F408288

General Info

Members Datasets Scaffolds Average Seq Length
326 218 652 127

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_11625323|Ga0105242_116253231
Length 149
Sequence LVPQPPVTPKLPKERMIRIASPNGVARLPKAKNVLGGKLATCGTSPMTGFFRDGCCNTGPEDVGSHTVCVVMTAEFLAFSKSAGNDLATPNLQWGFPGLQPGDRWCLCAPRWKEALDEGAAPKLVLASTHEETLAIVPLGVLKDYAVEA

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
66 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
112 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
113 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
114 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
117 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
118 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
121 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
122 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
123 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
124 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
135 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
136 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
137 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
138 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
139 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
145 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
146 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
147 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
148 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
149 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
150 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
151 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
156 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
157 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
167 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
168 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
169 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
170 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
171 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
172 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
183 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
184 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
185 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
186 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
187 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
188 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
189 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
190 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
191 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
192 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
193 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
194 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
195 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
196 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
197 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
198 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
199 3300053112 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 endosphere Metagenome Endosphere
200 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
201 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
202 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
203 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
204 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
205 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
206 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
207 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
208 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
209 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
210 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
211 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
212 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
213 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
214 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
215 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
216 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
217 2643221640 Caulobacter sp. Root342 Isolate Unclassified
218 2643221642 Caulobacter sp. Root343 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.08
Metatranscriptomes 0
Isolates 0.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.4
Nodule 0
Rhizoplane 3.37
Rhizosphere 71.78
Stem 0
Stem Tuber 0
Unclassified 1.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_11625323 3300009176 Bacteria 680
2 JGI24743J22301_10000042 3300001991 Bacteria 11518
3 JGI25153J46596_10040997 3300003215 Bacteria 1429
4 Ga0055530_10000039 3300003791 Bacteria 115587
5 Ga0055531_10013369 3300003794 Bacteria 3787
6 Ga0055531_10013764 3300003794 Bacteria 3706
7 Ga0070658_10043946 3300005327 Bacteria 3610
8 Ga0070658_10553579 3300005327 Bacteria 995
9 Ga0070658_10830738 3300005327 Bacteria 803
10 Ga0070670_100053768 3300005331 Bacteria 3457
11 Ga0070670_100277278 3300005331 Bacteria 1464
12 Ga0068869_101799827 3300005334 Bacteria 548
13 Ga0070666_10120996 3300005335 Bacteria 1815
14 Ga0070660_100029463 3300005339 Bacteria 4114
15 Ga0070660_100190148 3300005339 Bacteria 1663
16 Ga0070661_100037811 3300005344 Bacteria 3512
17 Ga0070661_100294082 3300005344 Bacteria 1263
18 Ga0070668_100001495 3300005347 Bacteria 16888
19 Ga0070668_100015020 3300005347 Bacteria 5783
20 Ga0070671_100010004 3300005355 Bacteria 7615
21 Ga0070671_100095814 3300005355 Bacteria 2488
22 Ga0070671_100974753 3300005355 Bacteria 742
23 Ga0070671_101404145 3300005355 Bacteria 617
24 Ga0070674_101081791 3300005356 Bacteria 707
25 Ga0070659_100004201 3300005366 Bacteria 10281
26 Ga0070659_100013307 3300005366 Bacteria 6120
27 Ga0070667_100024040 3300005367 Bacteria 5060
28 Ga0070667_100318775 3300005367 Bacteria 1402
29 Ga0070663_100097363 3300005455 Bacteria 2190
30 Ga0070663_100818905 3300005455 Bacteria 799
31 Ga0070663_102024746 3300005455 Bacteria 518
32 Ga0070662_100224186 3300005457 Bacteria 1501
33 Ga0070684_102278423 3300005535 Bacteria 511
34 Ga0068853_100085775 3300005539 Bacteria 2761
35 Ga0068853_100352283 3300005539 Bacteria 1370
36 Ga0070665_100000157 3300005548 Bacteria 124344
37 Ga0070665_100120439 3300005548 Bacteria 2626
38 Ga0068855_100122067 3300005563 Bacteria 2982
39 Ga0068855_100182359 3300005563 Bacteria 2373
40 Ga0070664_100478289 3300005564 Bacteria 1146
41 Ga0070664_101842575 3300005564 Bacteria 574
42 Ga0068857_100557446 3300005577 Bacteria 1080
43 Ga0068857_100864101 3300005577 Bacteria 866
44 Ga0068857_102121656 3300005577 Bacteria 551
45 Ga0068854_100092163 3300005578 Bacteria 2257
46 Ga0068856_100026934 3300005614 Bacteria 5607
47 Ga0068856_100086304 3300005614 Bacteria 3118
48 Ga0068856_100665445 3300005614 Bacteria 1062
49 Ga0068852_100007647 3300005616 Bacteria 7903
50 Ga0068852_100184148 3300005616 Bacteria 1966
51 Ga0068852_100266272 3300005616 Bacteria 1647
52 Ga0068859_100002128 3300005617 Bacteria 20159
53 Ga0068864_100001593 3300005618 Bacteria 18693
54 Ga0068861_100184939 3300005719 Bacteria 1737
55 Ga0068863_100000262 3300005841 Bacteria 55027
56 Ga0068863_100005675 3300005841 Bacteria 12256
57 Ga0068863_100948662 3300005841 Bacteria 862
58 Ga0068858_100001087 3300005842 Bacteria 28118
59 Ga0068858_100003620 3300005842 Bacteria 15288
