F408354

General Info

Members Datasets Scaffolds Average Seq Length
326 121 652 146

Family's Representative Sequence

Representative Sequence 3300025917|Ga0207660_11020076|Ga0207660_110200761
Length 165
Sequence MNNLTRWEPVRETMTLRDAMDRLFDDAFTRPFSLMRDGGANWSSPAIDMYQTDNEVVVKAAVPGFKADEVQINVTGDVLTIKGESKHEEEKKDRSWQIREHRWGAFERSITLPTGVISDRATADFENGILTITLPKSVTSCLAKSPETRTAPLVKLAAFRPAGGW

Samples

Sample ID Description Type Environment
1 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300029276 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctcc.R1 Metatranscriptome Rhizosphere
80 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
81 3300029280 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stcc.R1 Metatranscriptome Rhizosphere
82 3300029283 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctno.R1 Metatranscriptome Rhizosphere
83 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
84 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
85 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
86 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
87 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
92 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
95 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
96 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
97 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
98 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
103 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
104 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
105 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
106 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
107 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
108 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
109 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
110 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
111 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
112 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
113 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
114 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
115 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
116 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
117 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
120 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
121 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.81
Metatranscriptomes 13.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.08
Stem 0
Stem Tuber 0
Unclassified 31.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207660_11020076 3300025917 Bacteria 675
2 SwRhRL2b_contig_196118 2162886007 Bacteria 7826
3 JGI25406J46586_10004248 3300003203 Bacteria 6694
4 Ga0006777J48905_1047913 3300003308 Unclassified 585
5 Ga0006777J48905_1085600 3300003308 Bacteria 595
6 Ga0007429J51699_1076846 3300003579 Bacteria 570
7 Ga0006780_1021538 3300003735 Bacteria 592
8 Ga0058859_10988753 3300004798 Unclassified 573
9 Ga0058859_11814404 3300004798 Unclassified 510
10 Ga0058861_11541771 3300004800 Unclassified 552
11 Ga0058860_11717052 3300004801 Unclassified 558
12 Ga0058862_12444202 3300004803 Unclassified 537
13 Ga0058862_12833461 3300004803 Unclassified 581
14 Ga0065704_10070349 3300005289 Bacteria 30812
15 Ga0065704_10107715 3300005289 Bacteria 2049
16 Ga0065704_10622185 3300005289 Unclassified 582
17 Ga0065704_10833262 3300005289 Bacteria 514
18 Ga0065715_10010093 3300005293 Bacteria 3246
19 Ga0065707_10034543 3300005295 Bacteria 1436
20 Ga0065707_10081976 3300005295 Bacteria 26469
21 Ga0065707_10096103 3300005295 Bacteria 3304
22 Ga0065707_10104314 3300005295 Unclassified 2702
23 Ga0065707_10164824 3300005295 Bacteria 1531
24 Ga0065707_10283125 3300005295 Bacteria 1010
