F408384

General Info

Members Datasets Scaffolds Average Seq Length
326 180 652 260

Family's Representative Sequence

Representative Sequence 3300031235|Ga0265330_10036015|Ga0265330_100360152
Length 294
Sequence MAFALDLDGKVALVTGGSRGIGAETVRLLRAAGARVAFSYRKARAQADALVAECGGTGAAAEPLCVAIEQELCTPADGHRLVEGAVAAMGRLDILVANHGVWESEDVSIADMDEAQWRHTIAVNLDAVFGLVQAAVGQFERQGFSGQPTSDGVDTTSTAPQETGGTTSGGAGLGGVRGHIVLISSTAGQRGEAYHADYAVTKGALISLTKSLSTELAPKGIMVNCVAPGWVATDMTAATLADPATGEKISAAIPMGRVATAREIAGPIVFLCTPLAGFISGEVLNVNGGAVLVG

Samples

Sample ID Description Type Environment
1 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
125 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
126 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
127 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
140 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
143 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
144 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
145 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
150 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
153 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
167 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
171 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
176 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
177 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
178 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
180 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0.31
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 3.37
Rhizosphere 95.09
Stem 0
Stem Tuber 0
Unclassified 16.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265330_10036015 3300031235 Unclassified 2207
2 JGI24740J21852_10019626 3300001979 Bacteria 2376
3 rootH2_10052952 3300003320 Bacteria 4834
4 rootH2_10069609 3300003320 Bacteria 4329
5 rootH2_10204137 3300003320 Bacteria 1779
6 Ga0065715_10035240 3300005293 Bacteria 1742
7 Ga0070658_10021457 3300005327 Bacteria 5176
8 Ga0070683_100001021 3300005329 Bacteria 21002
9 Ga0070683_100122652 3300005329 Bacteria 2455
10 Ga0070683_100439691 3300005329 Unclassified 1244
11 Ga0070690_100008325 3300005330 Bacteria 5968
12 Ga0070670_100023666 3300005331 Bacteria 5286
13 Ga0068869_100010341 3300005334 Bacteria 6084
14 Ga0068868_100001328 3300005338 Bacteria 17048
15 Ga0068868_100137829 3300005338 Unclassified 2001
16 Ga0070660_100277842 3300005339 Bacteria 1370
17 Ga0070687_100321768 3300005343 Bacteria 988
18 Ga0070661_100049335 3300005344 Bacteria 3081
19 Ga0070661_100084323 3300005344 Bacteria 2348
20 Ga0070661_100093784 3300005344 Unclassified 2224
21 Ga0070668_100048887 3300005347 Bacteria 3254
22 Ga0070675_100254879 3300005354 Bacteria 1536
23 Ga0070671_100004759 3300005355 Bacteria 10787
24 Ga0070671_100142627 3300005355 Bacteria 2022
25 Ga0070673_100075521 3300005364 Bacteria 2718
26 Ga0070667_100000800 3300005367 Bacteria 29453
27 Ga0070703_10000665 3300005406 Bacteria 11940
28 Ga0070709_10000126 3300005434 Bacteria 50475
29 Ga0070709_10087376 3300005434 Unclassified 2048
30 Ga0070714_100005104 3300005435 Bacteria 9985
31 Ga0070713_100006056 3300005436 Bacteria 8334
32 Ga0070713_100235414 3300005436 Unclassified 1666
33 Ga0070710_10155172 3300005437 Unclassified 1415
34 Ga0070701_10072332 3300005438 Unclassified 1847
35 Ga0070711_100000005 3300005439 Bacteria 187807
36 Ga0070705_100000005 3300005440 Bacteria 120556
37 Ga0070705_100085038 3300005440 Bacteria 1954
38 Ga0070705_100319864 3300005440 Unclassified 1120
39 Ga0070708_100069460 3300005445 Bacteria 3168
40 Ga0070706_100000140 3300005467 Bacteria 91590