60 Ga0068860_100011314 3300005843 Bacteria 8793
61 Ga0068860_100111189 3300005843 Unclassified 2619
62 Ga0068860_102289749 3300005843 Bacteria 561
63 Ga0068862_100031143 3300005844 Bacteria 4500
64 Ga0081455_10071327 3300005937 Bacteria 2880
65 Ga0070717_10879257 3300006028 Bacteria 816
66 Ga0075368_10001941 3300006042 Bacteria 6657
67 Ga0075364_10001878 3300006051 Bacteria 11665
68 Ga0075367_10000927 3300006178 Bacteria 11877
69 Ga0075369_10094966 3300006186 Bacteria 1333
70 Ga0075366_10063716 3300006195 Bacteria 2191
71 Ga0097621_101330365 3300006237 Bacteria 679
72 Ga0075370_10089434 3300006353 Bacteria 1776
73 Ga0075370_10124491 3300006353 Bacteria 1502
74 Ga0075370_10350849 3300006353 Bacteria 881
75 Ga0075370_10514987 3300006353 Bacteria 722
76 Ga0068871_100520852 3300006358 Bacteria 1074
77 Ga0097620_100002128 3300006931 Bacteria 20159
78 Ga0105250_10004815 3300009092 Bacteria 6148
79 Ga0105240_10011196 3300009093 Bacteria 12518
80 Ga0105240_10049890 3300009093 Bacteria 5279
81 Ga0105240_10070502 3300009093 Bacteria 4324
82 Ga0105240_10108546 3300009093 Bacteria 3362
83 Ga0111539_11951860 3300009094 Bacteria 681
84 Ga0105247_10202624 3300009101 Bacteria 1334
85 Ga0105247_10411734 3300009101 Bacteria 966
86 Ga0105241_10210206 3300009174 Bacteria 1630
87 Ga0105241_10431636 3300009174 Bacteria 1162
88 Ga0105242_10509253 3300009176 Bacteria 1146
89 Ga0105248_10000628 3300009177 Bacteria 40072
90 Ga0105248_10005542 3300009177 Bacteria 13869
91 Ga0105248_10026306 3300009177 Bacteria 6473
92 Ga0105248_10026748 3300009177 Bacteria 6416
93 Ga0105248_12210107 3300009177 Bacteria 626
94 Ga0105237_10573929 3300009545 Bacteria 1135
95 Ga0105237_11732516 3300009545 Bacteria 632
96 Ga0105238_10003838 3300009551 Bacteria 14926
97 Ga0105238_10042720 3300009551 Bacteria 4589
98 Ga0105238_10118252 3300009551 Bacteria 2631
99 Ga0105249_10387815 3300009553 Bacteria 1424
100 Ga0105239_10732078 3300010375 Bacteria 1132
101 Ga0105239_10747654 3300010375 Bacteria 1119
102 Ga0105239_11073258 3300010375 Bacteria 927
103 Ga0157371_10022856 3300013102 Bacteria 4574
104 Ga0157370_10273510 3300013104 Bacteria 1560
105 Ga0157369_10033868 3300013105 Bacteria 5610
106 Ga0163162_10041548 3300013306 Bacteria 4602
107 Ga0157372_10050548 3300013307 Bacteria 4624
108 Ga0157375_12071967 3300013308 Bacteria 677
109 Ga0163163_10005390 3300014325 Bacteria 11057
110 Ga0163163_10016154 3300014325 Bacteria 6929
111 Ga0163163_10115829 3300014325 Bacteria 2711
112 Ga0163163_11373043 3300014325 Unclassified 768
113 Ga0163163_13076039 3300014325 Bacteria 520
114 Ga0157379_10004025 3300014968 Bacteria 12524
115 Ga0157379_10041333 3300014968 Bacteria 4116
116 Ga0213876_10001041 3300021384 Bacteria 17932
117 Ga0213876_10022439 3300021384 Bacteria 3337
118 Ga0213875_10169303 3300021388 Bacteria 1026
119 Ga0209758_1014271 3300025297 Bacteria 4242
120 Ga0209050_1000073 3300025298 Bacteria 292046
121 Ga0209257_1000099 3300025304 Bacteria 255304
122 Ga0209257_1009459 3300025304 Bacteria 5208
123 Ga0207697_10102891 3300025315 Bacteria 1218
124 Ga0207696_1045105 3300025711 Bacteria 1276
125 Ga0207710_10252775 3300025900 Bacteria 881
126 Ga0207710_10278848 3300025900 Bacteria 841
127 Ga0207705_10610920 3300025909 Bacteria 848
128 Ga0207695_10026897 3300025913 Bacteria 6413
129 Ga0207695_10043308 3300025913 Bacteria 4799
130 Ga0207695_11283387 3300025913 Bacteria 613
131 Ga0207671_10899786 3300025914 Bacteria 700
132 Ga0207657_10184734 3300025919 Bacteria 1684
133 Ga0207649_10015455 3300025920 Bacteria 4289
134 Ga0207649_10241994 3300025920 Bacteria 1296
135 Ga0207652_11602924 3300025921 Bacteria 555
136 Ga0207646_10445102 3300025922 Bacteria 1169