25 Ga0065707_10462246 3300005295 Bacteria 790
26 Ga0065707_10684717 3300005295 Bacteria 647
27 Ga0068869_101966255 3300005334 Unclassified 524
28 Ga0070680_100737291 3300005336 Bacteria 848
29 Ga0070680_100753310 3300005336 Bacteria 839
30 Ga0070680_100950406 3300005336 Unclassified 742
31 Ga0070680_101979593 3300005336 Bacteria 505
32 Ga0070689_100240446 3300005340 Bacteria 1491
33 Ga0070689_100303711 3300005340 Bacteria 1329
34 Ga0070689_101371247 3300005340 Bacteria 638
35 Ga0070689_101800178 3300005340 Unclassified 558
36 Ga0070687_100072487 3300005343 Bacteria 1854
37 Ga0070692_10533477 3300005345 Bacteria 766
38 Ga0070669_101231325 3300005353 Unclassified 647
39 Ga0070703_10090579 3300005406 Bacteria 1059
40 Ga0070705_100049224 3300005440 Bacteria 2446
41 Ga0070705_101003096 3300005440 Unclassified 678
42 Ga0070700_100161816 3300005441 Bacteria 1541
43 Ga0070694_100236945 3300005444 Bacteria 1375
44 Ga0070694_100793572 3300005444 Bacteria 776
45 Ga0070694_101308985 3300005444 Bacteria 610
46 Ga0068867_101126983 3300005459 Unclassified 717
47 Ga0070706_100493733 3300005467 Bacteria 1139
48 Ga0070706_101474761 3300005467 Unclassified 622
49 Ga0070706_101838478 3300005467 Unclassified 550
50 Ga0070707_100061639 3300005468 Bacteria 3598
51 Ga0070707_100748015 3300005468 Unclassified 941
52 Ga0070698_100040513 3300005471 Bacteria 4786
53 Ga0070698_100066058 3300005471 Unclassified 3641
54 Ga0070698_100117408 3300005471 Bacteria 2623
55 Ga0070698_100491538 3300005471 Unclassified 1165
56 Ga0070698_100522453 3300005471 Bacteria 1125
57 Ga0070698_100610125 3300005471 Bacteria 1032
58 Ga0070698_100695699 3300005471 Bacteria 958
59 Ga0070698_100711583 3300005471 Bacteria 946
60 Ga0070699_100026959 3300005518 Bacteria 4955
61 Ga0070699_100032083 3300005518 Bacteria 4536
62 Ga0070699_100032689 3300005518 Bacteria 4493
63 Ga0070699_100635657 3300005518 Unclassified 974
64 Ga0070699_100805028 3300005518 Bacteria 860
65 Ga0070697_101757760 3300005536 Bacteria 555
66 Ga0070695_100409801 3300005545 Unclassified 1030
67 Ga0070695_100814705 3300005545 Bacteria 749
68 Ga0070696_101788241 3300005546 Bacteria 531
69 Ga0070704_100178159 3300005549 Bacteria 1698
70 Ga0070704_100246269 3300005549 Bacteria 1465
71 Ga0070704_100681755 3300005549 Bacteria 910
72 Ga0070704_100881312 3300005549 Bacteria 804
73 Ga0068857_100878073 3300005577 Unclassified 859
74 Ga0068859_100004691 3300005617 Bacteria 13910
75 Ga0068859_100032311 3300005617 Bacteria 5257
76 Ga0068859_100235152 3300005617 Bacteria 1921
77 Ga0068859_100482411 3300005617 Bacteria 1335
78 Ga0068864_100247721 3300005618 Bacteria 1653
79 Ga0068864_100331880 3300005618 Bacteria 1431
80 Ga0068864_100948379 3300005618 Unclassified 851
81 Ga0068861_100536541 3300005719 Bacteria 1064
82 Ga0068861_101115863 3300005719 Bacteria 759
83 Ga0068870_10086825 3300005840 Bacteria 1741
84 Ga0068870_10418004 3300005840 Bacteria 877
85 Ga0068858_100993208 3300005842 Bacteria 822
86 Ga0068858_101104918 3300005842 Bacteria 778
87 Ga0068862_100004708 3300005844 Bacteria 11492
88 Ga0068862_100212646 3300005844 Unclassified 1748
89 Ga0081539_10010909 3300005985 Bacteria 7293
90 Ga0081539_10016689 3300005985 Bacteria 5220
91 Ga0081539_10077729 3300005985 Bacteria 1754
92 Ga0081539_10384592 3300005985 Unclassified 585
93 Ga0075427_10005204 3300006194 Bacteria 1848
94 Ga0075427_10085637 3300006194 Unclassified 574
95 Ga0075428_100074335 3300006844 Unclassified 3712
96 Ga0075428_100281806 3300006844 Unclassified 1788
97 Ga0075428_100847063 3300006844 Bacteria 971
98 Ga0075428_101327027 3300006844 Unclassified 756
99 Ga0075428_101533566 3300006844 Bacteria 698
100 Ga0075428_101555967 3300006844 Bacteria 692
101 Ga0075428_102265770 3300006844 Bacteria 559
102 Ga0075430_100006341 3300006846 Bacteria 9976