41 Ga0070706_100173708 3300005467 Unclassified 2012
42 Ga0070699_100000059 3300005518 Bacteria 105638
43 Ga0070684_100001524 3300005535 Bacteria 16745
44 Ga0070684_100026659 3300005535 Bacteria 4870
45 Ga0070684_100056130 3300005535 Bacteria 3436
46 Ga0070684_100128681 3300005535 Unclassified 2283
47 Ga0070697_100000425 3300005536 Bacteria 32401
48 Ga0068853_100000459 3300005539 Bacteria 27826
49 Ga0070695_100015128 3300005545 Bacteria 4657
50 Ga0070696_100000371 3300005546 Bacteria 27424
51 Ga0070665_100024467 3300005548 Bacteria 6082
52 Ga0070665_100035234 3300005548 Bacteria 5033
53 Ga0070665_100703136 3300005548 Bacteria 1024
54 Ga0070704_100047269 3300005549 Unclassified 3007
55 Ga0070704_100101916 3300005549 Unclassified 2165
56 Ga0068855_100005638 3300005563 Bacteria 15277
57 Ga0068855_100007635 3300005563 Bacteria 13081
58 Ga0068855_100008401 3300005563 Bacteria 12485
59 Ga0068855_100156233 3300005563 Bacteria 2591
60 Ga0070664_100041302 3300005564 Bacteria 3892
61 Ga0068857_100000342 3300005577 Bacteria 32171
62 Ga0068857_100004532 3300005577 Bacteria 11749
63 Ga0068857_100207619 3300005577 Unclassified 1787
64 Ga0068857_100329764 3300005577 Bacteria 1410
65 Ga0068854_100009264 3300005578 Bacteria 6353
66 Ga0068854_100257236 3300005578 Bacteria 1397
67 Ga0068856_100003675 3300005614 Bacteria 15388
68 Ga0068856_100004971 3300005614 Bacteria 13162
69 Ga0068856_100005208 3300005614 Bacteria 12838
70 Ga0068856_100014690 3300005614 Bacteria 7557
71 Ga0068856_100041588 3300005614 Bacteria 4518
72 Ga0068856_100548039 3300005614 Bacteria 1178
73 Ga0068852_100000279 3300005616 Bacteria 34158
74 Ga0068852_100071264 3300005616 Bacteria 3051
75 Ga0068852_100232356 3300005616 Unclassified 1758
76 Ga0068852_100539416 3300005616 Bacteria 1166
77 Ga0068859_100038991 3300005617 Unclassified 4765
78 Ga0068859_100240922 3300005617 Unclassified 1898
79 Ga0068851_10002265 3300005834 Bacteria 8448
80 Ga0068851_10068746 3300005834 Unclassified 1829
81 Ga0068858_100024791 3300005842 Bacteria 5586
82 Ga0068858_100145517 3300005842 Bacteria 2225
83 Ga0068860_100006371 3300005843 Bacteria 11846
84 Ga0070716_100091242 3300006173 Bacteria 1844
85 Ga0070716_100420831 3300006173 Unclassified 966
86 Ga0097621_100001491 3300006237 Bacteria 16046
87 Ga0068871_100064844 3300006358 Bacteria 2991
88 Ga0075428_100004568 3300006844 Bacteria 15308
89 Ga0075428_100283782 3300006844 Bacteria 1781
90 Ga0075433_10230143 3300006852 Unclassified 1646
91 Ga0075434_100131176 3300006871 Unclassified 2525
92 Ga0068865_100113057 3300006881 Bacteria 2006
93 Ga0075436_100000601 3300006914 Bacteria 23595
94 Ga0075436_100299441 3300006914 Bacteria 1152
95 Ga0097620_100038991 3300006931 Unclassified 4765
96 Ga0097620_100240940 3300006931 Unclassified 1898
97 Ga0075435_100095847 3300007076 Bacteria 2454
98 Ga0075435_100167828 3300007076 Bacteria 1851
99 Ga0105240_10000455 3300009093 Bacteria 75347
100 Ga0105240_10000897 3300009093 Bacteria 53086
101 Ga0105240_10006920 3300009093 Bacteria 16566
102 Ga0105240_10008023 3300009093 Bacteria 15199
103 Ga0105240_10011558 3300009093 Bacteria 12284
104 Ga0105240_10012011 3300009093 Bacteria 12004
105 Ga0105240_10016947 3300009093 Bacteria 9846
106 Ga0111539_10596144 3300009094 Bacteria 1287
107 Ga0105245_10002457 3300009098 Bacteria 16755
108 Ga0105245_10082220 3300009098 Bacteria 2946
109 Ga0105247_10061999 3300009101 Unclassified 2319
110 Ga0114129_10005795 3300009147 Bacteria 17494
111 Ga0114129_10006460 3300009147 Bacteria 16625
112 Ga0114129_10095294 3300009147 Bacteria 4122
113 Ga0105243_10298989 3300009148 Unclassified 1458