137 Ga0207681_10252489 3300025923 Bacteria 1377
138 Ga0207694_10044830 3300025924 Bacteria 3415
139 Ga0207694_10118101 3300025924 Bacteria 2115
140 Ga0207694_10129390 3300025924 Bacteria 2023
141 Ga0207694_10270776 3300025924 Bacteria 1393
142 Ga0207650_10166604 3300025925 Bacteria 1749
143 Ga0207644_10006403 3300025931 Bacteria 7672
144 Ga0207644_10346517 3300025931 Bacteria 1205
145 Ga0207690_10001364 3300025932 Bacteria 15338
146 Ga0207706_10085371 3300025933 Bacteria 2775
147 Ga0207686_11760805 3300025934 Bacteria 513
148 Ga0207711_10000097 3300025941 Bacteria 92721
149 Ga0207711_10005870 3300025941 Bacteria 10364
150 Ga0207711_10029808 3300025941 Bacteria 4604
151 Ga0207711_10034538 3300025941 Bacteria 4282
152 Ga0207689_10794224 3300025942 Bacteria 799
153 Ga0207667_10003395 3300025949 Bacteria 19649
154 Ga0207667_10047558 3300025949 Bacteria 4540
155 Ga0207667_10180551 3300025949 Bacteria 2168
156 Ga0207712_10171753 3300025961 Bacteria 1695
157 Ga0207712_11538282 3300025961 Bacteria 596
158 Ga0207668_10003367 3300025972 Bacteria 9365
159 Ga0207668_10006650 3300025972 Bacteria 6837
160 Ga0207640_10294328 3300025981 Bacteria 1281
161 Ga0207658_10052428 3300025986 Bacteria 3010
162 Ga0207677_11580118 3300026023 Bacteria 607
163 Ga0207703_10000051 3300026035 Bacteria 145390
164 Ga0207703_10015235 3300026035 Bacteria 5998
165 Ga0207639_10051106 3300026041 Bacteria 3142
166 Ga0207639_10687829 3300026041 Bacteria 948
167 Ga0207678_10741707 3300026067 Bacteria 866
168 Ga0207678_11911665 3300026067 Bacteria 518
169 Ga0207702_10020820 3300026078 Bacteria 5425
170 Ga0207702_10083251 3300026078 Bacteria 2783
171 Ga0207702_10098951 3300026078 Bacteria 2570
172 Ga0207641_10000003 3300026088 Bacteria 496984
173 Ga0207641_10042539 3300026088 Bacteria 3811
174 Ga0207641_11145753 3300026088 Bacteria 777
175 Ga0207648_10391707 3300026089 Bacteria 1258
176 Ga0207676_10007303 3300026095 Bacteria 7835
177 Ga0207676_10957459 3300026095 Bacteria 842
178 Ga0207674_10653695 3300026116 Bacteria 1015
179 Ga0207675_100542260 3300026118 Bacteria 1162
180 Ga0207698_10275939 3300026142 Bacteria 1552
181 Ga0207698_10343298 3300026142 Bacteria 1407
182 Ga0209967_1015407 3300027364 Bacteria 1094
183 Ga0209981_1000573 3300027378 Bacteria 4672
184 Ga0209999_1005386 3300027543 Bacteria 2304
185 Ga0209813_10001761 3300027866 Bacteria 4873
186 Ga0268266_10000003 3300028379 Bacteria 1701703
187 Ga0268266_10057499 3300028379 Bacteria 3347
188 Ga0268265_10172305 3300028380 Bacteria 1851
189 Ga0268264_10016328 3300028381 Bacteria 6080
190 Ga0268264_10140796 3300028381 Bacteria 2151
191 Ga0268264_11308649 3300028381 Bacteria 735
192 Ga0265319_1019903 3300028563 Bacteria 2497
193 Ga0265318_10177912 3300028577 Bacteria 779
194 Ga0307517_10002560 3300028786 Bacteria 28963
195 Ga0265320_10095666 3300031240 Bacteria 1372
196 Ga0265316_10807307 3300031344 Bacteria 658
197 Ga0307513_10003639 3300031456 Bacteria 20849
198 Ga0307508_10232656 3300031616 Bacteria 1441
199 Ga0307407_11712176 3300031903 Bacteria 501
200 Ga0307412_10488152 3300031911 Bacteria 1023
201 Ga0307510_10027324 3300033180 Bacteria 6539
202 Ga0373936_0005407 3300035113 Bacteria 4814
203 Ga0373943_0053411 3300035170 Bacteria 1995
204 Ga0373946_0049425 3300035171 Bacteria 1753
205 Ga0373931_1277595 3300035691 Bacteria 504
206 Ga0373927_0000899 3300035695 Bacteria 22619
207 Ga0373925_0000278 3300037068 Bacteria 53402
208 Ga0395899_0000190 3300037312 Bacteria 90356
209 Ga0395899_0045527 3300037312 Bacteria 3269
210 Ga0395899_0806494 3300037312 Bacteria 579
211 Ga0395900_0000002 3300037418 Bacteria 671103
212 Ga0395900_0044843 3300037418 Bacteria 4555
213 Ga0395900_0391134 3300037418 Bacteria 1356
