F408446

General Info

Members Datasets Scaffolds Average Seq Length
326 172 325 205

Family's Representative Sequence

Representative Sequence 3300042127|Ga0450890_007223|Ga0450890_007223_174_881
Length 235
Sequence MKIILSDAGKRFNRDWIFRHFTYTFEQGGSYAITGANGSGKSTLLQVLSGSMHFNEGSLRYEVDSSASSRISQSFGFAQDKSEMSPSTSLRMSEKLEIPHEKIYQHVSICAPYLEVVEEMTLKEFLDFHHGFKPFLPTINTGSIITRLGLEKAADKQIRYYSSGMKQRVKLAQCIFSDTVLVLLDEPCTNLDTAGIELYHELVSEYCGNRLVIVSSNDKVEYNFCKEVISIGDYK

Samples

Sample ID Description Type Environment
1 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
132 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
133 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
134 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
137 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
138 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
139 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
140 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
141 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
142 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
143 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
146 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
151 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
152 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
153 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
154 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
155 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
164 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
165 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
166 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
171 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
172 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.44
Nodule 0
Rhizoplane 1.84
Rhizosphere 91.72
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10000573 3300001989 Bacteria 13281
2 JGI25153J46596_10070445 3300003215 Bacteria 907
3 JGI25160J50197_1046320 3300003354 Bacteria 955
4 Ga0055526_1015321 3300003771 Bacteria 3084
5 Ga0055528_1002059 3300003790 Bacteria 11231
6 Ga0055530_10001651 3300003791 Bacteria 15904
7 Ga0065165_1000579 3300005262 Bacteria 54043
8 Ga0070676_10000340 3300005328 Bacteria 21336
9 Ga0070676_10002087 3300005328 Bacteria 10167
10 Ga0070683_100001004 3300005329 Bacteria 21143
11 Ga0070683_100003956 3300005329 Bacteria 12127
12 Ga0070683_100167855 3300005329 Bacteria 2083
13 Ga0070690_100002532 3300005330 Bacteria 9833
14 Ga0070677_10233947 3300005333 Bacteria 904
15 Ga0068869_100000814 3300005334 Bacteria 17836
16 Ga0068869_100007258 3300005334 Bacteria 7063
17 Ga0068869_100032099 3300005334 Bacteria 3698
18 Ga0070666_10021276 3300005335 Bacteria 4202
19 Ga0070666_10054077 3300005335 Bacteria 2709
20 Ga0068868_100001169 3300005338 Bacteria 17976
21 Ga0068868_100023129 3300005338 Bacteria 4699
22 Ga0068868_100089709 3300005338 Bacteria 2475
23 Ga0068868_100099304 3300005338 Bacteria 2355
24 Ga0070689_100016816 3300005340 Bacteria 5361
25 Ga0070689_100117422 3300005340 Bacteria 2122
26 Ga0070689_100301831 3300005340 Bacteria 1333
27 Ga0070661_100000922 3300005344 Bacteria 21063
28 Ga0070661_100015002 3300005344 Bacteria 5467
29 Ga0070661_100265160 3300005344 Bacteria 1329
30 Ga0070668_100028200 3300005347 Bacteria 4263
31 Ga0070669_100294059 3300005353 Bacteria 1304
32 Ga0070675_100060472 3300005354 Unclassified 3128
33 Ga0070675_100379486 3300005354 Bacteria 1258
34 Ga0070675_100763768 3300005354 Bacteria 882
35 Ga0070671_100012956 3300005355 Bacteria 6718
36 Ga0070671_100070130 3300005355 Unclassified 2924
37 Ga0070671_100119702 3300005355 Bacteria 2215
38 Ga0070674_100016991 3300005356 Bacteria 4568
39 Ga0070674_100051123 3300005356 Bacteria 2847
40 Ga0070673_100009950 3300005364 Bacteria 6410