114 Ga0105241_10000033 3300009174 Bacteria 118315
115 Ga0105241_10000162 3300009174 Bacteria 48662
116 Ga0105241_10002556 3300009174 Bacteria 13663
117 Ga0105241_10081851 3300009174 Bacteria 2530
118 Ga0105241_10370496 3300009174 Unclassified 1249
119 Ga0105248_10002740 3300009177 Bacteria 19565
120 Ga0105248_10490331 3300009177 Bacteria 1385
121 Ga0105237_10375672 3300009545 Bacteria 1426
122 Ga0105237_10400444 3300009545 Bacteria 1377
123 Ga0105238_10000390 3300009551 Bacteria 46780
124 Ga0105238_10004827 3300009551 Bacteria 13339
125 Ga0105238_10212362 3300009551 Bacteria 1911
126 Ga0105238_10572531 3300009551 Bacteria 1135
127 Ga0105239_10000774 3300010375 Bacteria 45307
128 Ga0105239_10001644 3300010375 Bacteria 29466
129 Ga0105239_10023671 3300010375 Bacteria 6761
130 Ga0105239_10095173 3300010375 Bacteria 3290
131 Ga0105239_10160653 3300010375 Bacteria 2510
132 Ga0105239_10570222 3300010375 Bacteria 1290
133 Ga0157373_10087275 3300013100 Unclassified 2198
134 Ga0157373_10107943 3300013100 Bacteria 1957
135 Ga0157370_10000003 3300013104 Bacteria 367417
136 Ga0157369_10000245 3300013105 Bacteria 75320
137 Ga0157369_10002731 3300013105 Bacteria 21071
138 Ga0157369_10004263 3300013105 Bacteria 16906
139 Ga0157369_10012628 3300013105 Bacteria 9577
140 Ga0157369_10057041 3300013105 Bacteria 4214
141 Ga0157369_10173238 3300013105 Bacteria 2273
142 Ga0157369_10179142 3300013105 Bacteria 2230
143 Ga0157374_10010998 3300013296 Bacteria 7815
144 Ga0157374_10043713 3300013296 Bacteria 4140
145 Ga0157374_10044368 3300013296 Bacteria 4110
146 Ga0157374_10135937 3300013296 Unclassified 2383
147 Ga0157374_10490941 3300013296 Bacteria 1232
148 Ga0157378_10002748 3300013297 Bacteria 15679
149 Ga0157378_10060057 3300013297 Bacteria 3393
150 Ga0157378_10459935 3300013297 Unclassified 1264
151 Ga0157378_10772320 3300013297 Unclassified 985
152 Ga0163162_10211906 3300013306 Bacteria 2067
153 Ga0157372_10000427 3300013307 Bacteria 46281
154 Ga0157372_10001123 3300013307 Bacteria 29091
155 Ga0157372_10017165 3300013307 Bacteria 7771
156 Ga0157372_10039143 3300013307 Bacteria 5234
157 Ga0157372_10306696 3300013307 Bacteria 1847
158 Ga0157372_10450100 3300013307 Bacteria 1501
159 Ga0157375_10065525 3300013308 Bacteria 3622
160 Ga0163163_10034980 3300014325 Bacteria 4870
161 Ga0157379_10004893 3300014968 Bacteria 11501
162 Ga0157379_10106560 3300014968 Unclassified 2516
163 Ga0157376_10005455 3300014969 Bacteria 8890
164 Ga0157376_10059355 3300014969 Bacteria 3207
165 Ga0157376_10954595 3300014969 Bacteria 878
166 Ga0163161_10051461 3300017792 Bacteria 2983
167 Ga0207656_10012256 3300025321 Bacteria 3256
168 Ga0207656_10086596 3300025321 Unclassified 1416
169 Ga0207653_10000069 3300025885 Bacteria 78587
170 Ga0207692_10378973 3300025898 Bacteria 878
171 Ga0207710_10007225 3300025900 Bacteria 4708
172 Ga0207688_10047988 3300025901 Bacteria 2385
173 Ga0207647_10017783 3300025904 Bacteria 4824
174 Ga0207699_10000003 3300025906 Bacteria 577076
175 Ga0207645_10005440 3300025907 Bacteria 9229
176 Ga0207705_10029991 3300025909 Bacteria 3880
177 Ga0207684_10000291 3300025910 Bacteria 71993
178 Ga0207654_10000172 3300025911 Bacteria 40572
179 Ga0207654_10001855 3300025911 Bacteria 10935
180 Ga0207654_10002979 3300025911 Bacteria 8589
181 Ga0207654_10122610 3300025911 Bacteria 1634
182 Ga0207695_10000119 3300025913 Bacteria 235221
183 Ga0207695_10000129 3300025913 Bacteria 225939
184 Ga0207695_10000598 3300025913 Bacteria 72240
185 Ga0207695_10029660 3300025913 Bacteria 6038
186 Ga0207695_10034426 3300025913 Bacteria 5509
187 Ga0207695_10036881 3300025913 Bacteria 5279
