_0013105 3300035171 Bacteria 3111
187 Ga0373946_0538308 3300035171 Bacteria 602
188 Ga0373955_0001372 3300035172 Bacteria 10349
189 Ga0373955_0022165 3300035172 Bacteria 3218
190 Ga0373924_0027315 3300035410 Bacteria 2268
191 Ga0373924_0047047 3300035410 Bacteria 1779
192 Ga0373935_0290291 3300035692 Bacteria 1153
193 Ga0373927_0015109 3300035695 Bacteria 5104
194 Ga0373927_0130562 3300035695 Bacteria 1641
195 Ga0373927_0399578 3300035695 Bacteria 907
196 Ga0373927_0486769 3300035695 Bacteria 815
197 Ga0373933_0006390 3300035724 Bacteria 6414
198 Ga0373933_0017205 3300035724 Bacteria 4053
199 Ga0373947_0002439 3300035725 Bacteria 11211
200 Ga0373947_0191472 3300035725 Bacteria 1335
201 Ga0373937_0502784 3300036401 Bacteria 1151
202 Ga0373937_0720361 3300036401 Bacteria 945
203 Ga0372808_024405 3300036459 Bacteria 867
204 Ga0373925_0242896 3300037068 Bacteria 1442
205 Ga0373925_1011542 3300037068 Bacteria 684
206 Ga0395899_0393614 3300037312 Bacteria 918
207 Ga0395900_0068141 3300037418 Bacteria 3656
208 Ga0395900_0174183 3300037418 Bacteria 2189
209 Ga0395898_0176769 3300037466 Bacteria 2040
210 Ga0395905_0002783 3300037471 Bacteria 19151
211 Ga0436364_0005657 3300037853 Bacteria 4001
212 Ga0436364_0806009 3300037853 Bacteria 1358
213 Ga0436364_1092745 3300037853 Bacteria 4319
214 Ga0395901_0129659 3300038443 Bacteria 2649
215 Ga0395901_0181283 3300038443 Bacteria 2209
216 Ga0395901_1258842 3300038443 Bacteria 703
217 Ga0436365_1124981 3300039437 Bacteria 1300
218 Ga0451853_4016836 3300041512 Bacteria 589
219 Ga0451577_0380119 3300042876 Bacteria 1281
220 Ga0453684_1349471 3300044712 Bacteria 742
221 Ga0466968_0087833 3300044735 Bacteria 1374
222 Ga0466959_0017422 3300045049 Bacteria 5265
223 Ga0451576_0170117 3300045051 Bacteria 2274
224 Ga0466967_1669457 3300045976 Bacteria 634
225 Ga0495592_0001238 3300046454 Bacteria 17695
226 Ga0495592_0071092 3300046454 Bacteria 2534
227 Ga0495603_0123650 3300046455 Bacteria 1508
228 Ga0495629_0000750 3300046459 Bacteria 26239
229 Ga0495629_0038555 3300046459 Bacteria 3365
230 Ga0495651_0019393 3300046462 Bacteria 5271
231 Ga0495653_0014575 3300046463 Bacteria 6416
232 Ga0495653_0347454 3300046463 Bacteria 955
233 Ga0495580_0012063 3300046472 Bacteria 6652
234 Ga0495582_0595760 3300046473 Bacteria 639
235 Ga0495639_0072703 3300046475 Bacteria 1590
236 Ga0495662_0065813 3300046476 Bacteria 1752
237 Ga0495664_0028765 3300046477 Bacteria 3246
238 Ga0495594_0083212 3300046499 Bacteria 1789
239 Ga0495608_0000738 3300046511 Bacteria 22828
240 Ga0495608_0589217 3300046511 Bacteria 668
241 Ga0495618_0012424 3300046514 Bacteria 5172
242 Ga0495618_0075980 3300046514 Bacteria 2140
243 Ga0495628_0034008 3300046516 Bacteria 4103
244 Ga0495628_1178711 3300046516 Bacteria 520
245 Ga0495630_0062540 3300046517 Bacteria 2796
246 Ga0495630_0926978 3300046517 Bacteria 663
247 Ga0495648_0052989 3300046524 Bacteria 2461
248 Ga0495666_0126439 3300046526 Bacteria 1195
249 Ga0495652_0004125 3300046529 Bacteria 14021
250 Ga0495652_0041725 3300046529 Bacteria 3959
251 Ga0495665_0020494 3300046531 Bacteria 3551