41 Ga0070673_100043296 3300005364 Bacteria 3478
42 Ga0070688_100015476 3300005365 Bacteria 4342
43 Ga0070688_100153509 3300005365 Bacteria 1576
44 Ga0070688_100286824 3300005365 Bacteria 1185
45 Ga0070659_100107572 3300005366 Bacteria 2249
46 Ga0070659_100416492 3300005366 Bacteria 1136
47 Ga0070667_100090570 3300005367 Bacteria 2629
48 Ga0070667_100320605 3300005367 Unclassified 1398
49 Ga0070663_100373549 3300005455 Bacteria 1159
50 Ga0070678_100008073 3300005456 Bacteria 6280
51 Ga0070662_100015192 3300005457 Bacteria 5153
52 Ga0070662_100134806 3300005457 Bacteria 1908
53 Ga0068867_100026945 3300005459 Bacteria 4130
54 Ga0068867_100048067 3300005459 Bacteria 3138
55 Ga0068867_100068726 3300005459 Bacteria 2644
56 Ga0070685_10018591 3300005466 Bacteria 3740
57 Ga0070685_10097756 3300005466 Bacteria 1788
58 Ga0070707_100223184 3300005468 Unclassified 1835
59 Ga0070684_100000042 3300005535 Bacteria 89896
60 Ga0070684_100001002 3300005535 Bacteria 20102
61 Ga0070684_100149801 3300005535 Bacteria 2113
62 Ga0068853_100025669 3300005539 Bacteria 4945
63 Ga0068853_100035590 3300005539 Bacteria 4230
64 Ga0068853_100579118 3300005539 Bacteria 1065
65 Ga0070672_100096782 3300005543 Bacteria 2388
66 Ga0070672_100224418 3300005543 Bacteria 1577
67 Ga0070672_100591331 3300005543 Bacteria 966
68 Ga0070686_100009323 3300005544 Bacteria 5513
69 Ga0070686_100009493 3300005544 Bacteria 5471
70 Ga0070665_100757822 3300005548 Bacteria 984
71 Ga0070664_100000266 3300005564 Bacteria 37671
72 Ga0070664_100004702 3300005564 Bacteria 10950
73 Ga0070664_100011145 3300005564 Bacteria 7292
74 Ga0070664_100018138 3300005564 Bacteria 5777
75 Ga0070664_100098601 3300005564 Bacteria 2539
76 Ga0070664_100204314 3300005564 Bacteria 1764
77 Ga0068857_100006612 3300005577 Bacteria 9955
78 Ga0068857_100013547 3300005577 Bacteria 7103
79 Ga0068857_100349782 3300005577 Bacteria 1368
80 Ga0068854_100007009 3300005578 Bacteria 7188
81 Ga0068854_100155432 3300005578 Unclassified 1767
82 Ga0068856_100148502 3300005614 Bacteria 2352
83 Ga0070702_100026654 3300005615 Bacteria 3108
84 Ga0068852_100044800 3300005616 Bacteria 3761
85 Ga0068852_100060389 3300005616 Bacteria 3291
86 Ga0068859_100015728 3300005617 Bacteria 7604
87 Ga0068859_100016137 3300005617 Bacteria 7501
88 Ga0068859_100049033 3300005617 Bacteria 4241
89 Ga0068859_100055696 3300005617 Bacteria 3978
90 Ga0068864_100015849 3300005618 Bacteria 6269
91 Ga0068864_100018371 3300005618 Bacteria 5841
92 Ga0068864_100124337 3300005618 Bacteria 2310
93 Ga0068864_100467234 3300005618 Bacteria 1209
94 Ga0068861_100032440 3300005719 Bacteria 3845
95 Ga0068861_100354207 3300005719 Bacteria 1289
96 Ga0068863_100015060 3300005841 Bacteria 7430
97 Ga0068863_100329937 3300005841 Bacteria 1483
98 Ga0068863_100656753 3300005841 Bacteria 1040
99 Ga0068858_100011874 3300005842 Bacteria 8208
100 Ga0068858_100520560 3300005842 Bacteria 1150
101 Ga0068858_100559235 3300005842 Bacteria 1108
102 Ga0068860_100033852 3300005843 Bacteria 4902
103 Ga0068862_100120534 3300005844 Bacteria 2311
104 Ga0068862_100184761 3300005844 Bacteria 1873
105 Ga0081539_10092209 3300005985 Bacteria 1562
106 Ga0075362_10267682 3300006177 Bacteria 843
107 Ga0075366_10083987 3300006195 Bacteria 1903
108 Ga0075366_10193737 3300006195 Bacteria 1235
109 Ga0097621_100042428 3300006237 Bacteria 3664
110 Ga0068871_100030374 3300006358 Bacteria 4254
111 Ga0068871_100713030 3300006358 Bacteria 920
112 Ga0068865_100092722 3300006881 Unclassified 2195
113 Ga0068865_100122705 3300006881 Bacteria 1935
114 Ga0068865_100197948 3300006881 Bacteria 1558
115 Ga0097620_100015728 3300006931 Bacteria 7604
116 Ga0097620_100016137 3300006931 Bacteria 7501
117 Ga0097620_100049030 3300006931 Bacteria 4241
118 Ga0097620_100055693 3300006931 Bacteria 3978
119 Ga0111539_10181068 3300009094 Bacteria 2461