188 Ga0207671_10000047 3300025914 Bacteria 196307
189 Ga0207671_10250375 3300025914 Bacteria 1393
190 Ga0207671_10322813 3300025914 Bacteria 1222
191 Ga0207671_10453782 3300025914 Bacteria 1021
192 Ga0207663_10000011 3300025916 Bacteria 172453
193 Ga0207663_10221056 3300025916 Bacteria 1378
194 Ga0207694_10000089 3300025924 Bacteria 103520
195 Ga0207694_10000198 3300025924 Bacteria 60251
196 Ga0207694_10001800 3300025924 Bacteria 17856
197 Ga0207694_10248624 3300025924 Unclassified 1455
198 Ga0207694_10422125 3300025924 Bacteria 1111
199 Ga0207650_10080214 3300025925 Unclassified 2474
200 Ga0207687_10389502 3300025927 Bacteria 1144
201 Ga0207700_10026513 3300025928 Bacteria 4042
202 Ga0207700_10092825 3300025928 Unclassified 2387
203 Ga0207664_10011016 3300025929 Bacteria 6405
204 Ga0207664_10101678 3300025929 Bacteria 2376
205 Ga0207644_10124315 3300025931 Bacteria 1967
206 Ga0207644_10130972 3300025931 Bacteria 1920
207 Ga0207709_10128749 3300025935 Unclassified 1721
208 Ga0207704_10022155 3300025938 Bacteria 3398
209 Ga0207691_10022755 3300025940 Bacteria 5908
210 Ga0207689_10004438 3300025942 Bacteria 12726
211 Ga0207689_10021443 3300025942 Bacteria 5430
212 Ga0207661_10000111 3300025944 Bacteria 51639
213 Ga0207679_10050013 3300025945 Unclassified 3052
214 Ga0207667_10001612 3300025949 Bacteria 28380
215 Ga0207667_10009053 3300025949 Bacteria 11772
216 Ga0207667_10497166 3300025949 Bacteria 1237
217 Ga0207640_10007384 3300025981 Bacteria 6068
218 Ga0207640_10034916 3300025981 Unclassified 3142
219 Ga0207658_10000076 3300025986 Bacteria 108585
220 Ga0207658_10070326 3300025986 Bacteria 2647
221 Ga0207677_10000266 3300026023 Bacteria 39403
222 Ga0207639_10000674 3300026041 Bacteria 23583
223 Ga0207639_10388887 3300026041 Unclassified 1254
224 Ga0207678_10024485 3300026067 Bacteria 5272
225 Ga0207702_10004827 3300026078 Bacteria 11876
226 Ga0207702_10025965 3300026078 Bacteria 4863
227 Ga0207702_10035192 3300026078 Unclassified 4187
228 Ga0207702_10176754 3300026078 Unclassified 1962
229 Ga0207641_10002110 3300026088 Bacteria 18798
230 Ga0207641_10227753 3300026088 Bacteria 1731
231 Ga0207674_10008090 3300026116 Bacteria 12190
232 Ga0207674_10011741 3300026116 Bacteria 9828
233 Ga0207674_10143168 3300026116 Unclassified 2350
234 Ga0207674_10818663 3300026116 Bacteria 898
235 Ga0207683_10004009 3300026121 Bacteria 12743
236 Ga0207698_10000027 3300026142 Bacteria 119295
237 Ga0207698_10001695 3300026142 Bacteria 12844
238 Ga0207698_10002999 3300026142 Bacteria 10131
239 Ga0207698_10070691 3300026142 Bacteria 2766
240 Ga0207698_10167011 3300026142 Bacteria 1933
241 Ga0207428_10132331 3300027907 Bacteria 1908
242 Ga0268266_10001414 3300028379 Bacteria 28640
243 Ga0268266_10007001 3300028379 Bacteria 10244
244 Ga0268266_10024300 3300028379 Bacteria 5155
245 Ga0268265_10853186 3300028380 Bacteria 891
246 Ga0268264_10000442 3300028381 Bacteria 56945
247 Ga0265318_10036928 3300028577 Bacteria 1873
248 Ga0265338_10003509 3300028800 Bacteria 21990
249 Ga0265338_10321350 3300028800 Unclassified 1120
250 Ga0265770_1007183 3300030878 Bacteria 1561
251 Ga0265330_10055331 3300031235 Bacteria 1733
252 Ga0265328_10012212 3300031239 Bacteria 3420
253 Ga0265325_10020227 3300031241 Bacteria 3670
254 Ga0265325_10023193 3300031241 Bacteria 3392
255 Ga0265340_10170170 3300031247 Unclassified 987
256 Ga0265339_10000026 3300031249 Bacteria 165764
257 Ga0265339_10030611 3300031249 Bacteria 3047
258 Ga0307408_100206305 3300031548 Bacteria 1594
259 Ga0265313_10013760 3300031595 Bacteria 4826
260 Ga0265313_10013890 3300031595 Unclassified 4797