214 Ga0395898_0111213 3300037466 Bacteria 2625
215 Ga0395898_1289306 3300037466 Bacteria 660
216 Ga0395905_0004637 3300037471 Bacteria 14218
217 Ga0395905_0016064 3300037471 Bacteria 7117
218 Ga0395905_1312852 3300037471 Bacteria 627
219 Ga0436364_1463023 3300037853 Bacteria 1189
220 Ga0395901_0000013 3300038443 Bacteria 375733
221 Ga0395901_0004747 3300038443 Bacteria 13714
222 Ga0395901_0321955 3300038443 Bacteria 1599
223 Ga0436365_0118129 3300039437 Bacteria 1527
224 Ga0436365_0869708 3300039437 Bacteria 31901
225 Ga0436365_1362947 3300039437 Bacteria 3519
226 Ga0436365_1805761 3300039437 Bacteria 1159
227 Ga0436365_1898704 3300039437 Bacteria 1369
228 Ga0436360_0424329 3300039438 Bacteria 539
229 Ga0436363_0474797 3300039450 Bacteria 4252
230 Ga0439439_0076897 3300041406 Bacteria 899
231 Ga0451807_2454997 3300041486 Bacteria 669
232 Ga0439442_032700 3300042002 Bacteria 1087
233 Ga0466964_0349767 3300044706 Bacteria 759
234 Ga0453684_0008832 3300044712 Bacteria 17871
235 Ga0466970_0941955 3300044765 Bacteria 509
236 Ga0466960_0712715 3300044901 Bacteria 603
237 Ga0451576_0252102 3300045051 Bacteria 1845
238 Ga0495585_0107715 3300046492 Bacteria 1485
239 Ga0495583_0076252 3300046506 Bacteria 1465
240 Ga0495606_0632994 3300046507 Bacteria 520
241 Ga0495610_0041087 3300046512 Bacteria 2325
242 Ga0495637_0266709 3300046520 Bacteria 613
243 Ga0495654_0179799 3300046530 Bacteria 917
244 Ga0495597_0058681 3300046542 Bacteria 1681
245 Ga0495622_0105223 3300046557 Bacteria 1292
246 Ga0495668_0012364 3300046616 Bacteria 5065
247 Ga0495668_0081786 3300046616 Bacteria 1772
248 Ga0495625_0473447 3300046660 Bacteria 770
249 Ga0495676_0512459 3300047321 Bacteria 786
250 Ga0495687_020070 3300047443 Bacteria 3265
251 Ga0495686_0015734 3300047472 Bacteria 5153
252 Ga0495686_0444372 3300047472 Bacteria 690
253 Ga0496100_0584439 3300048903 Bacteria 866
254 Ga0496101_0215445 3300048904 Bacteria 1489
255 Ga0496102_0048171 3300048905 Bacteria 3875
256 Ga0496103_0704635 3300048906 Bacteria 640
257 Ga0496104_0043070 3300048907 Bacteria 4239
258 Ga0496105_0883810 3300048908 Bacteria 674
259 Ga0496106_0098478 3300048909 Bacteria 2266
260 Ga0496110_1500924 3300048913 Unclassified 584
261 Ga0496115_0001531 3300048918 Bacteria 16601
262 Ga0496115_0017321 3300048918 Bacteria 5505
263 Ga0496117_0007822 3300048920 Bacteria 10289
264 Ga0496118_0014292 3300048921 Bacteria 7444
265 Ga0496119_0121879 3300048922 Bacteria 1432
266 Ga0496120_0133723 3300048923 Bacteria 1267
267 Ga0496121_0000042 3300048924 Bacteria 342304
268 Ga0495682_0057905 3300049460 Bacteria 1402
269 Ga0501032_0082756 3300049569 Bacteria 2135
270 Ga0501032_0188127 3300049569 Bacteria 1350
271 Ga0501033_0116345 3300049570 Bacteria 1943
272 Ga0501038_0413803 3300049574 Bacteria 1041
273 Ga0501038_1212427 3300049574 Bacteria 547
274 Ga0501039_0558349 3300049575 Bacteria 898
275 Ga0501043_0004285 3300049579 Bacteria 11615
276 Ga0501047_0445347 3300049581 Bacteria 1125
277 Ga0501048_0099287 3300049582 Bacteria 2054
278 Ga0501074_0134520 3300049590 Bacteria 1768
279 Ga0501079_0467791 3300049741 Bacteria 991
280 Ga0501044_0405355 3300049823 Bacteria 1275
281 Ga0501044_0720838 3300049823 Bacteria 881
282 nmdc:mga00v17_4271_c1 3300050491 Bacteria 7421
283 nmdc:mga0k408_151421_c1 3300050493 Bacteria 1381
284 nmdc:mga0k408_9222_c1 3300050493 Bacteria 5316
285 nmdc:mga06z11_5823_c1 3300050494 Bacteria 4973
286 nmdc:mga04h51_1904_c1 3300050495 Bacteria 4873
287 nmdc:mga07m45_154826_c2 3300050496 Bacteria 1009
288 nmdc:mga07m45_214706_c1 3300050496 Bacteria 1119
289 nmdc:mga07m45_69254_c1 3300050496 Bacteria 2006
290 nmdc:mga0sz30_90200_c1 3300050516 Bacteria 1333