120 Ga0105247_10001069 3300009101 Bacteria 20467
121 Ga0114129_10060217 3300009147 Bacteria 5308
122 Ga0105243_10445969 3300009148 Bacteria 1213
123 Ga0105241_10030148 3300009174 Unclassified 4052
124 Ga0105241_10240612 3300009174 Unclassified 1530
125 Ga0105241_10806243 3300009174 Unclassified 865
126 Ga0105242_10075649 3300009176 Bacteria 2804
127 Ga0105248_10115064 3300009177 Bacteria 3034
128 Ga0105249_10003825 3300009553 Bacteria 12985
129 Ga0105249_10037314 3300009553 Bacteria 4410
130 Ga0105249_10038530 3300009553 Bacteria 4338
131 Ga0105249_10313965 3300009553 Bacteria 1577
132 Ga0105246_10154089 3300011119 Bacteria 1743
133 Ga0157373_10150619 3300013100 Unclassified 1636
134 Ga0157373_10291482 3300013100 Bacteria 1157
135 Ga0157373_10568873 3300013100 Unclassified 823
136 Ga0157371_10052204 3300013102 Unclassified 2904
137 Ga0157371_10059745 3300013102 Bacteria 2702
138 Ga0157371_10133338 3300013102 Bacteria 1768
139 Ga0157370_10010588 3300013104 Bacteria 9709
140 Ga0157374_10003156 3300013296 Bacteria 13854
141 Ga0157374_10014456 3300013296 Bacteria 6907
142 Ga0157374_10024656 3300013296 Bacteria 5393
143 Ga0157374_10673503 3300013296 Bacteria 1047
144 Ga0157374_10757180 3300013296 Bacteria 986
145 Ga0157378_10024568 3300013297 Bacteria 5305
146 Ga0157378_10031632 3300013297 Bacteria 4674
147 Ga0157378_10059700 3300013297 Bacteria 3403
148 Ga0157378_10109452 3300013297 Unclassified 2531
149 Ga0163162_10001770 3300013306 Bacteria 20242
150 Ga0163162_10151282 3300013306 Bacteria 2439
151 Ga0163162_10213544 3300013306 Unclassified 2059
152 Ga0163162_10221084 3300013306 Unclassified 2024
153 Ga0163162_10381994 3300013306 Bacteria 1542
154 Ga0157372_10866014 3300013307 Bacteria 1049
155 Ga0157375_10010150 3300013308 Bacteria 8284
156 Ga0157375_10037870 3300013308 Bacteria 4626
157 Ga0157375_10060743 3300013308 Unclassified 3750
158 Ga0157375_10066049 3300013308 Bacteria 3609
159 Ga0157375_10256300 3300013308 Bacteria 1911
160 Ga0163163_10001563 3300014325 Bacteria 19320
161 Ga0163163_10016374 3300014325 Bacteria 6886
162 Ga0163163_10330688 3300014325 Bacteria 1578
163 Ga0157380_10106943 3300014326 Bacteria 2342
164 Ga0157380_10164932 3300014326 Unclassified 1929
165 Ga0157377_10012497 3300014745 Unclassified 4272
166 Ga0157377_10013045 3300014745 Bacteria 4196
167 Ga0157377_10554978 3300014745 Bacteria 812
168 Ga0157379_10027741 3300014968 Bacteria 5040
169 Ga0157379_10040924 3300014968 Bacteria 4137
170 Ga0157376_10014145 3300014969 Bacteria 5976
171 Ga0157376_10433339 3300014969 Bacteria 1278
172 Ga0163161_10003877 3300017792 Bacteria 10489
173 Ga0163161_10074553 3300017792 Bacteria 2488
174 Ga0163161_10158494 3300017792 Unclassified 1725
175 Ga0163161_10196520 3300017792 Bacteria 1553
176 Ga0209673_1000339 3300025273 Bacteria 85906
177 Ga0209675_1031836 3300025291 Bacteria 1242
178 Ga0209564_1003365 3300025295 Bacteria 11060
179 Ga0209564_1055873 3300025295 Bacteria 921
180 Ga0209758_1054840 3300025297 Bacteria 1359
181 Ga0209758_1089619 3300025297 Bacteria 904
182 Ga0209050_1000256 3300025298 Bacteria 114192
183 Ga0207426_1002135 3300025302 Bacteria 13503
184 Ga0209257_1000659 3300025304 Bacteria 54234
185 Ga0207697_10022305 3300025315 Bacteria 2593
186 Ga0207682_10055453 3300025893 Bacteria 1648
187 Ga0207710_10007493 3300025900 Bacteria 4621
188 Ga0207688_10009232 3300025901 Bacteria 5374
189 Ga0207645_10004909 3300025907 Bacteria 9808
190 Ga0207645_10012587 3300025907 Bacteria 5737
191 Ga0207643_10369056 3300025908 Bacteria 903
192 Ga0207654_10142540 3300025911 Unclassified 1530
193 Ga0207649_10000644 3300025920 Bacteria 23288
194 Ga0207646_10294582 3300025922 Bacteria 1466
195 Ga0207650_10126841 3300025925 Bacteria 1993
196 Ga0207650_10333146 3300025925 Bacteria 1245
197 Ga0207659_10126369 3300025926 Bacteria 1967