261 Ga0265313_10028424 3300031595 Bacteria 2906
262 Ga0265314_10102557 3300031711 Bacteria 1836
263 Ga0265342_10001312 3300031712 Bacteria 23334
264 Ga0265342_10019034 3300031712 Bacteria 4432
265 Ga0307416_100119134 3300032002 Bacteria 2347
266 Ga0373931_0134017 3300035691 Bacteria 1429
267 Ga0373937_0005347 3300036401 Bacteria 10980
268 Ga0373937_0718728 3300036401 Bacteria 946
269 Ga0453683_0117596 3300044673 Bacteria 1673
270 Ga0453683_0266601 3300044673 Bacteria 1093
271 Ga0466963_0029100 3300044694 Bacteria 3553
272 Ga0466967_0218576 3300045976 Unclassified 1810
273 Ga0466967_0918733 3300045976 Bacteria 871
274 Ga0495629_0055374 3300046459 Bacteria 2773
275 Ga0495629_0236773 3300046459 Bacteria 1257
276 Ga0495641_0035522 3300046461 Unclassified 2348
277 Ga0495580_0164484 3300046472 Bacteria 1535
278 Ga0495664_0048358 3300046477 Bacteria 2525
279 Ga0495585_0095850 3300046492 Bacteria 1593
280 Ga0495665_0181310 3300046531 Bacteria 1094
281 Ga0495586_0027473 3300046535 Unclassified 3045
282 Ga0495587_0070101 3300046536 Bacteria 2041
283 Ga0495587_0119031 3300046536 Bacteria 1513
284 Ga0495645_0009864 3300046543 Bacteria 6684
285 Ga0495625_0000046 3300046660 Bacteria 202299
286 Ga0495625_0254130 3300046660 Bacteria 1140
287 Ga0495635_0141765 3300046663 Bacteria 1637
288 Ga0495657_0083771 3300046675 Bacteria 2058
289 Ga0495669_0011639 3300046684 Bacteria 3740
290 Ga0495613_0195470 3300046689 Bacteria 1428
291 Ga0495600_0129657 3300046809 Unclassified 1640
292 Ga0495600_0307556 3300046809 Unclassified 999
293 Ga0495581_0247542 3300047315 Bacteria 1042
294 Ga0495604_0088864 3300047317 Bacteria 2298
295 Ga0495674_0181643 3300047319 Bacteria 1752
296 Ga0495675_0007752 3300047444 Bacteria 6624
297 Ga0495602_0082498 3300048088 Unclassified 2698
298 Ga0496100_0498483 3300048903 Unclassified 938
299 Ga0496101_0462592 3300048904 Bacteria 1001
300 Ga0496102_0127084 3300048905 Unclassified 2383
301 Ga0496102_0453526 3300048905 Unclassified 1203
302 Ga0496104_0441730 3300048907 Unclassified 1213
303 Ga0496105_0101570 3300048908 Bacteria 2375
304 Ga0496112_0438175 3300048915 Bacteria 1245
305 Ga0496114_0059588 3300048917 Bacteria 3189
306 Ga0496115_0148163 3300048918 Bacteria 1937
307 Ga0496115_0197809 3300048918 Bacteria 1661
308 Ga0496115_0219890 3300048918 Bacteria 1567
309 Ga0496126_0068441 3300048929 Bacteria 3170
310 Ga0501039_0192503 3300049575 Bacteria 1604
311 Ga0501042_0369879 3300049578 Bacteria 1037
312 Ga0501048_0132661 3300049582 Bacteria 1760
313 Ga0501076_0097654 3300049592 Bacteria 2366
314 Ga0501077_0168432 3300049593 Bacteria 1392
315 nmdc:mga05p37_121_c1 3300050507 Bacteria 70179
316 nmdc:mga05p37_296119_c1 3300050507 Bacteria 1924
317 nmdc:mga08y16_177355_c1 3300050511 Bacteria 2213
318 nmdc:mga0n895_688248_c1 3300050512 Bacteria 1019
319 nmdc:mga0n895_742564_c1 3300050512 Bacteria 975
320 nmdc:mga0rr50_151824_c1 3300050513 Bacteria 1872
321 nmdc:mga0rr50_83411_c1 3300050513 Bacteria 2471
322 nmdc:mga08x19_2_c1 3300050514 Bacteria 741277
323 nmdc:mga0a205_354667_c1 3300050515 Bacteria 1334
324 Ga0500595_042544 3300053119 Bacteria 1452
325 Ga0501082_0585394 3300060353 Bacteria 976
326 2884218239 2884215851 Bacteria 4554841
327 Ga0265330_10036015
328 JGI24740J21852_10019626
329 rootH2_10052952
330 rootH2_10069609
331 rootH2_10204137
332 Ga0065715_10035240
333 Ga0070658_10021457
334 Ga0070683_100001021
335 Ga0070683_100122652
336 Ga0070683_100439691
337 Ga0070690_100008325
338 Ga0070670_100023666
339 Ga0068869_100010341
340 Ga0068868_100001328
341 Ga0068868_100137829
342 Ga0070660_100277842