291 Ga0500635_0000123 3300053080 Bacteria 45690
292 Ga0500578_0263607 3300053086 Bacteria 1034
293 Ga0500643_007543 3300053087 Bacteria 4368
294 Ga0500643_186414 3300053087 Unclassified 556
295 Ga0500647_0008673 3300053091 Bacteria 4422
296 Ga0500651_0033029 3300053093 Bacteria 3263
297 Ga0500566_0019080 3300053094 Bacteria 4027
298 Ga0500554_029125 3300053102 Bacteria 1611
299 Ga0500555_001071 3300053103 Bacteria 9192
300 Ga0500556_0008704 3300053104 Bacteria 2933
301 Ga0500562_004803 3300053108 Bacteria 3404
302 Ga0500569_001363 3300053109 Bacteria 4587
303 Ga0500575_220494 3300053112 Bacteria 560
304 Ga0500582_282226 3300053114 Bacteria 522
305 Ga0500595_034825 3300053119 Bacteria 1662
306 Ga0500607_037579 3300053121 Bacteria 2638
307 Ga0500608_019441 3300053122 Bacteria 3115
308 Ga0500614_022491 3300053123 Bacteria 1472
309 Ga0500642_0231676 3300053130 Bacteria 853
310 Ga0500658_0233665 3300053134 Bacteria 844
311 Ga0500559_0000004 3300053136 Bacteria 241551
312 Ga0500559_0032470 3300053136 Bacteria 2244
313 Ga0500559_0208732 3300053136 Bacteria 921
314 Ga0500590_024238 3300053148 Bacteria 3149
315 Ga0500619_181106 3300053154 Bacteria 711
316 Ga0500636_0036245 3300053177 Bacteria 2919
317 Ga0500636_0085044 3300053177 Bacteria 1818
318 Ga0500637_0033429 3300053178 Bacteria 2872
319 Ga0500637_0111200 3300053178 Bacteria 1588
320 Ga0500625_204567 3300053729 Bacteria 654
321 Ga0500645_002869 3300053730 Bacteria 7382
322 Ga0500596_000476 3300053735 Bacteria 7496
323 Ga0500601_006413 3300053737 Bacteria 1296
324 2587915732 2585428106 Bacteria 5179711
325 2644223283 2643221640 Bacteria 5258820
326 2644236447 2643221642 Bacteria 5357871
327 Ga0105242_11625323
328 JGI24743J22301_10000042
329 JGI25153J46596_10040997
330 Ga0055530_10000039
331 Ga0055531_10013369
332 Ga0055531_10013764
333 Ga0070658_10043946
334 Ga0070658_10553579
335 Ga0070658_10830738
336 Ga0070670_100053768
337 Ga0070670_100277278
338 Ga0068869_101799827
339 Ga0070666_10120996
340 Ga0070660_100029463
341 Ga0070660_100190148
342 Ga0070661_100037811
343 Ga0070661_100294082
344 Ga0070668_100001495
345 Ga0070668_100015020
346 Ga0070671_100010004
347 Ga0070671_100095814
348 Ga0070671_100974753
349 Ga0070671_101404145
350 Ga0070674_101081791
351 Ga0070659_100004201
352 Ga0070659_100013307
353 Ga0070667_100024040
354 Ga0070667_100318775
355 Ga0070663_100097363
356 Ga0070663_100818905
357 Ga0070663_102024746
358 Ga0070662_100224186
359 Ga0070684_102278423
360 Ga0068853_100085775
361 Ga0068853_100352283
362 Ga0070665_100000157
363 Ga0070665_100120439
364 Ga0068855_100122067
365 Ga0068855_100182359
366 Ga0070664_100478289
367 Ga0070664_101842575
368 Ga0068857_100557446
369 Ga0068857_100864101
370 Ga0068857_102121656
371 Ga0068854_100092163
372 Ga0068856_100026934
373 Ga0068856_100086304
374 Ga0068856_100665445
375 Ga0068852_100007647
376 Ga0068852_100184148
377 Ga0068852_100266272
378 Ga0068859_100002128
379 Ga0068864_100001593
380 Ga0068861_100184939
381 Ga0068863_100000262
382 Ga0068863_100005675
383 Ga0068863_100948662
384 Ga0068858_100001087
385 Ga0068858_100003620
386 Ga0068860_100011314
387 Ga0068860_100111189
388 Ga0068860_102289749
389 Ga0068862_100031143
390 Ga0081455_10071327
391 Ga0070717_10879257
392 Ga0075368_10001941
393 Ga0075364_10001878
394 Ga0075367_10000927
395 Ga0075369_10094966
396 Ga0075366_10063716
397 Ga0097621_101330365
398 Ga0075370_10089434
399 Ga0075370_10124491
400 Ga0075370_10350849
401 Ga0075370_10514987
402 Ga0068871_100520852
403 Ga0097620_100002128
404 Ga0105250_10004815
405 Ga0105240_10011196
406 Ga0105240_10049890
407 Ga0105240_10070502
408 Ga0105240_10108546
409 Ga0111539_11951860
410 Ga0105247_10202624
411 Ga0105247_10411734