198 Ga0207659_10257909 3300025926 Bacteria 1417
199 Ga0207644_10289286 3300025931 Bacteria 1317
200 Ga0207690_10096309 3300025932 Bacteria 2104
201 Ga0207690_10162545 3300025932 Bacteria 1666
202 Ga0207690_10708819 3300025932 Bacteria 828
203 Ga0207706_10004084 3300025933 Bacteria 13789
204 Ga0207706_10021869 3300025933 Bacteria 5740
205 Ga0207686_10060630 3300025934 Bacteria 2395
206 Ga0207709_10353357 3300025935 Bacteria 1110
207 Ga0207670_10030989 3300025936 Bacteria 3421
208 Ga0207670_10144557 3300025936 Bacteria 1757
209 Ga0207669_10003587 3300025937 Bacteria 6731
210 Ga0207669_10020385 3300025937 Bacteria 3477
211 Ga0207669_10400584 3300025937 Bacteria 1075
212 Ga0207704_10348946 3300025938 Bacteria 1151
213 Ga0207691_10003310 3300025940 Bacteria 15699
214 Ga0207691_10328873 3300025940 Bacteria 1310
215 Ga0207691_10358359 3300025940 Bacteria 1247
216 Ga0207691_10534650 3300025940 Bacteria 994
217 Ga0207689_10001306 3300025942 Bacteria 24017
218 Ga0207689_10005140 3300025942 Bacteria 11766
219 Ga0207689_10035878 3300025942 Bacteria 4116
220 Ga0207689_10207479 3300025942 Bacteria 1618
221 Ga0207689_10278425 3300025942 Bacteria 1385
222 Ga0207661_10000781 3300025944 Bacteria 20721
223 Ga0207661_10064009 3300025944 Bacteria 2980
224 Ga0207679_10000733 3300025945 Bacteria 21828
225 Ga0207679_10018467 3300025945 Bacteria 4673
226 Ga0207679_10129179 3300025945 Bacteria 2024
227 Ga0207679_10488288 3300025945 Bacteria 1097
228 Ga0207651_10041219 3300025960 Bacteria 3063
229 Ga0207651_10231939 3300025960 Bacteria 1499
230 Ga0207712_10001115 3300025961 Bacteria 18744
231 Ga0207712_10035792 3300025961 Bacteria 3376
232 Ga0207712_10313002 3300025961 Unclassified 1293
233 Ga0207668_10047206 3300025972 Bacteria 2947
234 Ga0207640_10013226 3300025981 Bacteria 4725
235 Ga0207640_10438451 3300025981 Unclassified 1073
236 Ga0207658_10065888 3300025986 Bacteria 2723
237 Ga0207677_10001784 3300026023 Bacteria 11359
238 Ga0207677_10004770 3300026023 Bacteria 7314
239 Ga0207677_10046029 3300026023 Bacteria 2918
240 Ga0207677_10061234 3300026023 Bacteria 2605
241 Ga0207677_10063631 3300026023 Bacteria 2565
242 Ga0207677_10117690 3300026023 Bacteria 1992
243 Ga0207703_10047204 3300026035 Bacteria 3472
244 Ga0207639_10005779 3300026041 Bacteria 8376
245 Ga0207639_10018147 3300026041 Bacteria 4996
246 Ga0207639_10069909 3300026041 Bacteria 2741
247 Ga0207678_10076224 3300026067 Bacteria 2873
248 Ga0207678_10270462 3300026067 Bacteria 1457
249 Ga0207641_10063778 3300026088 Bacteria 3148
250 Ga0207641_10429034 3300026088 Bacteria 1274
251 Ga0207641_10713384 3300026088 Bacteria 988
252 Ga0207648_10010250 3300026089 Bacteria 8901
253 Ga0207648_10067801 3300026089 Bacteria 3110
254 Ga0207648_10071328 3300026089 Bacteria 3027
255 Ga0207648_10228999 3300026089 Bacteria 1653
256 Ga0207648_10363251 3300026089 Bacteria 1306
257 Ga0207676_10014205 3300026095 Bacteria 5721
258 Ga0207676_10128254 3300026095 Bacteria 2152
259 Ga0207676_10157442 3300026095 Bacteria 1964
260 Ga0207676_10415532 3300026095 Bacteria 1260
261 Ga0207674_10003645 3300026116 Bacteria 18783
262 Ga0207674_10020593 3300026116 Bacteria 7122
263 Ga0207675_100032802 3300026118 Bacteria 4838
264 Ga0207675_100067944 3300026118 Bacteria 3331
265 Ga0207675_100122266 3300026118 Bacteria 2464
266 Ga0207675_100137663 3300026118 Bacteria 2318
267 Ga0207675_100543648 3300026118 Bacteria 1160
268 Ga0207683_10007976 3300026121 Bacteria 9060
269 Ga0207683_10077230 3300026121 Bacteria 2949
270 Ga0207698_10205497 3300026142 Bacteria 1767
271 Ga0207698_11186100 3300026142 Bacteria 777
272 Ga0268266_10036278 3300028379 Bacteria 4196
273 Ga0268265_10274133 3300028380 Bacteria 1506
274 Ga0268265_10470060 3300028380 Bacteria 1179
275 Ga0268264_10015517 3300028381 Bacteria 6245
276 Ga0268264_10364265 3300028381 Bacteria 1380
