F408356

General Info

Members Datasets Scaffolds Average Seq Length
326 186 652 310

Family's Representative Sequence

Representative Sequence 3300025919|Ga0207657_10039459|Ga0207657_100394594
Length 328
Sequence VELDRGHARSVLSTLPGVGLAHWDDVDERRAAKGEMDAVWQMLGRAAGTAGVGVNRVRVASGKLPTPPHSHGASEEIYFVLAGSGLAWQDGDVHEIRPRDCIIQTPDHFEHTFVAGPDGLEYLVYGTRHPTEIGWLPRSRAIRIGWPWVEGRDDDPWDIEAAGPPLEVGDPKPRPENIRNVDEVELQSEGNQTWAGFEGSELAGFAWERLAPGKMGSVPHCHSEEEEIFVVLEGSATLHLWPSPRRAATGAQREQHELRPGHVVSRPPGSGTPHHFVAGEEGCTMLVYGTRKPNDMCFYPRSNKIAWRGLGVIGRVEHLDYWDGEERE

Samples

Sample ID Description Type Environment
1 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
77 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
80 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
81 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
82 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
83 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
84 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
85 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
86 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
89 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
90 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
91 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
99 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
100 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
101 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
102 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
103 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
104 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
105 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
106 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
107 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
110 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
111 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
112 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
119 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
120 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
121 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
122 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
123 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
124 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
125 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
126 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
132 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
135 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
136 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
137 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
138 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
139 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
152 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
172 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
173 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
179 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
180 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
181 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
182 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
183 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
184 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
185 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
186 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.47
Metatranscriptomes 1.53
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.44
Rhizosphere 92.02
Stem 0
Stem Tuber 0
Unclassified 9.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207657_10039459 3300025919 Bacteria 4195
2 rootH1_10033596 3300003323 Bacteria 1247
3 Ga0070683_100134254 3300005329 Bacteria 2343
4 Ga0068869_100048664 3300005334 Bacteria 3067