412 Ga0105241_10210206
413 Ga0105241_10431636
414 Ga0105242_10509253
415 Ga0105248_10000628
416 Ga0105248_10005542
417 Ga0105248_10026306
418 Ga0105248_10026748
419 Ga0105248_12210107
420 Ga0105237_10573929
421 Ga0105237_11732516
422 Ga0105238_10003838
423 Ga0105238_10042720
424 Ga0105238_10118252
425 Ga0105249_10387815
426 Ga0105239_10732078
427 Ga0105239_10747654
428 Ga0105239_11073258
429 Ga0157371_10022856
430 Ga0157370_10273510
431 Ga0157369_10033868
432 Ga0163162_10041548
433 Ga0157372_10050548
434 Ga0157375_12071967
435 Ga0163163_10005390
436 Ga0163163_10016154
437 Ga0163163_10115829
438 Ga0163163_11373043
439 Ga0163163_13076039
440 Ga0157379_10004025
441 Ga0157379_10041333
442 Ga0213876_10001041
443 Ga0213876_10022439
444 Ga0213875_10169303
445 Ga0209758_1014271
446 Ga0209050_1000073
447 Ga0209257_1000099
448 Ga0209257_1009459
449 Ga0207697_10102891
450 Ga0207696_1045105
451 Ga0207710_10252775
452 Ga0207710_10278848
453 Ga0207705_10610920
454 Ga0207695_10026897
455 Ga0207695_10043308
456 Ga0207695_11283387
457 Ga0207671_10899786
458 Ga0207657_10184734
459 Ga0207649_10015455
460 Ga0207649_10241994
461 Ga0207652_11602924
462 Ga0207646_10445102
463 Ga0207681_10252489
464 Ga0207694_10044830
465 Ga0207694_10118101
466 Ga0207694_10129390
467 Ga0207694_10270776
468 Ga0207650_10166604
469 Ga0207644_10006403
470 Ga0207644_10346517
471 Ga0207690_10001364
472 Ga0207706_10085371
473 Ga0207686_11760805
474 Ga0207711_10000097
475 Ga0207711_10005870
476 Ga0207711_10029808
477 Ga0207711_10034538
478 Ga0207689_10794224
479 Ga0207667_10003395
480 Ga0207667_10047558
481 Ga0207667_10180551
482 Ga0207712_10171753
483 Ga0207712_11538282
484 Ga0207668_10003367
485 Ga0207668_10006650
486 Ga0207640_10294328
487 Ga0207658_10052428
488 Ga0207677_11580118
489 Ga0207703_10000051
490 Ga0207703_10015235
491 Ga0207639_10051106
492 Ga0207639_10687829
493 Ga0207678_10741707
494 Ga0207678_11911665
495 Ga0207702_10020820
496 Ga0207702_10083251
497 Ga0207702_10098951
498 Ga0207641_10000003
499 Ga0207641_10042539
500 Ga0207641_11145753
501 Ga0207648_10391707
502 Ga0207676_10007303
503 Ga0207676_10957459
504 Ga0207674_10653695
505 Ga0207675_100542260
506 Ga0207698_10275939
507 Ga0207698_10343298
508 Ga0209967_1015407
509 Ga0209981_1000573
510 Ga0209999_1005386
511 Ga0209813_10001761
512 Ga0268266_10000003
513 Ga0268266_10057499
514 Ga0268265_10172305
515 Ga0268264_10016328
516 Ga0268264_10140796
517 Ga0268264_11308649
518 Ga0265319_1019903
519 Ga0265318_10177912
520 Ga0307517_10002560
521 Ga0265320_10095666
522 Ga0265316_10807307
523 Ga0307513_10003639
524 Ga0307508_10232656
525 Ga0307407_11712176
526 Ga0307412_10488152
527 Ga0307510_10027324
528 Ga0373936_0005407
529 Ga0373943_0053411
530 Ga0373946_0049425
531 Ga0373931_1277595
532 Ga0373927_0000899
533 Ga0373925_0000278
534 Ga0395899_0000190
535 Ga0395899_0045527
536 Ga0395899_0806494
537 Ga0395900_0000002
538 Ga0395900_0044843
539 Ga0395900_0391134
540 Ga0395898_0111213
541 Ga0395898_1289306
542 Ga0395905_0004637
543 Ga0395905_0016064
544 Ga0395905_1312852
545 Ga0436364_1463023
546 Ga0395901_0000013
547 Ga0395901_0004747
548 Ga0395901_0321955
549 Ga0436365_0118129
550 Ga0436365_0869708
551 Ga0436365_1362947
552 Ga0436365_1805761
553 Ga0436365_1898704
554 Ga0436360_0424329
555 Ga0436363_0474797
556 Ga0439439_0076897
557 Ga0451807_2454997
558 Ga0439442_032700
559 Ga0466964_0349767
560 Ga0453684_0008832
561 Ga0466970_0941955
562 Ga0466960_0712715
563 Ga0451576_0252102
564 Ga0495585_0107715
565 Ga0495583_0076252
566 Ga0495606_0632994
567 Ga0495610_0041087
568 Ga0495637_0266709
569 Ga0495654_0179799
570 Ga0495597_0058681
571 Ga0495622_0105223
572 Ga0495668_0012364
573 Ga0495668_0081786