103 Ga0075430_100043102 3300006846 Bacteria 3814
104 Ga0075430_100155945 3300006846 Bacteria 1901
105 Ga0075430_100226425 3300006846 Bacteria 1551
106 Ga0075430_100362877 3300006846 Bacteria 1196
107 Ga0075430_100412665 3300006846 Unclassified 1115
108 Ga0075430_100568596 3300006846 Bacteria 935
109 Ga0075431_100070830 3300006847 Bacteria 3597
110 Ga0075431_100131328 3300006847 Bacteria 2583
111 Ga0075431_100150280 3300006847 Unclassified 2399
112 Ga0075431_100170072 3300006847 Bacteria 2239
113 Ga0075431_100419203 3300006847 Bacteria 1338
114 Ga0075431_101540214 3300006847 Unclassified 623
115 Ga0075433_10494202 3300006852 Unclassified 1077
116 Ga0075433_11320520 3300006852 Unclassified 625
117 Ga0075429_100000137 3300006880 Bacteria 44168
118 Ga0075429_100012774 3300006880 Bacteria 7284
119 Ga0075429_100015293 3300006880 Bacteria 6650
120 Ga0075429_100102030 3300006880 Bacteria 2505
121 Ga0075429_100157527 3300006880 Unclassified 1988
122 Ga0075429_100189470 3300006880 Unclassified 1802
123 Ga0075429_100252250 3300006880 Unclassified 1545
124 Ga0075429_100291137 3300006880 Bacteria 1430
125 Ga0075429_100366202 3300006880 Unclassified 1262
126 Ga0075429_100623802 3300006880 Bacteria 945
127 Ga0075429_100741391 3300006880 Bacteria 860
128 Ga0068865_101162343 3300006881 Bacteria 682
129 Ga0097620_100004691 3300006931 Bacteria 13910
130 Ga0097620_100032310 3300006931 Bacteria 5257
131 Ga0097620_100235149 3300006931 Bacteria 1921
132 Ga0097620_100482402 3300006931 Bacteria 1335
133 Ga0111539_11913677 3300009094 Unclassified 688
134 Ga0111539_12092055 3300009094 Unclassified 657
135 Ga0114129_10002746 3300009147 Bacteria 24536
136 Ga0114129_10006416 3300009147 Bacteria 16677
137 Ga0114129_10013226 3300009147 Bacteria 11753
138 Ga0114129_10076862 3300009147 Bacteria 4646
139 Ga0114129_10092649 3300009147 Bacteria 4186
140 Ga0114129_10245951 3300009147 Bacteria 2403
141 Ga0114129_10329276 3300009147 Unclassified 2028
142 Ga0114129_10399922 3300009147 Unclassified 1810
143 Ga0114129_10530318 3300009147 Bacteria 1534
144 Ga0114129_10648806 3300009147 Bacteria 1363
145 Ga0114129_12620808 3300009147 Bacteria 601
146 Ga0105243_10245284 3300009148 Bacteria 1596
147 Ga0105243_10249567 3300009148 Bacteria 1584
148 Ga0105243_10251271 3300009148 Bacteria 1579
149 Ga0105243_10398477 3300009148 Bacteria 1278
150 Ga0105249_10040397 3300009553 Bacteria 4237
151 Ga0105249_10620377 3300009553 Unclassified 1137
152 Ga0105249_10661259 3300009553 Bacteria 1103
153 Ga0105246_10025443 3300011119 Bacteria 3858
154 Ga0197907_10369913 3300020069 Unclassified 505
155 Ga0206356_10306416 3300020070 Unclassified 541
156 Ga0206356_10621144 3300020070 Unclassified 573
157 Ga0206349_1353194 3300020075 Unclassified 589
158 Ga0206351_10130959 3300020077 Unclassified 511
159 Ga0206351_10272933 3300020077 Bacteria 502
160 Ga0206351_10284128 3300020077 Bacteria 607
161 Ga0206351_10543805 3300020077 Unclassified 578
162 Ga0206351_10975273 3300020077 Bacteria 571
163 Ga0206352_10553937 3300020078 Unclassified 500
164 Ga0206352_10600906 3300020078 Unclassified 591
165 Ga0206352_11051235 3300020078 Bacteria 566
166 Ga0206350_10002614 3300020080 Unclassified 569
167 Ga0206350_10020820 3300020080 Unclassified 558
168 Ga0206350_11211298 3300020080 Unclassified 512
169 Ga0206350_11413039 3300020080 Bacteria 615
170 Ga0206354_10117395 3300020081 Bacteria 560
171 Ga0206354_10120529 3300020081 Unclassified 600
172 Ga0206354_10445799 3300020081 Bacteria 579
173 Ga0206354_10488000 3300020081 Bacteria 683
174 Ga0206354_10612655 3300020081 Bacteria 620
175 Ga0206354_10813375 3300020081 Unclassified 553
176 Ga0206353_10283791 3300020082 Unclassified 513
177 Ga0206353_12054578 3300020082 Unclassified 549
178 Ga0154015_1251456 3300020610 Unclassified 573