5 Ga0070682_100164081 3300005337 Unclassified 1537
6 Ga0070682_100205561 3300005337 Unclassified 1392
7 Ga0070660_100001270 3300005339 Bacteria 17212
8 Ga0070660_100162814 3300005339 Bacteria 1798
9 Ga0070660_100285173 3300005339 Bacteria 1352
10 Ga0070661_100012084 3300005344 Bacteria 6035
11 Ga0070661_100176625 3300005344 Bacteria 1623
12 Ga0070675_100237803 3300005354 Bacteria 1591
13 Ga0070671_100128596 3300005355 Bacteria 2133
14 Ga0070671_100230773 3300005355 Bacteria 1571
15 Ga0070674_100266099 3300005356 Bacteria 1353
16 Ga0070709_10068220 3300005434 Bacteria 2286
17 Ga0070709_10174648 3300005434 Bacteria 1504
18 Ga0070713_100384265 3300005436 Bacteria 1308
19 Ga0070710_10249350 3300005437 Unclassified 1141
20 Ga0070711_100000341 3300005439 Bacteria 23948
21 Ga0070678_100178516 3300005456 Bacteria 1736
22 Ga0070681_10000752 3300005458 Bacteria 26939
23 Ga0070681_10282172 3300005458 Bacteria 1571
24 Ga0068867_100074557 3300005459 Bacteria 2544
25 Ga0070698_100022476 3300005471 Bacteria 6597
26 Ga0070679_100071755 3300005530 Bacteria 3454
27 Ga0070679_100089122 3300005530 Bacteria 3072
28 Ga0070679_100215094 3300005530 Bacteria 1884
29 Ga0068853_100173014 3300005539 Unclassified 1954
30 Ga0070665_100090473 3300005548 Bacteria 3066
31 Ga0068855_100022559 3300005563 Bacteria 7543
32 Ga0068855_100063551 3300005563 Bacteria 4308
33 Ga0068855_100067800 3300005563 Bacteria 4155
34 Ga0068855_100337202 3300005563 Bacteria 1663
35 Ga0068857_100071236 3300005577 Bacteria 3097
36 Ga0068857_100187268 3300005577 Bacteria 1884
37 Ga0068854_100508981 3300005578 Unclassified 1015
38 Ga0068856_100025658 3300005614 Bacteria 5746
39 Ga0068852_100067985 3300005616 Bacteria 3116
40 Ga0068866_10034965 3300005718 Bacteria 2451
41 Ga0068866_10143358 3300005718 Bacteria 1374
42 Ga0081455_10044729 3300005937 Bacteria 3858
43 Ga0070717_10001661 3300006028 Bacteria 15459
44 Ga0075432_10004801 3300006058 Bacteria 4598
45 Ga0070712_100005578 3300006175 Bacteria 7784
46 Ga0070712_100020446 3300006175 Bacteria 4332
47 Ga0070712_100036799 3300006175 Bacteria 3333
48 Ga0068871_100425160 3300006358 Bacteria 1187
49 Ga0075428_100408039 3300006844 Bacteria 1456
50 Ga0075433_10052695 3300006852 Bacteria 3546
51 Ga0075436_100015350 3300006914 Bacteria 5247
52 Ga0075436_100042366 3300006914 Bacteria 3140
53 Ga0075435_100024952 3300007076 Bacteria 4648
54 Ga0105240_10223689 3300009093 Bacteria 2191
55 Ga0111539_10012304 3300009094 Bacteria 10723
56 Ga0111539_10747396 3300009094 Bacteria 1138
57 Ga0105245_10039318 3300009098 Bacteria 4210
58 Ga0105245_10045592 3300009098 Bacteria 3916
59 Ga0105245_10367798 3300009098 Bacteria 1429
60 Ga0105247_10044176 3300009101 Bacteria 2732
61 Ga0105242_10012764 3300009176 Bacteria 6470
62 Ga0105237_10079980 3300009545 Bacteria 3259
63 Ga0105238_10008930 3300009551 Bacteria 10031
64 Ga0105238_10074948 3300009551 Bacteria 3376
65 Ga0105238_10572422 3300009551 Bacteria 1135
66 Ga0157370_10040724 3300013104 Bacteria 4485
67 Ga0157374_10182977 3300013296 Bacteria 2048
68 Ga0157372_10073346 3300013307 Bacteria 3858
69 Ga0157372_10504021 3300013307 Bacteria 1411
70 Ga0182008_10061673 3300014497 Bacteria 1848
71 Ga0157379_10533771 3300014968 Unclassified 1090
72 Ga0197907_10614961 3300020069 Bacteria 1681
73 Ga0206354_10337584 3300020081 Bacteria 1315
74 Ga0206354_11199835 3300020081 Bacteria 1302
75 Ga0206353_11851681 3300020082 Unclassified 1646
76 Ga0224712_10156946 3300022467 Unclassified 1012
77 Ga0207692_10190307 3300025898 Unclassified 1201
78 Ga0207705_10106116 3300025909 Bacteria 2071
79 Ga0207705_10134984 3300025909 Bacteria 1839
80 Ga0207707_10005535 3300025912 Bacteria 11046
81 Ga0207707_10029462 3300025912 Bacteria 4799
82 Ga0207707_10102199 3300025912 Bacteria 2505
83 Ga0207695_10188941 3300025913 Bacteria 1978