277 Ga0268264_10880004 3300028381 Bacteria 898
278 Ga0307414_10355762 3300032004 Unclassified 1258
279 Ga0373952_0090663 3300035092 Bacteria 793
280 Ga0373955_0363909 3300035172 Bacteria 877
281 Ga0373933_0119870 3300035724 Bacteria 1647
282 Ga0373947_0352750 3300035725 Bacteria 987
283 Ga0373947_0445525 3300035725 Unclassified 877
284 Ga0395900_0786451 3300037418 Unclassified 880
285 Ga0439439_0010419 3300041406 Bacteria 2222
286 Ga0451807_0864671 3300041486 Bacteria 1522
287 Ga0451807_2532153 3300041486 Bacteria 1272
288 Ga0439431_0016596 3300041997 Unclassified 1725
289 Ga0439433_0046463 3300041999 Bacteria 1018
290 Ga0439445_0015799 3300042004 Bacteria 1853
291 Ga0450890_007223 3300042127 Bacteria 1419
292 Ga0451577_0124682 3300042876 Unclassified 2308
293 Ga0453684_0155487 3300044712 Bacteria 2712
294 Ga0453684_0273826 3300044712 Bacteria 1928
295 Ga0495629_0162024 3300046459 Bacteria 1554
296 Ga0495638_0272172 3300046460 Unclassified 924
297 Ga0495650_0121227 3300046471 Bacteria 962
298 Ga0495580_0249631 3300046472 Bacteria 1215
299 Ga0495608_0022753 3300046511 Bacteria 4299
300 Ga0495628_0579737 3300046516 Bacteria 803
301 Ga0495586_0275845 3300046535 Unclassified 962
302 Ga0495634_0197006 3300046642 Bacteria 1253
303 Ga0495635_0184559 3300046663 Bacteria 1417
304 Ga0495657_0203113 3300046675 Unclassified 1207
305 Ga0495600_0072214 3300046809 Bacteria 2255
306 Ga0495672_0007731 3300047320 Bacteria 8045
307 Ga0495672_0045901 3300047320 Bacteria 2610
308 Ga0495676_0138558 3300047321 Unclassified 1746
309 Ga0495680_0073831 3300047322 Bacteria 2591
310 Ga0495684_0444866 3300047471 Bacteria 902
311 Ga0496105_0326585 3300048908 Bacteria 1229
312 Ga0496110_0318839 3300048913 Bacteria 1416
313 Ga0496110_0561491 3300048913 Unclassified 1037
314 Ga0496114_0381942 3300048917 Bacteria 1247
315 Ga0501047_0010114 3300049581 Bacteria 8918
316 Ga0501217_017481 3300049661 Bacteria 1654
317 Ga0501233_033319 3300049668 Bacteria 1176
318 Ga0501252_010336 3300049682 Bacteria 1102
319 Ga0501221_014469 3300049704 Unclassified 1467
320 Ga0501080_0194367 3300049742 Bacteria 1864
321 Ga0501083_0129232 3300049744 Bacteria 1656
322 Ga0501044_0052083 3300049823 Bacteria 4220
323 nmdc:mga0k408_169163_c1 3300050493 Bacteria 1303
324 Ga0500628_060054 3300053129 Bacteria 926
325 Ga0500611_000004 3300053727 Bacteria 253326

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013307 Ga0157372_10866014 Ga0157372_108660141 183
2 3300005355 Ga0070671_100119702 Ga0070671_1001197023 186
3 3300005614 Ga0068856_100148502 Ga0068856_1001485022 186
4 3300013297 Ga0157378_10109452 Ga0157378_101094523 186
5 3300025960 Ga0207651_10041219 Ga0207651_100412193 186
6 3300046471 Ga0495650_0121227 Ga0495650_0121227_194_814 186
7 3300048917 Ga0496114_0381942 Ga0496114_0381942_73_693 186
8 3300014326 Ga0157380_10106943 Ga0157380_101069434 187
9 3300041486 Ga0451807_0864671 Ga0451807_0864671_408_1028 187
10 3300047321 Ga0495676_0138558 Ga0495676_0138558_921_1541 187
11 3300005355 Ga0070671_100070130 Ga0070671_1000701303 188
12 3300026088 Ga0207641_10713384 Ga0207641_107133841 188
13 3300047320 Ga0495672_0007731 Ga0495672_0007731_3124_3777 188
14 3300005335 Ga0070666_10021276 Ga0070666_100212764 189
15 3300005338 Ga0068868_100023129 Ga0068868_1000231292 189
16 3300005340 Ga0070689_100117422 Ga0070689_1001174223 189
17 3300005354 Ga0070675_100379486 Ga0070675_1003794862 189
18 3300005365 Ga0070688_100286824 Ga0070688_1002868242 189
19 3300005456 Ga0070678_100008073 Ga0070678_1000080737 189
20 3300005457 Ga0070662_100015192 Ga0070662_1000151924 189
21 3300005459 Ga0068867_100026945 Ga0068867_1000269453 189
22 3300005564 Ga0070664_100098601 Ga0070664_1000986012 189
23 3300005578 Ga0068854_100007009 Ga0068854_1000070094 189
24 3300005616 Ga0068852_100044800 Ga0068852_1000448002 189