179 Ga0207653_10018489 3300025885 Bacteria 2194
180 Ga0207643_10679925 3300025908 Bacteria 665
181 Ga0207684_10492679 3300025910 Bacteria 1051
182 Ga0207646_10138860 3300025922 Bacteria 2188
183 Ga0207681_11092770 3300025923 Unclassified 670
184 Ga0207709_10336046 3300025935 Unclassified 1135
185 Ga0207670_10084028 3300025936 Bacteria 2234
186 Ga0207670_10252967 3300025936 Bacteria 1362
187 Ga0207670_10328250 3300025936 Bacteria 1205
188 Ga0207712_11483092 3300025961 Bacteria 607
189 Ga0207658_11193531 3300025986 Bacteria 696
190 Ga0207703_10547416 3300026035 Bacteria 1091
191 Ga0207703_10913662 3300026035 Bacteria 841
192 Ga0207648_10507551 3300026089 Bacteria 1104
193 Ga0207676_10212500 3300026095 Bacteria 1717
194 Ga0207674_10047797 3300026116 Bacteria 4384
195 Ga0207674_10287254 3300026116 Bacteria 1593
196 Ga0207675_100004153 3300026118 Bacteria 14016
197 Ga0207675_100566746 3300026118 Bacteria 1136
198 Ga0207675_100748998 3300026118 Bacteria 988
199 Ga0209999_1047366 3300027543 Bacteria 809
200 Ga0268265_10020684 3300028380 Bacteria 4598
201 Ga0268265_10134301 3300028380 Unclassified 2062
202 Ga0311004_106649 3300029276 Unclassified 684
203 Ga0311001_1037031 3300029277 Bacteria 560
204 Ga0311001_1050343 3300029277 Unclassified 515
205 Ga0311011_110316 3300029280 Bacteria 604
206 Ga0311011_112782 3300029280 Unclassified 619
207 Ga0310982_133721 3300029283 Bacteria 500
208 Ga0310982_141326 3300029283 Unclassified 733
209 Ga0310981_1000047 3300029285 Unclassified 575
210 Ga0307405_10240408 3300031731 Bacteria 1341
211 Ga0307405_10519154 3300031731 Bacteria 958
212 Ga0307410_10281737 3300031852 Unclassified 1305
213 Ga0307410_10556955 3300031852 Unclassified 951
214 Ga0307406_10270933 3300031901 Unclassified 1290
215 Ga0307407_10300352 3300031903 Bacteria 1119
216 Ga0307409_100824412 3300031995 Bacteria 937
217 Ga0307416_100477795 3300032002 Bacteria 1305
218 Ga0307416_100543686 3300032002 Bacteria 1234
219 Ga0307416_100798173 3300032002 Bacteria 1039
220 Ga0307416_100901662 3300032002 Unclassified 984
221 Ga0307415_100237722 3300032126 Unclassified 1471
222 Ga0373949_0063862 3300035090 Unclassified 953
223 Ga0439433_0065971 3300041999 Bacteria 868
224 Ga0451577_0028464 3300042876 Bacteria 5054
225 Ga0451577_0111352 3300042876 Bacteria 2449
226 Ga0451577_0149335 3300042876 Unclassified 2102
227 Ga0451577_0412090 3300042876 Bacteria 1227
228 Ga0451577_0462010 3300042876 Bacteria 1153
229 Ga0451577_0760895 3300042876 Bacteria 876
230 Ga0451577_0783639 3300042876 Bacteria 862
231 Ga0453683_0048139 3300044673 Bacteria 2674
232 Ga0453683_0165884 3300044673 Unclassified 1398
233 Ga0453683_0259608 3300044673 Bacteria 1108
234 Ga0453683_0520112 3300044673 Unclassified 773
235 Ga0453684_0000003 3300044712 Bacteria 1481694
236 Ga0453684_0000447 3300044712 Bacteria 166799
237 Ga0453684_0001179 3300044712 Bacteria 81099
238 Ga0453684_0026190 3300044712 Bacteria 8436
239 Ga0453684_0027616 3300044712 Bacteria 8130
240 Ga0453684_0056843 3300044712 Bacteria 5071
241 Ga0453684_0063726 3300044712 Bacteria 4713
242 Ga0453684_0082336 3300044712 Bacteria 4009
243 Ga0453684_0176450 3300044712 Bacteria 2513
244 Ga0453684_0185260 3300044712 Bacteria 2440
245 Ga0453684_0412653 3300044712 Unclassified 1510
246 Ga0453684_0568883 3300044712 Bacteria 1246
247 Ga0453684_0632172 3300044712 Bacteria 1170
248 Ga0453684_0685607 3300044712 Unclassified 1115
249 Ga0453684_0903702 3300044712 Bacteria 945
250 Ga0453684_0968788 3300044712 Bacteria 907
251 Ga0453684_1155894 3300044712 Unclassified 815
252 Ga0453684_1450718 3300044712 Bacteria 710
253 Ga0453684_1500340 3300044712 Bacteria 695
254 Ga0453684_2088932 3300044712 Unclassified 568
255 Ga0453684_2182158 3300044712 Unclassified 553
256 Ga0451576_0009907 3300045051 Bacteria 11003