84 Ga0207693_10002081 3300025915 Bacteria 17492
85 Ga0207693_10084879 3300025915 Bacteria 2481
86 Ga0207693_10218046 3300025915 Bacteria 1499
87 Ga0207663_10021886 3300025916 Bacteria 3647
88 Ga0207660_10067607 3300025917 Bacteria 2589
89 Ga0207660_10146918 3300025917 Bacteria 1808
90 Ga0207657_10000651 3300025919 Bacteria 36939
91 Ga0207657_10000941 3300025919 Bacteria 30830
92 Ga0207649_10055725 3300025920 Bacteria 2466
93 Ga0207652_10078115 3300025921 Bacteria 2889
94 Ga0207694_10073178 3300025924 Bacteria 2680
95 Ga0207694_10301263 3300025924 Bacteria 1320
96 Ga0207659_10193982 3300025926 Bacteria 1618
97 Ga0207664_10053637 3300025929 Bacteria 3193
98 Ga0207644_10070240 3300025931 Bacteria 2559
99 Ga0207686_10049821 3300025934 Bacteria 2602
100 Ga0207709_10035839 3300025935 Bacteria 2937
101 Ga0207665_10000060 3300025939 Bacteria 70443
102 Ga0207665_10183980 3300025939 Bacteria 1515
103 Ga0207661_10023632 3300025944 Bacteria 4647
104 Ga0207667_10178754 3300025949 Bacteria 2179
105 Ga0207639_10038965 3300026041 Bacteria 3539
106 Ga0207639_10042864 3300026041 Bacteria 3394
107 Ga0207674_10292870 3300026116 Unclassified 1576
108 Ga0207683_10206689 3300026121 Bacteria 1786
109 Ga0207698_10410035 3300026142 Bacteria 1297
110 Ga0207428_10007861 3300027907 Bacteria 9699
111 Ga0265319_1027790 3300028563 Bacteria 2001
112 Ga0265318_10008313 3300028577 Bacteria 4627
113 Ga0265338_10078363 3300028800 Bacteria 2787
114 Ga0265338_10281214 3300028800 Unclassified 1216
115 Ga0265332_10012919 3300031238 Bacteria 3702
116 Ga0265328_10002677 3300031239 Bacteria 7968
117 Ga0265325_10001119 3300031241 Bacteria 19210
118 Ga0265329_10024137 3300031242 Bacteria 2019
119 Ga0265340_10051754 3300031247 Bacteria 1987
120 Ga0265327_10009733 3300031251 Bacteria 6879
121 Ga0265327_10057064 3300031251 Unclassified 2010
122 Ga0265313_10063482 3300031595 Bacteria 1721
123 Ga0265342_10087533 3300031712 Bacteria 1789
124 Ga0307411_10380297 3300032005 Bacteria 1161
125 Ga0373926_0092265 3300035083 Bacteria 1127
126 Ga0373953_0076615 3300035117 Bacteria 1386
127 Ga0373927_0159768 3300035695 Bacteria 1476
128 Ga0373933_0133417 3300035724 Bacteria 1563
129 Ga0373937_0000494 3300036401 Bacteria 35944
130 Ga0373937_0114468 3300036401 Bacteria 2511
131 Ga0373937_0127519 3300036401 Bacteria 2375
132 Ga0395899_0021226 3300037312 Bacteria 4925
133 Ga0395900_0007485 3300037418 Bacteria 11277
134 Ga0395900_0237546 3300037418 Bacteria 1829
135 Ga0395900_0241033 3300037418 Bacteria 1814
136 Ga0395900_0310160 3300037418 Bacteria 1561
137 Ga0395900_0420040 3300037418 Bacteria 1298
138 Ga0395898_0001584 3300037466 Bacteria 31082
139 Ga0395898_0216304 3300037466 Bacteria 1827
140 Ga0395898_0236426 3300037466 Bacteria 1742
141 Ga0395898_0499432 3300037466 Bacteria 1157
142 Ga0395905_0087035 3300037471 Bacteria 2929
143 Ga0395905_0163896 3300037471 Bacteria 2089
144 Ga0395905_0235772 3300037471 Bacteria 1710
145 Ga0395901_0001414 3300038443 Bacteria 25054
146 Ga0395901_0059084 3300038443 Bacteria 3989
147 Ga0395901_0099202 3300038443 Bacteria 3054
148 Ga0451807_1075421 3300041486 Bacteria 1268
149 Ga0451835_0535582 3300041492 Bacteria 2231
150 Ga0451839_0782197 3300041496 Bacteria 1867
151 Ga0451849_0829885 3300041505 Bacteria 1288
152 Ga0451855_0171249 3300041511 Bacteria 1681
153 Ga0439446_0000667 3300042156 Bacteria 7132
154 Ga0439434_0002292 3300042435 Bacteria 5563
155 Ga0466965_0007732 3300044683 Bacteria 4946
156 Ga0466966_0014862 3300044684 Bacteria 5150
157 Ga0466966_0052451 3300044684 Bacteria 2590
158 Ga0466966_0096112 3300044684 Bacteria 1835
159 Ga0466966_0113821 3300044684 Bacteria 1666
160 Ga0466966_0115709 3300044684 Bacteria 1650
161 Ga0466966_0126966 3300044684 Bacteria 1563
162 Ga0466961_0004049 3300044693 Bacteria 9184
163 Ga0466961_0011374 3300044693 Bacteria 5691