343 Ga0070687_100321768
344 Ga0070661_100049335
345 Ga0070661_100084323
346 Ga0070661_100093784
347 Ga0070668_100048887
348 Ga0070675_100254879
349 Ga0070671_100004759
350 Ga0070671_100142627
351 Ga0070673_100075521
352 Ga0070667_100000800
353 Ga0070703_10000665
354 Ga0070709_10000126
355 Ga0070709_10087376
356 Ga0070714_100005104
357 Ga0070713_100006056
358 Ga0070713_100235414
359 Ga0070710_10155172
360 Ga0070701_10072332
361 Ga0070711_100000005
362 Ga0070705_100000005
363 Ga0070705_100085038
364 Ga0070705_100319864
365 Ga0070708_100069460
366 Ga0070706_100000140
367 Ga0070706_100173708
368 Ga0070699_100000059
369 Ga0070684_100001524
370 Ga0070684_100026659
371 Ga0070684_100056130
372 Ga0070684_100128681
373 Ga0070697_100000425
374 Ga0068853_100000459
375 Ga0070695_100015128
376 Ga0070696_100000371
377 Ga0070665_100024467
378 Ga0070665_100035234
379 Ga0070665_100703136
380 Ga0070704_100047269
381 Ga0070704_100101916
382 Ga0068855_100005638
383 Ga0068855_100007635
384 Ga0068855_100008401
385 Ga0068855_100156233
386 Ga0070664_100041302
387 Ga0068857_100000342
388 Ga0068857_100004532
389 Ga0068857_100207619
390 Ga0068857_100329764
391 Ga0068854_100009264
392 Ga0068854_100257236
393 Ga0068856_100003675
394 Ga0068856_100004971
395 Ga0068856_100005208
396 Ga0068856_100014690
397 Ga0068856_100041588
398 Ga0068856_100548039
399 Ga0068852_100000279
400 Ga0068852_100071264
401 Ga0068852_100232356
402 Ga0068852_100539416
403 Ga0068859_100038991
404 Ga0068859_100240922
405 Ga0068851_10002265
406 Ga0068851_10068746
407 Ga0068858_100024791
408 Ga0068858_100145517
409 Ga0068860_100006371
410 Ga0070716_100091242
411 Ga0070716_100420831
412 Ga0097621_100001491
413 Ga0068871_100064844
414 Ga0075428_100004568
415 Ga0075428_100283782
416 Ga0075433_10230143
417 Ga0075434_100131176
418 Ga0068865_100113057
419 Ga0075436_100000601
420 Ga0075436_100299441
421 Ga0097620_100038991
422 Ga0097620_100240940
423 Ga0075435_100095847
424 Ga0075435_100167828
425 Ga0105240_10000455
426 Ga0105240_10000897
427 Ga0105240_10006920
428 Ga0105240_10008023
429 Ga0105240_10011558
430 Ga0105240_10012011
431 Ga0105240_10016947
432 Ga0111539_10596144
433 Ga0105245_10002457
434 Ga0105245_10082220
435 Ga0105247_10061999
436 Ga0114129_10005795
437 Ga0114129_10006460
438 Ga0114129_10095294
439 Ga0105243_10298989
440 Ga0105241_10000033
441 Ga0105241_10000162
442 Ga0105241_10002556
443 Ga0105241_10081851
444 Ga0105241_10370496
445 Ga0105248_10002740
446 Ga0105248_10490331
447 Ga0105237_10375672
448 Ga0105237_10400444
449 Ga0105238_10000390
450 Ga0105238_10004827
451 Ga0105238_10212362
452 Ga0105238_10572531
453 Ga0105239_10000774
454 Ga0105239_10001644
455 Ga0105239_10023671
456 Ga0105239_10095173
457 Ga0105239_10160653
458 Ga0105239_10570222
459 Ga0157373_10087275
460 Ga0157373_10107943
461 Ga0157370_10000003
462 Ga0157369_10000245
463 Ga0157369_10002731
464 Ga0157369_10004263
465 Ga0157369_10012628
466 Ga0157369_10057041
467 Ga0157369_10173238
468 Ga0157369_10179142
469 Ga0157374_10010998
470 Ga0157374_10043713
471 Ga0157374_10044368
472 Ga0157374_10135937
473 Ga0157374_10490941
474 Ga0157378_10002748
475 Ga0157378_10060057
476 Ga0157378_10459935
477 Ga0157378_10772320
478 Ga0163162_10211906
479 Ga0157372_10000427
480 Ga0157372_10001123
481 Ga0157372_10017165
482 Ga0157372_10039143
483 Ga0157372_10306696
484 Ga0157372_10450100
485 Ga0157375_10065525
486 Ga0163163_10034980
487 Ga0157379_10004893
488 Ga0157379_10106560
489 Ga0157376_10005455
490 Ga0157376_10059355
491 Ga0157376_10954595
492 Ga0163161_10051461
493 Ga0207656_10012256
494 Ga0207656_10086596
495 Ga0207653_10000069