257 Ga0451576_0025161 3300045051 Bacteria 6417
258 Ga0451576_0063878 3300045051 Unclassified 3836
259 Ga0451576_0080642 3300045051 Bacteria 3385
260 Ga0451576_0292694 3300045051 Bacteria 1702
261 Ga0451576_1050872 3300045051 Bacteria 853
262 Ga0451576_1750289 3300045051 Unclassified 643
263 Ga0501299_007927 3300049522 Bacteria 1712
264 Ga0501036_0673057 3300049572 Unclassified 856
265 Ga0501036_1310957 3300049572 Unclassified 588
266 Ga0501039_0227035 3300049575 Bacteria 1468
267 Ga0501040_0330553 3300049576 Bacteria 1091
268 Ga0501048_1120475 3300049582 Unclassified 566
269 Ga0501048_1400842 3300049582 Unclassified 502
270 Ga0501072_0649075 3300049588 Bacteria 831
271 Ga0501072_0981841 3300049588 Bacteria 659
272 Ga0501075_0028189 3300049591 Bacteria 4144
273 Ga0501076_0027859 3300049592 Bacteria 4382
274 Ga0501076_0161229 3300049592 Unclassified 1827
275 Ga0501076_1045419 3300049592 Unclassified 673
276 Ga0501216_052410 3300049660 Bacteria 805
277 Ga0501222_025506 3300049662 Unclassified 801
278 Ga0501227_134515 3300049665 Unclassified 675
279 Ga0501243_101136 3300049675 Unclassified 582
280 Ga0501253_204723 3300049683 Unclassified 522
281 Ga0501257_054467 3300049686 Bacteria 1002
282 Ga0501079_0240079 3300049741 Bacteria 1416
283 Ga0501080_0716880 3300049742 Bacteria 881
284 Ga0501080_1724624 3300049742 Unclassified 528
285 Ga0501081_1386184 3300049743 Bacteria 533
286 Ga0501283_098304 3300049779 Unclassified 567
287 nmdc:mga05p37_11032_c1 3300050507 Bacteria 10735
288 nmdc:mga05p37_11061_c1 3300050507 Bacteria 10722
289 nmdc:mga05p37_213337_c1 3300050507 Bacteria 2333
290 nmdc:mga05p37_24508_c1 3300050507 Bacteria 7335
291 nmdc:mga05p37_3837_c1 3300050507 Bacteria 17586
292 nmdc:mga05p37_468117_c1 3300050507 Unclassified 1017
293 nmdc:mga05p37_745213_c1 3300050507 Bacteria 1081
294 nmdc:mga05p37_77045_c1 3300050507 Bacteria 4105
295 nmdc:mga09592_166568_c1 3300050508 Bacteria 1905
296 nmdc:mga09592_1684898_c1 3300050508 Bacteria 512
297 nmdc:mga09592_17182_c1 3300050508 Bacteria 5924
298 nmdc:mga09592_194_c1 3300050508 Bacteria 43708
299 nmdc:mga09592_208564_c1 3300050508 Unclassified 1693
300 nmdc:mga09592_254446_c1 3300050508 Bacteria 1522
301 nmdc:mga09592_326092_c1 3300050508 Unclassified 1330
302 nmdc:mga09592_344_c1 3300050508 Bacteria 11087
303 nmdc:mga09592_360329_c1 3300050508 Bacteria 1258
304 nmdc:mga09592_484658_c1 3300050508 Unclassified 1065
305 nmdc:mga09592_525340_c1 3300050508 Unclassified 1018
306 nmdc:mga09592_76058_c1 3300050508 Bacteria 2855
307 nmdc:mga09592_90678_c1 3300050508 Bacteria 2612
308 nmdc:mga0qj67_1049509_c1 3300050509 Bacteria 638
309 nmdc:mga0qj67_15626_c1 3300050509 Bacteria 5749
310 nmdc:mga0qj67_228445_c1 3300050509 Bacteria 1510
311 nmdc:mga0qj67_344826_c1 3300050509 Bacteria 1204
312 nmdc:mga0qj67_39931_c1 3300050509 Bacteria 3687
313 nmdc:mga0qj67_436534_c1 3300050509 Unclassified 1055
314 nmdc:mga0qj67_628546_c1 3300050509 Unclassified 858
315 nmdc:mga06r32_283276_c1 3300050510 Bacteria 1644
316 nmdc:mga06r32_438881_c1 3300050510 Unclassified 1286
317 nmdc:mga06r32_724857_c1 3300050510 Bacteria 959
318 nmdc:mga06r32_84688_c1 3300050510 Bacteria 3090
319 nmdc:mga06r32_872155_c1 3300050510 Bacteria 858
320 nmdc:mga0a205_1535519_c1 3300050515 Bacteria 514
321 nmdc:mga0a205_206876_c1 3300050515 Bacteria 1851
322 nmdc:mga0a205_384143_c1 3300050515 Bacteria 1269
323 nmdc:mga0a205_829571_c1 3300050515 Bacteria 772
324 Ga0501084_0275025 3300054114 Bacteria 1422
325 Ga0501084_1230536 3300054114 Bacteria 628
326 Ga0501082_0156051 3300060353 Bacteria 1983
327 Ga0207660_11020076
328 SwRhRL2b_contig_196118
329 JGI25406J46586_10004248
330 Ga0006777J48905_1047913
331 Ga0006777J48905_1085600
332 Ga0007429J51699_1076846
333 Ga0006780_1021538