252 Ga0495640_0041782 3300046533 Bacteria 3202
253 Ga0495640_0055752 3300046533 Bacteria 2703
254 Ga0495586_0056786 3300046535 Bacteria 2124
255 Ga0495587_0012212 3300046536 Bacteria 5423
256 Ga0495645_0152713 3300046543 Bacteria 1602
257 Ga0495667_0014203 3300046559 Bacteria 5377
258 Ga0495667_0112302 3300046559 Bacteria 1761
259 Ga0495634_0025310 3300046642 Bacteria 4155
260 Ga0495634_0037628 3300046642 Bacteria 3305
261 Ga0495635_0000166 3300046663 Bacteria 40939
262 Ga0495635_0015226 3300046663 Bacteria 5382
263 Ga0495588_0311373 3300046674 Bacteria 828
264 Ga0495657_0004131 3300046675 Bacteria 11623
265 Ga0495599_0005025 3300046678 Bacteria 7865
266 Ga0495623_0002267 3300046679 Bacteria 12801
267 Ga0495646_0019980 3300046680 Bacteria 4235
268 Ga0495646_0067140 3300046680 Bacteria 2120
269 Ga0495647_0048803 3300046681 Bacteria 1638
270 Ga0495658_0074828 3300046683 Bacteria 1974
271 Ga0495613_0096697 3300046689 Bacteria 2135
272 Ga0495613_0132297 3300046689 Bacteria 1786
273 Ga0495624_0048677 3300046690 Bacteria 2689
274 Ga0495600_0008000 3300046809 Bacteria 6479
275 Ga0495581_0035924 3300047315 Bacteria 2866
276 Ga0495581_0632896 3300047315 Bacteria 619
277 Ga0495604_0047644 3300047317 Bacteria 3337
278 Ga0495604_0262517 3300047317 Bacteria 1173
279 Ga0495674_0011184 3300047319 Bacteria 8474
280 Ga0495674_0034564 3300047319 Bacteria 4571
281 Ga0495674_0062247 3300047319 Bacteria 3250
282 Ga0495674_0213447 3300047319 Bacteria 1598
283 Ga0495676_0258191 3300047321 Bacteria 1186
284 Ga0495680_0134277 3300047322 Bacteria 1815
285 Ga0495675_0183616 3300047444 Bacteria 1279
286 Ga0495684_0007715 3300047471 Bacteria 8330
287 Ga0495684_0064967 3300047471 Bacteria 2773
288 Ga0495593_0006819 3300047673 Bacteria 6685
289 Ga0495593_0023148 3300047673 Bacteria 3455
290 Ga0495602_0310158 3300048088 Bacteria 1151
291 Ga0496100_1674573 3300048903 Bacteria 503
292 Ga0496101_1416563 3300048904 Bacteria 542
293 Ga0496102_0467687 3300048905 Bacteria 1182
294 Ga0496102_0617733 3300048905 Bacteria 1007
295 Ga0496115_0183524 3300048918 Bacteria 1729
296 Ga0496117_0019619 3300048920 Bacteria 5544
297 Ga0496118_0003817 3300048921 Bacteria 18562
298 Ga0495682_0063402 3300049460 Bacteria 1333
299 Ga0501041_0124821 3300049577 Bacteria 1602
300 Ga0501043_0030567 3300049579 Bacteria 4233
301 Ga0501046_0011269 3300049580 Bacteria 7652
302 Ga0501048_0403172 3300049582 Bacteria 978
303 Ga0501067_0164969 3300049583 Bacteria 1233
304 Ga0501070_0000452 3300049586 Bacteria 37359
305 nmdc:mga00v17_247003_c1 3300050491 Bacteria 1157
306 nmdc:mga0yw44_91277_c1 3300050492 Bacteria 1925
307 nmdc:mga0qj67_975223_c1 3300050509 Bacteria 666
308 nmdc:mga06r32_1690764_c1 3300050510 Bacteria 570
309 nmdc:mga08y16_217658_c1 3300050511 Bacteria 1977
310 nmdc:mga08y16_647379_c1 3300050511 Bacteria 1061
311 nmdc:mga0n895_857139_c1 3300050512 Bacteria 896
312 nmdc:mga0rr50_175541_c1 3300050513 Bacteria 1748
313 nmdc:mga0sz30_334127_c1 3300050516 Bacteria 677
314 Ga0495601_0096036 3300053077 Bacteria 1911
315 Ga0495612_0053895 3300053078 Bacteria 1656