496 Ga0207692_10378973
497 Ga0207710_10007225
498 Ga0207688_10047988
499 Ga0207647_10017783
500 Ga0207699_10000003
501 Ga0207645_10005440
502 Ga0207705_10029991
503 Ga0207684_10000291
504 Ga0207654_10000172
505 Ga0207654_10001855
506 Ga0207654_10002979
507 Ga0207654_10122610
508 Ga0207695_10000119
509 Ga0207695_10000129
510 Ga0207695_10000598
511 Ga0207695_10029660
512 Ga0207695_10034426
513 Ga0207695_10036881
514 Ga0207671_10000047
515 Ga0207671_10250375
516 Ga0207671_10322813
517 Ga0207671_10453782
518 Ga0207663_10000011
519 Ga0207663_10221056
520 Ga0207694_10000089
521 Ga0207694_10000198
522 Ga0207694_10001800
523 Ga0207694_10248624
524 Ga0207694_10422125
525 Ga0207650_10080214
526 Ga0207687_10389502
527 Ga0207700_10026513
528 Ga0207700_10092825
529 Ga0207664_10011016
530 Ga0207664_10101678
531 Ga0207644_10124315
532 Ga0207644_10130972
533 Ga0207709_10128749
534 Ga0207704_10022155
535 Ga0207691_10022755
536 Ga0207689_10004438
537 Ga0207689_10021443
538 Ga0207661_10000111
539 Ga0207679_10050013
540 Ga0207667_10001612
541 Ga0207667_10009053
542 Ga0207667_10497166
543 Ga0207640_10007384
544 Ga0207640_10034916
545 Ga0207658_10000076
546 Ga0207658_10070326
547 Ga0207677_10000266
548 Ga0207639_10000674
549 Ga0207639_10388887
550 Ga0207678_10024485
551 Ga0207702_10004827
552 Ga0207702_10025965
553 Ga0207702_10035192
554 Ga0207702_10176754
555 Ga0207641_10002110
556 Ga0207641_10227753
557 Ga0207674_10008090
558 Ga0207674_10011741
559 Ga0207674_10143168
560 Ga0207674_10818663
561 Ga0207683_10004009
562 Ga0207698_10000027
563 Ga0207698_10001695
564 Ga0207698_10002999
565 Ga0207698_10070691
566 Ga0207698_10167011
567 Ga0207428_10132331
568 Ga0268266_10001414
569 Ga0268266_10007001
570 Ga0268266_10024300
571 Ga0268265_10853186
572 Ga0268264_10000442
573 Ga0265318_10036928
574 Ga0265338_10003509
575 Ga0265338_10321350
576 Ga0265770_1007183
577 Ga0265330_10055331
578 Ga0265328_10012212
579 Ga0265325_10020227
580 Ga0265325_10023193
581 Ga0265340_10170170
582 Ga0265339_10000026
583 Ga0265339_10030611
584 Ga0307408_100206305
585 Ga0265313_10013760
586 Ga0265313_10013890
587 Ga0265313_10028424
588 Ga0265314_10102557
589 Ga0265342_10001312
590 Ga0265342_10019034
591 Ga0307416_100119134
592 Ga0373931_0134017
593 Ga0373937_0005347
594 Ga0373937_0718728
595 Ga0453683_0117596
596 Ga0453683_0266601
597 Ga0466963_0029100
598 Ga0466967_0218576
599 Ga0466967_0918733
600 Ga0495629_0055374
601 Ga0495629_0236773
602 Ga0495641_0035522
603 Ga0495580_0164484
604 Ga0495664_0048358
605 Ga0495585_0095850
606 Ga0495665_0181310
607 Ga0495586_0027473
608 Ga0495587_0070101
609 Ga0495587_0119031
610 Ga0495645_0009864
611 Ga0495625_0000046
612 Ga0495625_0254130
613 Ga0495635_0141765
614 Ga0495657_0083771
615 Ga0495669_0011639
616 Ga0495613_0195470
617 Ga0495600_0129657
618 Ga0495600_0307556
619 Ga0495581_0247542
620 Ga0495604_0088864
621 Ga0495674_0181643
622 Ga0495675_0007752
623 Ga0495602_0082498
624 Ga0496100_0498483
625 Ga0496101_0462592
626 Ga0496102_0127084
627 Ga0496102_0453526
628 Ga0496104_0441730
629 Ga0496105_0101570
630 Ga0496112_0438175
631 Ga0496114_0059588
632 Ga0496115_0148163
633 Ga0496115_0197809
634 Ga0496115_0219890
635 Ga0496126_0068441
636 Ga0501039_0192503
637 Ga0501042_0369879
638 Ga0501048_0132661
639 Ga0501076_0097654
640 Ga0501077_0168432
641 nmdc:mga05p37_121_c1
642 nmdc:mga05p37_296119_c1
643 nmdc:mga08y16_177355_c1
644 nmdc:mga0n895_688248_c1
645 nmdc:mga0n895_742564_c1
646 nmdc:mga0rr50_151824_c1
647 nmdc:mga0rr50_83411_c1
648 nmdc:mga08x19_2_c1
649 nmdc:mga0a205_354667_c1
650 Ga0500595_042544
651 Ga0501082_0585394
652 2884218239