334 Ga0058859_10988753
335 Ga0058859_11814404
336 Ga0058861_11541771
337 Ga0058860_11717052
338 Ga0058862_12444202
339 Ga0058862_12833461
340 Ga0065704_10070349
341 Ga0065704_10107715
342 Ga0065704_10622185
343 Ga0065704_10833262
344 Ga0065715_10010093
345 Ga0065707_10034543
346 Ga0065707_10081976
347 Ga0065707_10096103
348 Ga0065707_10104314
349 Ga0065707_10164824
350 Ga0065707_10283125
351 Ga0065707_10462246
352 Ga0065707_10684717
353 Ga0068869_101966255
354 Ga0070680_100737291
355 Ga0070680_100753310
356 Ga0070680_100950406
357 Ga0070680_101979593
358 Ga0070689_100240446
359 Ga0070689_100303711
360 Ga0070689_101371247
361 Ga0070689_101800178
362 Ga0070687_100072487
363 Ga0070692_10533477
364 Ga0070669_101231325
365 Ga0070703_10090579
366 Ga0070705_100049224
367 Ga0070705_101003096
368 Ga0070700_100161816
369 Ga0070694_100236945
370 Ga0070694_100793572
371 Ga0070694_101308985
372 Ga0068867_101126983
373 Ga0070706_100493733
374 Ga0070706_101474761
375 Ga0070706_101838478
376 Ga0070707_100061639
377 Ga0070707_100748015
378 Ga0070698_100040513
379 Ga0070698_100066058
380 Ga0070698_100117408
381 Ga0070698_100491538
382 Ga0070698_100522453
383 Ga0070698_100610125
384 Ga0070698_100695699
385 Ga0070698_100711583
386 Ga0070699_100026959
387 Ga0070699_100032083
388 Ga0070699_100032689
389 Ga0070699_100635657
390 Ga0070699_100805028
391 Ga0070697_101757760
392 Ga0070695_100409801
393 Ga0070695_100814705
394 Ga0070696_101788241
395 Ga0070704_100178159
396 Ga0070704_100246269
397 Ga0070704_100681755
398 Ga0070704_100881312
399 Ga0068857_100878073
400 Ga0068859_100004691
401 Ga0068859_100032311
402 Ga0068859_100235152
403 Ga0068859_100482411
404 Ga0068864_100247721
405 Ga0068864_100331880
406 Ga0068864_100948379
407 Ga0068861_100536541
408 Ga0068861_101115863
409 Ga0068870_10086825
410 Ga0068870_10418004
411 Ga0068858_100993208
412 Ga0068858_101104918
413 Ga0068862_100004708
414 Ga0068862_100212646
415 Ga0081539_10010909
416 Ga0081539_10016689
417 Ga0081539_10077729
418 Ga0081539_10384592
419 Ga0075427_10005204
420 Ga0075427_10085637
421 Ga0075428_100074335
422 Ga0075428_100281806
423 Ga0075428_100847063
424 Ga0075428_101327027
425 Ga0075428_101533566
426 Ga0075428_101555967
427 Ga0075428_102265770
428 Ga0075430_100006341
429 Ga0075430_100043102
430 Ga0075430_100155945
431 Ga0075430_100226425
432 Ga0075430_100362877
433 Ga0075430_100412665
434 Ga0075430_100568596
435 Ga0075431_100070830
436 Ga0075431_100131328
437 Ga0075431_100150280
438 Ga0075431_100170072
439 Ga0075431_100419203
440 Ga0075431_101540214
441 Ga0075433_10494202
442 Ga0075433_11320520
443 Ga0075429_100000137
444 Ga0075429_100012774
445 Ga0075429_100015293
446 Ga0075429_100102030
447 Ga0075429_100157527
448 Ga0075429_100189470
449 Ga0075429_100252250
450 Ga0075429_100291137
451 Ga0075429_100366202
452 Ga0075429_100623802
453 Ga0075429_100741391
454 Ga0068865_101162343
455 Ga0097620_100004691
456 Ga0097620_100032310
457 Ga0097620_100235149
458 Ga0097620_100482402
459 Ga0111539_11913677
460 Ga0111539_12092055
461 Ga0114129_10002746
462 Ga0114129_10006416
463 Ga0114129_10013226
464 Ga0114129_10076862
465 Ga0114129_10092649
466 Ga0114129_10245951
467 Ga0114129_10329276
468 Ga0114129_10399922
469 Ga0114129_10530318
470 Ga0114129_10648806
471 Ga0114129_12620808
472 Ga0105243_10245284
473 Ga0105243_10249567
474 Ga0105243_10251271
475 Ga0105243_10398477
476 Ga0105249_10040397
477 Ga0105249_10620377
478 Ga0105249_10661259
479 Ga0105246_10025443
480 Ga0197907_10369913
481 Ga0206356_10306416
482 Ga0206356_10621144
483 Ga0206349_1353194
484 Ga0206351_10130959
485 Ga0206351_10272933
486 Ga0206351_10284128
487 Ga0206351_10543805
488 Ga0206351_10975273
489 Ga0206352_10553937
490 Ga0206352_10600906
491 Ga0206352_11051235
492 Ga0206350_10002614