316 Ga0495612_0078604 3300053078 Bacteria 1384
317 Ga0500610_0007936 3300053079 Bacteria 4591
318 Ga0495595_0000332 3300053084 Bacteria 18218
319 Ga0495619_0000633 3300053085 Bacteria 23194
320 Ga0500578_0078699 3300053086 Bacteria 2098
321 Ga0500651_0004739 3300053093 Bacteria 7670
322 Ga0500594_0231948 3300053118 Bacteria 612
323 Ga0500628_078555 3300053129 Bacteria 840
324 Ga0500588_0334866 3300053146 Bacteria 574
325 Ga0500622_0235560 3300053156 Bacteria 812
326 Ga0500645_002304 3300053730 Bacteria 8615
327 Ga0105241_10326587
328 Ga0055526_1012772
329 Ga0065712_10227794
330 Ga0070658_10241218
331 Ga0070676_10140724
332 Ga0070683_100557683
333 Ga0070683_100677417
334 Ga0070683_100935999
335 Ga0068868_100176145
336 Ga0070660_100166498
337 Ga0070671_100027724
338 Ga0070671_100650396
339 Ga0070674_100000408
340 Ga0070703_10032602
341 Ga0070709_10012057
342 Ga0070709_10463481
343 Ga0070714_100524377
344 Ga0070713_100001186
345 Ga0070713_100780770
346 Ga0070710_10047262
347 Ga0070711_100008851
348 Ga0070700_100452008
349 Ga0070678_100160417
350 Ga0070662_100266876
351 Ga0070681_10057575
352 Ga0068867_100000216
353 Ga0068867_100041984
354 Ga0068867_100241351
355 Ga0070679_100256152
356 Ga0070679_100671441
357 Ga0070679_100759348
358 Ga0070684_100500457
359 Ga0068853_100031087
360 Ga0070672_100281994
361 Ga0068855_100003442
362 Ga0070664_100260726
363 Ga0068857_101492800
364 Ga0068854_100362395
365 Ga0068856_100071685
366 Ga0068856_101368448
367 Ga0068859_100233198
368 Ga0068859_102145520
369 Ga0068866_10001043
370 Ga0068858_100598073
371 Ga0068860_101297545
372 Ga0068862_100003947
373 Ga0068862_100178016
374 Ga0081538_10119133
375 Ga0081540_1014267
376 Ga0070717_10607790
377 Ga0075365_10647451
378 Ga0075368_10255429
379 Ga0075363_100476293
380 Ga0075364_10233913
381 Ga0075432_10002159
382 Ga0070716_100050599
383 Ga0070712_100200936
384 Ga0075367_10031036
385 Ga0075367_10062335
386 Ga0075370_10005465
387 Ga0068871_100157902
388 Ga0075428_101544084
389 Ga0075430_100111150
390 Ga0075431_101627650
391 Ga0075433_10016255
392 Ga0075436_100004940
393 Ga0097620_100233194
394 Ga0097620_102145975
395 Ga0075435_100020979
396 Ga0105240_10231744
397 Ga0105240_10871692
398 Ga0105245_10095344
399 Ga0105245_10165664
400 Ga0105247_10387898
401 Ga0114129_12100329
402 Ga0105243_10398999
403 Ga0105241_10795810
404 Ga0105242_10052110
405 Ga0105248_10118397
406 Ga0105237_10159912
407 Ga0105238_10071900
408 Ga0105238_10108450
409 Ga0105238_10378202
410 Ga0105239_10021101
411 Ga0105239_10040825
412 Ga0105246_10025762
413 Ga0105246_10160750
414 Ga0105246_10480727
415 Ga0157373_10230809
416 Ga0157370_10794037
417 Ga0157369_10251334
418 Ga0157369_10735697
419 Ga0157378_10000477
420 Ga0157378_10318263
421 Ga0163162_10011321
422 Ga0163163_10147312
423 Ga0157380_10014708
424 Ga0157380_10245514
425 Ga0157376_11316848
426 Ga0163161_10061871
427 Ga0213875_10181979
428 Ga0209129_1001573
429 Ga0209565_1023232
430 Ga0209025_1000129
431 Ga0209025_1033043
432 Ga0209564_1001449
433 Ga0209758_1001266
434 Ga0207656_10110011
435 Ga0207642_10026876
436 Ga0207680_10235699