164 Ga0466961_0075801 3300044693 Bacteria 2132
165 Ga0466961_0099940 3300044693 Bacteria 1828
166 Ga0466963_0000686 3300044694 Bacteria 16445
167 Ga0466963_0003398 3300044694 Bacteria 9103
168 Ga0466963_0012968 3300044694 Bacteria 5109
169 Ga0466963_0015662 3300044694 Bacteria 4703
170 Ga0466963_0027991 3300044694 Bacteria 3614
171 Ga0466963_0036275 3300044694 Bacteria 3214
172 Ga0466963_0046820 3300044694 Bacteria 2853
173 Ga0466963_0047997 3300044694 Bacteria 2819
174 Ga0466963_0048030 3300044694 Bacteria 2818
175 Ga0466963_0058417 3300044694 Bacteria 2571
176 Ga0466963_0146710 3300044694 Bacteria 1637
177 Ga0466963_0188907 3300044694 Bacteria 1439
178 Ga0466964_0007188 3300044706 Bacteria 4164
179 Ga0466964_0014952 3300044706 Bacteria 2955
180 Ga0466964_0116078 3300044706 Bacteria 1200
181 Ga0466971_0004642 3300044719 Bacteria 5935
182 Ga0466971_0007945 3300044719 Bacteria 4622
183 Ga0466968_0025554 3300044735 Bacteria 2418
184 Ga0466970_0001717 3300044765 Bacteria 10542
185 Ga0466970_0055411 3300044765 Bacteria 2117
186 Ga0466970_0085727 3300044765 Unclassified 1706
187 Ga0466957_0001760 3300044842 Bacteria 11390
188 Ga0466957_0009837 3300044842 Bacteria 5467
189 Ga0466957_0015472 3300044842 Bacteria 4456
190 Ga0466957_0016220 3300044842 Bacteria 4356
191 Ga0466957_0052228 3300044842 Bacteria 2488
192 Ga0466957_0254072 3300044842 Bacteria 1169
193 Ga0466957_0404813 3300044842 Unclassified 934
194 Ga0466960_0198977 3300044901 Unclassified 1094
195 Ga0466959_0001127 3300045049 Bacteria 16111
196 Ga0466959_0020641 3300045049 Bacteria 4854
197 Ga0466959_0041244 3300045049 Bacteria 3408
198 Ga0466959_0047468 3300045049 Bacteria 3158
199 Ga0466958_0003210 3300045836 Bacteria 8443
200 Ga0466958_0006409 3300045836 Bacteria 6402
201 Ga0466958_0026201 3300045836 Bacteria 3444
202 Ga0466958_0027760 3300045836 Bacteria 3350
203 Ga0466958_0033578 3300045836 Bacteria 3057
204 Ga0466967_0000367 3300045976 Bacteria 20993
205 Ga0466967_0007395 3300045976 Bacteria 7917
206 Ga0466967_0009473 3300045976 Bacteria 7228
207 Ga0466967_0010182 3300045976 Bacteria 7032
208 Ga0466967_0010856 3300045976 Bacteria 6861
209 Ga0466967_0017320 3300045976 Bacteria 5715
210 Ga0466967_0018787 3300045976 Bacteria 5537
211 Ga0466967_0033765 3300045976 Bacteria 4335
212 Ga0466967_0051582 3300045976 Bacteria 3606
213 Ga0466967_0071080 3300045976 Bacteria 3115
214 Ga0466967_0091361 3300045976 Bacteria 2767
215 Ga0466967_0111743 3300045976 Bacteria 2511
216 Ga0466967_0130152 3300045976 Bacteria 2335
217 Ga0466967_0197644 3300045976 Bacteria 1903
218 Ga0495592_0000123 3300046454 Bacteria 68503
219 Ga0495651_0000008 3300046462 Bacteria 156989
220 Ga0495653_0006797 3300046463 Bacteria 9395
221 Ga0495653_0190266 3300046463 Bacteria 1401
222 Ga0495580_0047205 3300046472 Bacteria 3053
223 Ga0495664_0214840 3300046477 Bacteria 1164
224 Ga0495608_0001396 3300046511 Bacteria 17181
225 Ga0495608_0019502 3300046511 Bacteria 4666
226 Ga0495608_0207250 3300046511 Bacteria 1233
227 Ga0495618_0002333 3300046514 Bacteria 12257
228 Ga0495618_0016885 3300046514 Bacteria 4472
229 Ga0495628_0000016 3300046516 Bacteria 170260
230 Ga0495628_0061669 3300046516 Bacteria 2941
231 Ga0495628_0063746 3300046516 Bacteria 2887
232 Ga0495630_0020192 3300046517 Bacteria 4909
233 Ga0495630_0023711 3300046517 Bacteria 4536
234 Ga0495652_0000045 3300046529 Bacteria 122469
235 Ga0495640_0045469 3300046533 Bacteria 3046
236 Ga0495640_0053581 3300046533 Bacteria 2765
237 Ga0495640_0097008 3300046533 Unclassified 1939
238 Ga0495640_0194517 3300046533 Bacteria 1288
239 Ga0495587_0000275 3300046536 Bacteria 36839
240 Ga0495645_0000068 3300046543 Bacteria 72552
241 Ga0495645_0077158 3300046543 Bacteria 2396
242 Ga0495645_0209395 3300046543 Bacteria 1317
243 Ga0495667_0087052 3300046559 Bacteria 2026