493 Ga0206350_10020820
494 Ga0206350_11211298
495 Ga0206350_11413039
496 Ga0206354_10117395
497 Ga0206354_10120529
498 Ga0206354_10445799
499 Ga0206354_10488000
500 Ga0206354_10612655
501 Ga0206354_10813375
502 Ga0206353_10283791
503 Ga0206353_12054578
504 Ga0154015_1251456
505 Ga0207653_10018489
506 Ga0207643_10679925
507 Ga0207684_10492679
508 Ga0207646_10138860
509 Ga0207681_11092770
510 Ga0207709_10336046
511 Ga0207670_10084028
512 Ga0207670_10252967
513 Ga0207670_10328250
514 Ga0207712_11483092
515 Ga0207658_11193531
516 Ga0207703_10547416
517 Ga0207703_10913662
518 Ga0207648_10507551
519 Ga0207676_10212500
520 Ga0207674_10047797
521 Ga0207674_10287254
522 Ga0207675_100004153
523 Ga0207675_100566746
524 Ga0207675_100748998
525 Ga0209999_1047366
526 Ga0268265_10020684
527 Ga0268265_10134301
528 Ga0311004_106649
529 Ga0311001_1037031
530 Ga0311001_1050343
531 Ga0311011_110316
532 Ga0311011_112782
533 Ga0310982_133721
534 Ga0310982_141326
535 Ga0310981_1000047
536 Ga0307405_10240408
537 Ga0307405_10519154
538 Ga0307410_10281737
539 Ga0307410_10556955
540 Ga0307406_10270933
541 Ga0307407_10300352
542 Ga0307409_100824412
543 Ga0307416_100477795
544 Ga0307416_100543686
545 Ga0307416_100798173
546 Ga0307416_100901662
547 Ga0307415_100237722
548 Ga0373949_0063862
549 Ga0439433_0065971
550 Ga0451577_0028464
551 Ga0451577_0111352
552 Ga0451577_0149335
553 Ga0451577_0412090
554 Ga0451577_0462010
555 Ga0451577_0760895
556 Ga0451577_0783639
557 Ga0453683_0048139
558 Ga0453683_0165884
559 Ga0453683_0259608
560 Ga0453683_0520112
561 Ga0453684_0000003
562 Ga0453684_0000447
563 Ga0453684_0001179
564 Ga0453684_0026190
565 Ga0453684_0027616
566 Ga0453684_0056843
567 Ga0453684_0063726
568 Ga0453684_0082336
569 Ga0453684_0176450
570 Ga0453684_0185260
571 Ga0453684_0412653
572 Ga0453684_0568883
573 Ga0453684_0632172
574 Ga0453684_0685607
575 Ga0453684_0903702
576 Ga0453684_0968788
577 Ga0453684_1155894
578 Ga0453684_1450718
579 Ga0453684_1500340
580 Ga0453684_2088932
581 Ga0453684_2182158
582 Ga0451576_0009907
583 Ga0451576_0025161
584 Ga0451576_0063878
585 Ga0451576_0080642
586 Ga0451576_0292694
587 Ga0451576_1050872
588 Ga0451576_1750289
589 Ga0501299_007927
590 Ga0501036_0673057
591 Ga0501036_1310957
592 Ga0501039_0227035
593 Ga0501040_0330553
594 Ga0501048_1120475
595 Ga0501048_1400842
596 Ga0501072_0649075
597 Ga0501072_0981841
598 Ga0501075_0028189
599 Ga0501076_0027859
600 Ga0501076_0161229
601 Ga0501076_1045419
602 Ga0501216_052410
603 Ga0501222_025506
604 Ga0501227_134515
605 Ga0501243_101136
606 Ga0501253_204723
607 Ga0501257_054467
608 Ga0501079_0240079
609 Ga0501080_0716880
610 Ga0501080_1724624
611 Ga0501081_1386184
612 Ga0501283_098304
613 nmdc:mga05p37_11032_c1
614 nmdc:mga05p37_11061_c1
615 nmdc:mga05p37_213337_c1
616 nmdc:mga05p37_24508_c1
617 nmdc:mga05p37_3837_c1
618 nmdc:mga05p37_468117_c1
619 nmdc:mga05p37_745213_c1
620 nmdc:mga05p37_77045_c1
621 nmdc:mga09592_166568_c1
622 nmdc:mga09592_1684898_c1
623 nmdc:mga09592_17182_c1
624 nmdc:mga09592_194_c1
625 nmdc:mga09592_208564_c1
626 nmdc:mga09592_254446_c1
627 nmdc:mga09592_326092_c1
628 nmdc:mga09592_344_c1
629 nmdc:mga09592_360329_c1
630 nmdc:mga09592_484658_c1
631 nmdc:mga09592_525340_c1
632 nmdc:mga09592_76058_c1
633 nmdc:mga09592_90678_c1
634 nmdc:mga0qj67_1049509_c1
635 nmdc:mga0qj67_15626_c1
636 nmdc:mga0qj67_228445_c1
637 nmdc:mga0qj67_344826_c1
638 nmdc:mga0qj67_39931_c1
639 nmdc:mga0qj67_436534_c1
640 nmdc:mga0qj67_628546_c1
641 nmdc:mga06r32_283276_c1
642 nmdc:mga06r32_438881_c1
643 nmdc:mga06r32_724857_c1
644 nmdc:mga06r32_84688_c1
645 nmdc:mga06r32_872155_c1
646 nmdc:mga0a205_1535519_c1
647 nmdc:mga0a205_206876_c1
648 nmdc:mga0a205_384143_c1
649 nmdc:mga0a205_829571_c1
650 Ga0501084_0275025
651 Ga0501084_1230536
652 Ga0501082_0156051