437 Ga0207699_10132270
438 Ga0207645_10000208
439 Ga0207645_10209402
440 Ga0207643_10199761
441 Ga0207654_10161569
442 Ga0207654_10784479
443 Ga0207707_10019818
444 Ga0207695_10303298
445 Ga0207695_10519306
446 Ga0207695_10645761
447 Ga0207660_10030322
448 Ga0207657_10198989
449 Ga0207652_10025815
450 Ga0207652_10779871
451 Ga0207694_10129117
452 Ga0207694_10167547
453 Ga0207700_10707336
454 Ga0207664_10437397
455 Ga0207644_10171191
456 Ga0207706_10000214
457 Ga0207686_10018331
458 Ga0207709_10372783
459 Ga0207691_10359296
460 Ga0207711_10008446
461 Ga0207661_10375866
462 Ga0207661_10548150
463 Ga0207661_11556091
464 Ga0207667_10107282
465 Ga0207667_10335013
466 Ga0207712_10000690
467 Ga0207712_10039884
468 Ga0207712_10129566
469 Ga0207668_10266645
470 Ga0207640_10265858
471 Ga0207658_10337833
472 Ga0207703_10400696
473 Ga0207639_10152482
474 Ga0207678_10091230
475 Ga0207678_10123613
476 Ga0207708_10121687
477 Ga0207708_10563275
478 Ga0207648_10000098
479 Ga0207648_10173702
480 Ga0207676_11558370
481 Ga0207674_10000654
482 Ga0207683_10237049
483 Ga0207698_10382456
484 Ga0209813_10073944
485 Ga0268264_10007308
486 Ga0268264_10661537
487 Ga0265330_10002532
488 Ga0265320_10019881
489 Ga0265339_10000906
490 Ga0265316_10020207
491 Ga0307513_10000070
492 Ga0307513_10271389
493 Ga0265342_10074687
494 Ga0307406_10589086
495 Ga0307412_11919111
496 Ga0307416_100282235
497 Ga0307414_10567941
498 Ga0316215_1001897
499 Ga0373926_0093614
500 Ga0373934_0036372
501 Ga0373923_0001382
502 Ga0373923_0002101
503 Ga0373923_0168263
504 Ga0373953_0000985
505 Ga0373953_0114696
506 Ga0373953_0190123
507 Ga0373954_0001160
508 Ga0373954_0004646
509 Ga0373956_0001463
510 Ga0373957_0010109
511 Ga0373943_0280193
512 Ga0373946_0013105
513 Ga0373946_0538308
514 Ga0373955_0001372
515 Ga0373955_0022165
516 Ga0373924_0027315
517 Ga0373924_0047047
518 Ga0373935_0290291
519 Ga0373927_0015109
520 Ga0373927_0130562
521 Ga0373927_0399578
522 Ga0373927_0486769
523 Ga0373933_0006390
524 Ga0373933_0017205
525 Ga0373947_0002439
526 Ga0373947_0191472
527 Ga0373937_0502784
528 Ga0373937_0720361
529 Ga0372808_024405
530 Ga0373925_0242896
531 Ga0373925_1011542
532 Ga0395899_0393614
533 Ga0395900_0068141
534 Ga0395900_0174183
535 Ga0395898_0176769
536 Ga0395905_0002783
537 Ga0436364_0005657
538 Ga0436364_0806009
539 Ga0436364_1092745
540 Ga0395901_0129659
541 Ga0395901_0181283
542 Ga0395901_1258842
543 Ga0436365_1124981
544 Ga0451853_4016836
545 Ga0451577_0380119
546 Ga0453684_1349471
547 Ga0466968_0087833
548 Ga0466959_0017422
549 Ga0451576_0170117
550 Ga0466967_1669457
551 Ga0495592_0001238
552 Ga0495592_0071092
553 Ga0495603_0123650
554 Ga0495629_0000750
555 Ga0495629_0038555
556 Ga0495651_0019393
557 Ga0495653_0014575
558 Ga0495653_0347454
559 Ga0495580_0012063
560 Ga0495582_0595760
561 Ga0495639_0072703
562 Ga0495662_0065813
563 Ga0495664_0028765
564 Ga0495594_0083212
565 Ga0495608_0000738
566 Ga0495608_0589217
567 Ga0495618_0012424
568 Ga0495618_0075980
569 Ga0495628_0034008
570 Ga0495628_1178711
571 Ga0495630_0062540
572 Ga0495630_0926978
573 Ga0495648_0052989