25 3300005618 Ga0068864_100467234 Ga0068864_1004672342 189
26 3300006237 Ga0097621_100042428 Ga0097621_1000424283 189
27 3300006358 Ga0068871_100030374 Ga0068871_1000303744 189
28 3300009174 Ga0105241_10030148 Ga0105241_100301482 189
29 3300009177 Ga0105248_10115064 Ga0105248_101150643 189
30 3300013102 Ga0157371_10052204 Ga0157371_100522042 189
31 3300013296 Ga0157374_10014456 Ga0157374_100144563 189
32 3300013306 Ga0163162_10213544 Ga0163162_102135442 189
33 3300013308 Ga0157375_10010150 Ga0157375_100101503 189
34 3300014968 Ga0157379_10027741 Ga0157379_100277412 189
35 3300014969 Ga0157376_10014145 Ga0157376_100141454 189
36 3300017792 Ga0163161_10003877 Ga0163161_100038773 189
37 3300025908 Ga0207643_10369056 Ga0207643_103690562 189
38 3300025911 Ga0207654_10142540 Ga0207654_101425402 189
39 3300025931 Ga0207644_10289286 Ga0207644_102892861 189
40 3300025933 Ga0207706_10004084 Ga0207706_100040849 189
41 3300025942 Ga0207689_10278425 Ga0207689_102784252 189
42 3300025945 Ga0207679_10129179 Ga0207679_101291792 189
43 3300025981 Ga0207640_10013226 Ga0207640_100132263 189
44 3300026023 Ga0207677_10063631 Ga0207677_100636313 189
45 3300026095 Ga0207676_10415532 Ga0207676_104155322 189
46 3300026118 Ga0207675_100067944 Ga0207675_1000679443 189
47 3300026121 Ga0207683_10007976 Ga0207683_1000797610 189
48 3300026142 Ga0207698_11186100 Ga0207698_111861002 189
49 3300041406 Ga0439439_0010419 Ga0439439_0010419_205_900 189
50 3300041997 Ga0439431_0016596 Ga0439431_0016596_866_1513 189
51 3300041999 Ga0439433_0046463 Ga0439433_0046463_118_765 189
52 3300048908 Ga0496105_0326585 Ga0496105_0326585_427_1047 189
53 3300005985 Ga0081539_10092209 Ga0081539_100922092 191
54 3300035172 Ga0373955_0363909 Ga0373955_0363909_222_842 191
55 3300035724 Ga0373933_0119870 Ga0373933_0119870_52_750 191
56 3300046511 Ga0495608_0022753 Ga0495608_0022753_2883_3503 191
57 3300046535 Ga0495586_0275845 Ga0495586_0275845_279_899 191
58 3300046809 Ga0495600_0072214 Ga0495600_0072214_738_1358 191
59 3300047322 Ga0495680_0073831 Ga0495680_0073831_64_684 191
60 3300005367 Ga0070667_100320605 Ga0070667_1003206052 192
61 3300032004 Ga0307414_10355762 Ga0307414_103557622 192
62 3300005356 Ga0070674_100016991 Ga0070674_1000169912 193
63 3300025937 Ga0207669_10003587 Ga0207669_100035876 193
64 3300042004 Ga0439445_0015799 Ga0439445_0015799_246_941 193
65 3300035725 Ga0373947_0445525 Ga0373947_0445525_57_677 195
66 3300046459 Ga0495629_0162024 Ga0495629_0162024_147_767 195
67 3300046675 Ga0495657_0203113 Ga0495657_0203113_81_701 195
68 3300047471 Ga0495684_0444866 Ga0495684_0444866_246_866 195
69 3300013102 Ga0157371_10133338 Ga0157371_101333382 198
70 iso_pu_bacteria 2881955468 2881957006 202
71 3300053727 Ga0500611_000004 Ga0500611_000004_90032_90649 203
72 3300014969 Ga0157376_10433339 Ga0157376_104333391 204
73 3300053129 Ga0500628_060054 Ga0500628_060054_64_678 204
74 3300001989 JGI24739J22299_10000573 JGI24739J22299_100005736 205
75 3300003215 JGI25153J46596_10070445 JGI25153J46596_100704451 205
76 3300003354 JGI25160J50197_1046320 JGI25160J50197_10463202 205
77 3300003771 Ga0055526_1015321 Ga0055526_10153214 205
78 3300003790 Ga0055528_1002059 Ga0055528_10020598 205
79 3300003791 Ga0055530_10001651 Ga0055530_100016517 205
80 3300005262 Ga0065165_1000579 Ga0065165_100057918 205
81 3300005328 Ga0070676_10000340 Ga0070676_1000034021 205
82 3300005328 Ga0070676_10002087 Ga0070676_100020877 205
83 3300005329 Ga0070683_100001004 Ga0070683_10000100415 205
84 3300005329 Ga0070683_100003956 Ga0070683_10000395610 205
85 3300005329 Ga0070683_100167855 Ga0070683_1001678553 205
86 3300005330 Ga0070690_100002532 Ga0070690_1000025329 205
87 3300005333 Ga0070677_10233947 Ga0070677_102339471 205
88 3300005334 Ga0068869_100000814 Ga0068869_10000081418 205