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17886

ArsA_HSP20

HSP20-like domain found in ArsA

53

134

0.97

PF00011

HSP20

Hsp20/alpha crystallin family

48

148

0.94

PF04969

CS

CS domain

45

136

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rzk-assembly1.cif.gz_B crystal structure of sulfolobus solfataricus hsp20.1 acd 0.8777 41 134
4mjh-assembly3.cif.gz_C human hsp27 core domain in complex with c-terminal peptide 0.8389 54 132
4m5t-assembly3.cif.gz_C disulfide trapped human alphab crystallin core domain in complex with c-terminal peptide 0.8328 45 135
4m5t-assembly3.cif.gz_A disulfide trapped human alphab crystallin core domain in complex with c-terminal peptide 0.8295 45 135
2y22-assembly1.cif.gz_A human alphab-crystallin domain (residues 67-157) 0.8291 45 135
ID Description Score Start End Superfamily
af_C0PJF1_1_102_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8833 42 135 2.60.40.790
4rzkB00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8777 41 134 2.60.40.790
2bolB03 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8739 52 134 2.60.40.790
af_I1M7E1_1_101_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8665 42 133 2.60.40.790
af_F4HWW7_1_102_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8649 42 133 2.60.40.790
ID Description Score Start End GO Terms
AF-A0A2E5F636-F1-model_v4 SHSP domain-containing protein 0.8668 40 146
AF-A0A1V5CCW2-F1-model_v4 Spore protein SP21 0.8446 41 147
AF-A0A011P689-F1-model_v4 Spore protein SP21 0.8405 41 145
AF-A0A1V5CCW2-F1-model_v4 Spore protein SP21 0.8361 41 147
AF-A0A7T9KQJ3-F1-model_v4 deleted 0.8172 40 147

Map