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

171

291

0.97

PF00106

adh_short

short chain dehydrogenase

172

244

0.94

PF00106

adh_short

short chain dehydrogenase

10

159

0.89

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

16

161

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tzq-assembly1.cif.gz_C crystal structure of a short-chain type dehydrogenase/reductase from mycobacterium marinum 0.911 7 261
3grp-assembly1.cif.gz_B 2.1 angstrom crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from bartonella henselae 0.9108 4 264
3tzq-assembly1.cif.gz_A crystal structure of a short-chain type dehydrogenase/reductase from mycobacterium marinum 0.9095 9 258
5t2u-assembly1.cif.gz_B short chain dehydrogenase/reductase family protein 0.9094 6 258
3emk-assembly1.cif.gz_C 2.5a crystal structure of glucose/ribitol dehydrogenase from brucella melitensis 0.9091 7 264
ID Description Score Start End Superfamily
3grpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9215 4 264 3.40.50.720
3grpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9174 4 264 3.40.50.720
3tzqC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9135 7 259 3.40.50.720
af_P9WGR9_1_247_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9107 4 261 3.40.50.720
5t2uB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9094 6 258 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1G7PF55-F1-model_v4 3-oxoacyl-[acyl-carrier protein] reductase 0.93 2 266 GO:0006633
GO:0016616
GO:0048038
AF-A0A2V9ZQP3-F1-model_v4 Short-chain dehydrogenase 0.9252 4 266 GO:0016491
AF-A0A446CE85-F1-model_v4 Glucose 1-dehydrogenase (EC 1.1.1.119) 0.9239 7 261 GO:0047935
AF-A0A424WBP2-F1-model_v4 SDR family oxidoreductase 0.9237 7 261 GO:0016491
AF-A0A2N8KPV6-F1-model_v4 Dehydrogenase 0.9233 7 261 GO:0016491

Map