89 3300005334 Ga0068869_100007258 Ga0068869_1000072586 205
90 3300005334 Ga0068869_100032099 Ga0068869_1000320992 205
91 3300005335 Ga0070666_10054077 Ga0070666_100540773 205
92 3300005338 Ga0068868_100001169 Ga0068868_1000011692 205
93 3300005338 Ga0068868_100089709 Ga0068868_1000897092 205
94 3300005338 Ga0068868_100099304 Ga0068868_1000993042 205
95 3300005340 Ga0070689_100016816 Ga0070689_1000168163 205
96 3300005340 Ga0070689_100301831 Ga0070689_1003018311 205
97 3300005344 Ga0070661_100000922 Ga0070661_10000092217 205
98 3300005344 Ga0070661_100015002 Ga0070661_1000150023 205
99 3300005344 Ga0070661_100265160 Ga0070661_1002651602 205
100 3300005347 Ga0070668_100028200 Ga0070668_1000282003 205
101 3300005353 Ga0070669_100294059 Ga0070669_1002940592 205
102 3300005354 Ga0070675_100060472 Ga0070675_1000604722 205
103 3300005354 Ga0070675_100763768 Ga0070675_1007637682 205
104 3300005355 Ga0070671_100012956 Ga0070671_1000129564 205
105 3300005356 Ga0070674_100051123 Ga0070674_1000511232 205
106 3300005364 Ga0070673_100009950 Ga0070673_1000099506 205
107 3300005364 Ga0070673_100043296 Ga0070673_1000432963 205
108 3300005365 Ga0070688_100015476 Ga0070688_1000154764 205
109 3300005365 Ga0070688_100153509 Ga0070688_1001535092 205
110 3300005366 Ga0070659_100107572 Ga0070659_1001075722 205
111 3300005366 Ga0070659_100416492 Ga0070659_1004164921 205
112 3300005367 Ga0070667_100090570 Ga0070667_1000905703 205
113 3300005455 Ga0070663_100373549 Ga0070663_1003735491 205
114 3300005457 Ga0070662_100134806 Ga0070662_1001348063 205
115 3300005459 Ga0068867_100048067 Ga0068867_1000480671 205
116 3300005459 Ga0068867_100068726 Ga0068867_1000687263 205
117 3300005466 Ga0070685_10018591 Ga0070685_100185914 205
118 3300005466 Ga0070685_10097756 Ga0070685_100977561 205
119 3300005468 Ga0070707_100223184 Ga0070707_1002231843 205
120 3300005535 Ga0070684_100000042 Ga0070684_1000000428 205
121 3300005535 Ga0070684_100001002 Ga0070684_1000010022 205
122 3300005535 Ga0070684_100149801 Ga0070684_1001498013 205
123 3300005539 Ga0068853_100025669 Ga0068853_1000256692 205
124 3300005539 Ga0068853_100035590 Ga0068853_1000355904 205
125 3300005539 Ga0068853_100579118 Ga0068853_1005791182 205
126 3300005543 Ga0070672_100096782 Ga0070672_1000967822 205
127 3300005543 Ga0070672_100224418 Ga0070672_1002244182 205
128 3300005543 Ga0070672_100591331 Ga0070672_1005913312 205
129 3300005544 Ga0070686_100009323 Ga0070686_1000093232 205
130 3300005544 Ga0070686_100009493 Ga0070686_1000094933 205
131 3300005548 Ga0070665_100757822 Ga0070665_1007578222 205
132 3300005564 Ga0070664_100000266 Ga0070664_10000026636 205
133 3300005564 Ga0070664_100004702 Ga0070664_1000047022 205
134 3300005564 Ga0070664_100011145 Ga0070664_1000111456 205
135 3300005564 Ga0070664_100018138 Ga0070664_1000181387 205
136 3300005564 Ga0070664_100204314 Ga0070664_1002043142 205
137 3300005577 Ga0068857_100006612 Ga0068857_1000066125 205
138 3300005577 Ga0068857_100013547 Ga0068857_1000135473 205
139 3300005577 Ga0068857_100349782 Ga0068857_1003497822 205
140 3300005578 Ga0068854_100155432 Ga0068854_1001554321 205
141 3300005615 Ga0070702_100026654 Ga0070702_1000266542 205
142 3300005616 Ga0068852_100060389 Ga0068852_1000603893 205
143 3300005617 Ga0068859_100015728 Ga0068859_1000157288 205
144 3300005617 Ga0068859_100016137 Ga0068859_1000161379 205
145 3300005617 Ga0068859_100049033 Ga0068859_1000490332 205
146 3300005617 Ga0068859_100055696 Ga0068859_1000556962 205
147 3300005618 Ga0068864_100015849 Ga0068864_1000158497 205
148 3300005618 Ga0068864_100018371 Ga0068864_1000183713 205
149 3300005618 Ga0068864_100124337 Ga0068864_1001243372 205
150 3300005719 Ga0068861_100032440 Ga0068861_1000324404 205
151 3300005719 Ga0068861_100354207 Ga0068861_1003542072 205
152 3300005841 Ga0068863_100015060 Ga0068863_1000150602 205