244 Ga0495634_0069879 3300046642 Bacteria 2315
245 Ga0495635_0039290 3300046663 Bacteria 3273
246 Ga0495657_0005214 3300046675 Bacteria 10289
247 Ga0495657_0045768 3300046675 Bacteria 2967
248 Ga0495599_0000271 3300046678 Bacteria 32430
249 Ga0495599_0029027 3300046678 Bacteria 3466
250 Ga0495623_0001174 3300046679 Bacteria 17771
251 Ga0495646_0000588 3300046680 Bacteria 19747
252 Ga0495647_0028733 3300046681 Bacteria 2052
253 Ga0495600_0032676 3300046809 Bacteria 3377
254 Ga0495604_0000072 3300047317 Bacteria 88631
255 Ga0495604_0056469 3300047317 Bacteria 3022
256 Ga0495604_0197646 3300047317 Bacteria 1397
257 Ga0495674_0004634 3300047319 Bacteria 13218
258 Ga0495674_0030291 3300047319 Bacteria 4921
259 Ga0495674_0076209 3300047319 Bacteria 2885
260 Ga0495674_0117722 3300047319 Bacteria 2247
261 Ga0495674_0161564 3300047319 Bacteria 1874
262 Ga0495680_0005913 3300047322 Bacteria 11439
263 Ga0495675_0000269 3300047444 Bacteria 37748
264 Ga0495675_0189129 3300047444 Unclassified 1257
265 Ga0495602_0001060 3300048088 Bacteria 26944
266 Ga0495614_0125881 3300048089 Unclassified 1132
267 Ga0496100_0133147 3300048903 Unclassified 1753
268 Ga0496101_0001655 3300048904 Bacteria 13367
269 Ga0496102_0036355 3300048905 Bacteria 4436
270 Ga0496102_0315568 3300048905 Unclassified 1473
271 Ga0496104_0192166 3300048907 Unclassified 1953
272 Ga0496105_0057777 3300048908 Bacteria 3203
273 Ga0496105_0185900 3300048908 Bacteria 1700
274 Ga0496106_0023106 3300048909 Bacteria 4618
275 Ga0496107_0016196 3300048910 Bacteria 5232
276 Ga0496108_0107065 3300048911 Bacteria 2387
277 Ga0496110_0148689 3300048913 Bacteria 2120
278 Ga0496111_0086575 3300048914 Bacteria 2292
279 Ga0496111_0389974 3300048914 Bacteria 1030
280 Ga0496112_0076316 3300048915 Bacteria 3314
281 Ga0496112_0383690 3300048915 Bacteria 1346
282 Ga0496113_0134536 3300048916 Bacteria 1942
283 Ga0496113_0223288 3300048916 Bacteria 1501
284 Ga0496114_0021695 3300048917 Bacteria 5226
285 Ga0496115_0010597 3300048918 Bacteria 6894
286 Ga0496115_0100881 3300048918 Bacteria 2366
287 Ga0501031_0156103 3300049568 Unclassified 1491
288 Ga0501038_0110038 3300049574 Bacteria 2283
289 Ga0501041_0003946 3300049577 Bacteria 8558
290 Ga0501042_0002132 3300049578 Bacteria 12010
291 Ga0501047_0032244 3300049581 Bacteria 5057
292 Ga0501048_0021655 3300049582 Bacteria 4704
293 Ga0501067_0001730 3300049583 Bacteria 12002
294 Ga0501067_0020415 3300049583 Bacteria 3667
295 Ga0501069_0001302 3300049585 Bacteria 12240
296 Ga0501069_0283471 3300049585 Bacteria 970
297 Ga0501070_0000187 3300049586 Bacteria 58257
298 Ga0501070_0072051 3300049586 Bacteria 2860
299 Ga0501070_0188559 3300049586 Bacteria 1695
300 Ga0501071_0047583 3300049587 Unclassified 3081
301 Ga0501072_0041882 3300049588 Bacteria 3597
302 Ga0501074_0089258 3300049590 Bacteria 2207
303 Ga0501075_0400390 3300049591 Unclassified 1046
304 Ga0501079_0035921 3300049741 Unclassified 3816
305 Ga0501080_0255729 3300049742 Bacteria 1597
306 Ga0501080_0408196 3300049742 Unclassified 1221
307 Ga0501035_0222279 3300049822 Unclassified 1612
308 Ga0501045_0148671 3300049824 Bacteria 1743
309 nmdc:mga08y16_31871_c1 3300050511 Bacteria 5542
310 nmdc:mga0a205_23254_c1 3300050515 Bacteria 5659
311 nmdc:mga0a205_61845_c1 3300050515 Bacteria 3617
312 Ga0495601_0000400 3300053077 Bacteria 22948
313 Ga0495601_0034810 3300053077 Bacteria 3142
314 Ga0495601_0043721 3300053077 Bacteria 2813
315 Ga0495612_0016063 3300053078 Bacteria 2999
316 Ga0495595_0040954 3300053084 Bacteria 2118
317 Ga0495619_0000454 3300053085 Bacteria 27700
318 Ga0495619_0017914 3300053085 Bacteria 4489
319 Ga0495619_0123493 3300053085 Unclassified 1776
320 Ga0495619_0362265 3300053085 Unclassified 1002
321 Ga0501084_0030054 3300054114 Unclassified 4545