574 Ga0495625_0473447
575 Ga0495676_0512459
576 Ga0495687_020070
577 Ga0495686_0015734
578 Ga0495686_0444372
579 Ga0496100_0584439
580 Ga0496101_0215445
581 Ga0496102_0048171
582 Ga0496103_0704635
583 Ga0496104_0043070
584 Ga0496105_0883810
585 Ga0496106_0098478
586 Ga0496110_1500924
587 Ga0496115_0001531
588 Ga0496115_0017321
589 Ga0496117_0007822
590 Ga0496118_0014292
591 Ga0496119_0121879
592 Ga0496120_0133723
593 Ga0496121_0000042
594 Ga0495682_0057905
595 Ga0501032_0082756
596 Ga0501032_0188127
597 Ga0501033_0116345
598 Ga0501038_0413803
599 Ga0501038_1212427
600 Ga0501039_0558349
601 Ga0501043_0004285
602 Ga0501047_0445347
603 Ga0501048_0099287
604 Ga0501074_0134520
605 Ga0501079_0467791
606 Ga0501044_0405355
607 Ga0501044_0720838
608 nmdc:mga00v17_4271_c1
609 nmdc:mga0k408_151421_c1
610 nmdc:mga0k408_9222_c1
611 nmdc:mga06z11_5823_c1
612 nmdc:mga04h51_1904_c1
613 nmdc:mga07m45_154826_c2
614 nmdc:mga07m45_214706_c1
615 nmdc:mga07m45_69254_c1
616 nmdc:mga0sz30_90200_c1
617 Ga0500635_0000123
618 Ga0500578_0263607
619 Ga0500643_007543
620 Ga0500643_186414
621 Ga0500647_0008673
622 Ga0500651_0033029
623 Ga0500566_0019080
624 Ga0500554_029125
625 Ga0500555_001071
626 Ga0500556_0008704
627 Ga0500562_004803
628 Ga0500569_001363
629 Ga0500575_220494
630 Ga0500582_282226
631 Ga0500595_034825
632 Ga0500607_037579
633 Ga0500608_019441
634 Ga0500614_022491
635 Ga0500642_0231676
636 Ga0500658_0233665
637 Ga0500559_0000004
638 Ga0500559_0032470
639 Ga0500559_0208732
640 Ga0500590_024238
641 Ga0500619_181106
642 Ga0500636_0036245
643 Ga0500636_0085044
644 Ga0500637_0033429
645 Ga0500637_0111200
646 Ga0500625_204567
647 Ga0500645_002869
648 Ga0500596_000476
649 Ga0500601_006413
650 2587915732
651 2644223283
652 2644236447

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09996

DUF2237

Uncharacterized protein conserved in bacteria (DUF2237)

32

146

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ush-assembly1.cif.gz_A crystal structure of the q2s0r5 protein from salinibacter ruber, northeast structural genomics consortium target srr207 0.8679 2 119
3ush-assembly1.cif.gz_A crystal structure of the q2s0r5 protein from salinibacter ruber, northeast structural genomics consortium target srr207 0.861 2 119
4ioh-assembly1.cif.gz_A-2 crystal structure of the tll1086 protein from thermosynechococcus elongatus, northeast structural genomics consortium target ter258 0.7808 3 118
2lq3-assembly1.cif.gz_A solution nmr structure of syc0711_d from synechococcus sp., northeast structural genomics consortium (nesg) target snr212 0.4958 1 120
2lq3-assembly1.cif.gz_A solution nmr structure of syc0711_d from synechococcus sp., northeast structural genomics consortium (nesg) target snr212 0.4924 1 120
ID Description Score Start End Superfamily
3ushA00 Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 0.8622 2 119 3.30.56.110
3ushA00 Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 0.8551 2 119 3.30.56.110
4iohA00 Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 0.7747 3 118 3.30.56.110
4iohA00 Alpha Beta;2-Layer Sandwich;Phenylalanyl-tRNA Synthetase; Chain B, domain 1;Protein of unknown function DUF2237 0.7565 3 118 3.30.56.110
2lq3A01 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.6468 45 117 1.10.1660.80
ID Description Score Start End GO Terms
AF-A0A2V6DHX8-F1-model_v4 DUF2237 domain-containing protein 1.013 77 118
AF-A0A2V5VJH0-F1-model_v4 DUF2237 domain-containing protein 1.006 69 118
AF-A0A2V6FIW9-F1-model_v4 DUF2237 domain-containing protein 0.9984 52 118
AF-A0A1Z8KNJ8-F1-model_v4 Uncharacterized protein 0.9962 79 119
AF-A0A3B9W7D5-F1-model_v4 DUF2237 domain-containing protein 0.9958 68 117

Map