574 Ga0495666_0126439
575 Ga0495652_0004125
576 Ga0495652_0041725
577 Ga0495665_0020494
578 Ga0495640_0041782
579 Ga0495640_0055752
580 Ga0495586_0056786
581 Ga0495587_0012212
582 Ga0495645_0152713
583 Ga0495667_0014203
584 Ga0495667_0112302
585 Ga0495634_0025310
586 Ga0495634_0037628
587 Ga0495635_0000166
588 Ga0495635_0015226
589 Ga0495588_0311373
590 Ga0495657_0004131
591 Ga0495599_0005025
592 Ga0495623_0002267
593 Ga0495646_0019980
594 Ga0495646_0067140
595 Ga0495647_0048803
596 Ga0495658_0074828
597 Ga0495613_0096697
598 Ga0495613_0132297
599 Ga0495624_0048677
600 Ga0495600_0008000
601 Ga0495581_0035924
602 Ga0495581_0632896
603 Ga0495604_0047644
604 Ga0495604_0262517
605 Ga0495674_0011184
606 Ga0495674_0034564
607 Ga0495674_0062247
608 Ga0495674_0213447
609 Ga0495676_0258191
610 Ga0495680_0134277
611 Ga0495675_0183616
612 Ga0495684_0007715
613 Ga0495684_0064967
614 Ga0495593_0006819
615 Ga0495593_0023148
616 Ga0495602_0310158
617 Ga0496100_1674573
618 Ga0496101_1416563
619 Ga0496102_0467687
620 Ga0496102_0617733
621 Ga0496115_0183524
622 Ga0496117_0019619
623 Ga0496118_0003817
624 Ga0495682_0063402
625 Ga0501041_0124821
626 Ga0501043_0030567
627 Ga0501046_0011269
628 Ga0501048_0403172
629 Ga0501067_0164969
630 Ga0501070_0000452
631 nmdc:mga00v17_247003_c1
632 nmdc:mga0yw44_91277_c1
633 nmdc:mga0qj67_975223_c1
634 nmdc:mga06r32_1690764_c1
635 nmdc:mga08y16_217658_c1
636 nmdc:mga08y16_647379_c1
637 nmdc:mga0n895_857139_c1
638 nmdc:mga0rr50_175541_c1
639 nmdc:mga0sz30_334127_c1
640 Ga0495601_0096036
641 Ga0495612_0053895
642 Ga0495612_0078604
643 Ga0500610_0007936
644 Ga0495595_0000332
645 Ga0495619_0000633
646 Ga0500578_0078699
647 Ga0500651_0004739
648 Ga0500594_0231948
649 Ga0500628_078555
650 Ga0500588_0334866
651 Ga0500622_0235560
652 Ga0500645_002304

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

30

145

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.7448 1 114
4fpi-assembly1.cif.gz_E crystal structure of 5-chloromuconolactone isomerase from rhodococcus opacus 1cp 0.7033 1 120
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.6891 1 114
3zo7-assembly1.cif.gz_E crystal structure of clcfe27a with substrate 0.668 1 120
4fpi-assembly1.cif.gz_E crystal structure of 5-chloromuconolactone isomerase from rhodococcus opacus 1cp 0.6631 1 120
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7448 1 114 3.30.70.1060
2nzcC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 0.7046 2 113 3.30.70.1150
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6891 1 114 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6754 1 119 3.30.70.1060
2nzcC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 0.6749 2 113 3.30.70.1150
ID Description Score Start End GO Terms
AF-A0A7W1B6H1-F1-model_v4 YciI family protein 0.9091 1 126
AF-A0A1Q7RXR3-F1-model_v4 Transcription initiation protein 0.9086 1 127
AF-A0A2V7RCP6-F1-model_v4 Transcription initiation protein 0.9075 1 127
AF-A0A503WCB3-F1-model_v4 YciI family protein 0.9007 1 129
AF-A0A4Q1UNU8-F1-model_v4 Transcription initiation protein 0.8993 1 129

Map