322 Ga0501082_0037540 3300060353 Unclassified 4176
323 Ga0466962_0000598 3300061719 Bacteria 15926
324 Ga0466962_0015672 3300061719 Bacteria 3654
325 Ga0530510_0027904 3300061734 Bacteria 4046
326 Ga0530510_0192143 3300061734 Bacteria 1515
327 Ga0207657_10039459
328 rootH1_10033596
329 Ga0070683_100134254
330 Ga0068869_100048664
331 Ga0070682_100164081
332 Ga0070682_100205561
333 Ga0070660_100001270
334 Ga0070660_100162814
335 Ga0070660_100285173
336 Ga0070661_100012084
337 Ga0070661_100176625
338 Ga0070675_100237803
339 Ga0070671_100128596
340 Ga0070671_100230773
341 Ga0070674_100266099
342 Ga0070709_10068220
343 Ga0070709_10174648
344 Ga0070713_100384265
345 Ga0070710_10249350
346 Ga0070711_100000341
347 Ga0070678_100178516
348 Ga0070681_10000752
349 Ga0070681_10282172
350 Ga0068867_100074557
351 Ga0070698_100022476
352 Ga0070679_100071755
353 Ga0070679_100089122
354 Ga0070679_100215094
355 Ga0068853_100173014
356 Ga0070665_100090473
357 Ga0068855_100022559
358 Ga0068855_100063551
359 Ga0068855_100067800
360 Ga0068855_100337202
361 Ga0068857_100071236
362 Ga0068857_100187268
363 Ga0068854_100508981
364 Ga0068856_100025658
365 Ga0068852_100067985
366 Ga0068866_10034965
367 Ga0068866_10143358
368 Ga0081455_10044729
369 Ga0070717_10001661
370 Ga0075432_10004801
371 Ga0070712_100005578
372 Ga0070712_100020446
373 Ga0070712_100036799
374 Ga0068871_100425160
375 Ga0075428_100408039
376 Ga0075433_10052695
377 Ga0075436_100015350
378 Ga0075436_100042366
379 Ga0075435_100024952
380 Ga0105240_10223689
381 Ga0111539_10012304
382 Ga0111539_10747396
383 Ga0105245_10039318
384 Ga0105245_10045592
385 Ga0105245_10367798
386 Ga0105247_10044176
387 Ga0105242_10012764
388 Ga0105237_10079980
389 Ga0105238_10008930
390 Ga0105238_10074948
391 Ga0105238_10572422
392 Ga0157370_10040724
393 Ga0157374_10182977
394 Ga0157372_10073346
395 Ga0157372_10504021
396 Ga0182008_10061673
397 Ga0157379_10533771
398 Ga0197907_10614961
399 Ga0206354_10337584
400 Ga0206354_11199835
401 Ga0206353_11851681
402 Ga0224712_10156946
403 Ga0207692_10190307
404 Ga0207705_10106116
405 Ga0207705_10134984
406 Ga0207707_10005535
407 Ga0207707_10029462
408 Ga0207707_10102199
409 Ga0207695_10188941
410 Ga0207693_10002081
411 Ga0207693_10084879
412 Ga0207693_10218046
413 Ga0207663_10021886
414 Ga0207660_10067607
415 Ga0207660_10146918
416 Ga0207657_10000651
417 Ga0207657_10000941
418 Ga0207649_10055725
419 Ga0207652_10078115
420 Ga0207694_10073178
421 Ga0207694_10301263
422 Ga0207659_10193982
423 Ga0207664_10053637
424 Ga0207644_10070240
425 Ga0207686_10049821
426 Ga0207709_10035839
427 Ga0207665_10000060
428 Ga0207665_10183980
429 Ga0207661_10023632
430 Ga0207667_10178754
431 Ga0207639_10038965
432 Ga0207639_10042864
433 Ga0207674_10292870
434 Ga0207683_10206689
435 Ga0207698_10410035
436 Ga0207428_10007861
437 Ga0265319_1027790
438 Ga0265318_10008313
439 Ga0265338_10078363
440 Ga0265338_10281214
441 Ga0265332_10012919
442 Ga0265328_10002677
443 Ga0265325_10001119
444 Ga0265329_10024137
445 Ga0265340_10051754
446 Ga0265327_10009733
447 Ga0265327_10057064
448 Ga0265313_10063482
449 Ga0265342_10087533
450 Ga0307411_10380297
451 Ga0373926_0092265
452 Ga0373953_0076615
453 Ga0373927_0159768
454 Ga0373933_0133417
455 Ga0373937_0000494
456 Ga0373937_0114468
457 Ga0373937_0127519
458 Ga0395899_0021226
459 Ga0395900_0007485
460 Ga0395900_0237546
461 Ga0395900_0241033
462 Ga0395900_0310160
463 Ga0395900_0420040
464 Ga0395898_0001584
465 Ga0395898_0216304
466 Ga0395898_0236426
467 Ga0395898_0499432
468 Ga0395905_0087035
469 Ga0395905_0163896
470 Ga0395905_0235772
471 Ga0395901_0001414
472 Ga0395901_0059084
473 Ga0395901_0099202
474 Ga0451807_1075421
475 Ga0451835_0535582
476 Ga0451839_0782197
477 Ga0451849_0829885
478 Ga0451855_0171249
479 Ga0439446_0000667
480 Ga0439434_0002292
481 Ga0466965_0007732
482 Ga0466966_0014862
483 Ga0466966_0052451
484 Ga0466966_0096112
485 Ga0466966_0113821
486 Ga0466966_0115709
487 Ga0466966_0126966
488 Ga0466961_0004049
489 Ga0466961_0011374
490 Ga0466961_0075801
491 Ga0466961_0099940
492 Ga0466963_0000686
493 Ga0466963_0003398
494 Ga0466963_0012968
495 Ga0466963_0015662
496 Ga0466963_0027991
497 Ga0466963_0036275
498 Ga0466963_0046820
499 Ga0466963_0047997
500 Ga0466963_0048030
501 Ga0466963_0058417
502 Ga0466963_0146710
503 Ga0466963_0188907
504 Ga0466964_0007188
505 Ga0466964_0014952
506 Ga0466964_0116078
507 Ga0466971_0004642
508 Ga0466971_0007945
509 Ga0466968_0025554
510 Ga0466970_0001717
511 Ga0466970_0055411
512 Ga0466970_0085727
513 Ga0466957_0001760
514 Ga0466957_0009837
515 Ga0466957_0015472
516 Ga0466957_0016220
517 Ga0466957_0052228
518 Ga0466957_0254072
519 Ga0466957_0404813
520 Ga0466960_0198977
521 Ga0466959_0001127
522 Ga0466959_0020641
523 Ga0466959_0041244
524 Ga0466959_0047468
525 Ga0466958_0003210
526 Ga0466958_0006409
527 Ga0466958_0026201
528 Ga0466958_0027760
529 Ga0466958_0033578
530 Ga0466967_0000367
531 Ga0466967_0007395
532 Ga0466967_0009473
533 Ga0466967_0010182
534 Ga0466967_0010856
535 Ga0466967_0017320
536 Ga0466967_0018787
537 Ga0466967_0033765
538 Ga0466967_0051582
539 Ga0466967_0071080
540 Ga0466967_0091361
541 Ga0466967_0111743
542 Ga0466967_0130152
543 Ga0466967_0197644
544 Ga0495592_0000123
545 Ga0495651_0000008
546 Ga0495653_0006797
547 Ga0495653_0190266
548 Ga0495580_0047205
549 Ga0495664_0214840
550 Ga0495608_0001396
551 Ga0495608_0019502
552 Ga0495608_0207250
553 Ga0495618_0002333
554 Ga0495618_0016885
555 Ga0495628_0000016
556 Ga0495628_0061669
557 Ga0495628_0063746
558 Ga0495630_0020192
559 Ga0495630_0023711
560 Ga0495652_0000045
561 Ga0495640_0045469
562 Ga0495640_0053581
563 Ga0495640_0097008
564 Ga0495640_0194517
565 Ga0495587_0000275
566 Ga0495645_0000068
567 Ga0495645_0077158
568 Ga0495645_0209395
569 Ga0495667_0087052
570 Ga0495634_0069879
571 Ga0495635_0039290
572 Ga0495657_0005214
573 Ga0495657_0045768
574 Ga0495599_0000271
575 Ga0495599_0029027
576 Ga0495623_0001174
577 Ga0495646_0000588
578 Ga0495647_0028733
579 Ga0495600_0032676
580 Ga0495604_0000072
581 Ga0495604_0056469
582 Ga0495604_0197646
583 Ga0495674_0004634
584 Ga0495674_0030291
585 Ga0495674_0076209
586 Ga0495674_0117722
587 Ga0495674_0161564
588 Ga0495680_0005913
589 Ga0495675_0000269
590 Ga0495675_0189129
591 Ga0495602_0001060
592 Ga0495614_0125881
593 Ga0496100_0133147
594 Ga0496101_0001655
595 Ga0496102_0036355
596 Ga0496102_0315568
597 Ga0496104_0192166
598 Ga0496105_0057777
599 Ga0496105_0185900
600 Ga0496106_0023106
601 Ga0496107_0016196
602 Ga0496108_0107065
603 Ga0496110_0148689
604 Ga0496111_0086575
605 Ga0496111_0389974
606 Ga0496112_0076316
607 Ga0496112_0383690
608 Ga0496113_0134536
609 Ga0496113_0223288
610 Ga0496114_0021695
611 Ga0496115_0010597
612 Ga0496115_0100881
613 Ga0501031_0156103
614 Ga0501038_0110038
615 Ga0501041_0003946
616 Ga0501042_0002132
617 Ga0501047_0032244
618 Ga0501048_0021655
619 Ga0501067_0001730
620 Ga0501067_0020415
621 Ga0501069_0001302
622 Ga0501069_0283471
623 Ga0501070_0000187
624 Ga0501070_0072051
625 Ga0501070_0188559
626 Ga0501071_0047583
627 Ga0501072_0041882
628 Ga0501074_0089258
629 Ga0501075_0400390
630 Ga0501079_0035921
631 Ga0501080_0255729
632 Ga0501080_0408196
633 Ga0501035_0222279
634 Ga0501045_0148671
635 nmdc:mga08y16_31871_c1
636 nmdc:mga0a205_23254_c1
637 nmdc:mga0a205_61845_c1
638 Ga0495601_0000400
639 Ga0495601_0034810
640 Ga0495601_0043721
641 Ga0495612_0016063
642 Ga0495595_0040954
643 Ga0495619_0000454
644 Ga0495619_0017914
645 Ga0495619_0123493
646 Ga0495619_0362265
647 Ga0501084_0030054
648 Ga0501082_0037540
649 Ga0466962_0000598
650 Ga0466962_0015672
651 Ga0530510_0027904
652 Ga0530510_0192143

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

206

289

0.86

PF07883

Cupin_2

Cupin domain

55

124

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3l2h-assembly1.cif.gz_D crystal structure of putative sugar phosphate isomerase (afe_0303) from acidithiobacillus ferrooxidans atcc 23270 at 1.85 a resolution 0.9146 7 125
5fpx-assembly1.cif.gz_A the structure of kdgf from yersinia enterocolitica. 0.904 165 274
5fpz-assembly1.cif.gz_A-2 the structure of kdgf from yersinia enterocolitica with malonate bound in the active site. 0.8952 164 275
2pfw-assembly1.cif.gz_B crystal structure of a rmlc-like cupin (sfri_3105) from shewanella frigidimarina ncimb 400 at 1.90 a resolution 0.8783 162 275
7zyb-assembly1.cif.gz_A bekdgf with ca 0.8703 164 275
ID Description Score Start End Superfamily
5fpxA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.904 165 274 2.60.120.10
3l2hD01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9021 10 125 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8646 171 274 2.60.120.10
af_F1LVA4_327_469_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8567 186 274 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8561 171 274 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A534XSA4-F1-model_v4 Cupin domain-containing protein 0.9712 4 127
AF-A0A7V9IG87-F1-model_v4 Cupin domain-containing protein 0.9642 177 311
AF-A0A1E5XV51-F1-model_v4 Cupin type-2 domain-containing protein 0.9626 4 127
AF-A0A523J718-F1-model_v4 Cupin domain-containing protein 0.9622 4 127
AF-A0A7C1U969-F1-model_v4 Cupin domain-containing protein 0.9596 4 127

Map