153 3300005841 Ga0068863_100329937 Ga0068863_1003299372 205
154 3300005841 Ga0068863_100656753 Ga0068863_1006567532 205
155 3300005842 Ga0068858_100011874 Ga0068858_1000118748 205
156 3300005842 Ga0068858_100520560 Ga0068858_1005205602 205
157 3300005842 Ga0068858_100559235 Ga0068858_1005592352 205
158 3300005843 Ga0068860_100033852 Ga0068860_1000338523 205
159 3300005844 Ga0068862_100120534 Ga0068862_1001205342 205
160 3300005844 Ga0068862_100184761 Ga0068862_1001847612 205
161 3300006177 Ga0075362_10267682 Ga0075362_102676822 205
162 3300006195 Ga0075366_10083987 Ga0075366_100839872 205
163 3300006195 Ga0075366_10193737 Ga0075366_101937372 205
164 3300006358 Ga0068871_100713030 Ga0068871_1007130302 205
165 3300006881 Ga0068865_100092722 Ga0068865_1000927224 205
166 3300006881 Ga0068865_100122705 Ga0068865_1001227052 205
167 3300006881 Ga0068865_100197948 Ga0068865_1001979482 205
168 3300006931 Ga0097620_100015728 Ga0097620_1000157288 205
169 3300006931 Ga0097620_100016137 Ga0097620_1000161379 205
170 3300006931 Ga0097620_100049030 Ga0097620_1000490302 205
171 3300006931 Ga0097620_100055693 Ga0097620_1000556934 205
172 3300009094 Ga0111539_10181068 Ga0111539_101810682 205
173 3300009101 Ga0105247_10001069 Ga0105247_100010694 205
174 3300009147 Ga0114129_10060217 Ga0114129_100602171 205
175 3300009148 Ga0105243_10445969 Ga0105243_104459692 205
176 3300009174 Ga0105241_10240612 Ga0105241_102406122 205
177 3300009174 Ga0105241_10806243 Ga0105241_108062431 205
178 3300009176 Ga0105242_10075649 Ga0105242_100756492 205
179 3300009553 Ga0105249_10003825 Ga0105249_100038259 205
180 3300009553 Ga0105249_10037314 Ga0105249_100373144 205
181 3300009553 Ga0105249_10038530 Ga0105249_100385303 205
182 3300009553 Ga0105249_10313965 Ga0105249_103139652 205
183 3300011119 Ga0105246_10154089 Ga0105246_101540892 205
184 3300013100 Ga0157373_10150619 Ga0157373_101506192 205
185 3300013100 Ga0157373_10291482 Ga0157373_102914822 205
186 3300013100 Ga0157373_10568873 Ga0157373_105688731 205
187 3300013102 Ga0157371_10059745 Ga0157371_100597453 205
188 3300013104 Ga0157370_10010588 Ga0157370_100105882 205
189 3300013296 Ga0157374_10003156 Ga0157374_100031564 205
190 3300013296 Ga0157374_10024656 Ga0157374_100246564 205
191 3300013296 Ga0157374_10673503 Ga0157374_106735032 205
192 3300013296 Ga0157374_10757180 Ga0157374_107571801 205
193 3300013297 Ga0157378_10024568 Ga0157378_100245685 205
194 3300013297 Ga0157378_10031632 Ga0157378_100316325 205
195 3300013297 Ga0157378_10059700 Ga0157378_100597002 205
196 3300013306 Ga0163162_10001770 Ga0163162_1000177014 205
197 3300013306 Ga0163162_10151282 Ga0163162_101512823 205
198 3300013306 Ga0163162_10221084 Ga0163162_102210842 205
199 3300013306 Ga0163162_10381994 Ga0163162_103819941 205
200 3300013308 Ga0157375_10037870 Ga0157375_100378702 205
201 3300013308 Ga0157375_10060743 Ga0157375_100607435 205
202 3300013308 Ga0157375_10066049 Ga0157375_100660493 205
203 3300013308 Ga0157375_10256300 Ga0157375_102563002 205
204 3300014325 Ga0163163_10001563 Ga0163163_1000156317 205
205 3300014325 Ga0163163_10016374 Ga0163163_100163746 205
206 3300014325 Ga0163163_10330688 Ga0163163_103306882 205
207 3300014326 Ga0157380_10164932 Ga0157380_101649322 205
208 3300014745 Ga0157377_10012497 Ga0157377_100124972 205
209 3300014745 Ga0157377_10013045 Ga0157377_100130452 205
210 3300014745 Ga0157377_10554978 Ga0157377_105549782 205
211 3300014968 Ga0157379_10040924 Ga0157379_100409244 205
212 3300017792 Ga0163161_10074553 Ga0163161_100745533 205
213 3300017792 Ga0163161_10158494 Ga0163161_101584941 205
214 3300017792 Ga0163161_10196520 Ga0163161_101965202 205
215 3300025273 Ga0209673_1000339 Ga0209673_100033961 205
216 3300025291 Ga0209675_1031836 Ga0209675_10318362 205
217 3300025295 Ga0209564_1003365 Ga0209564_10033652 205
218 3300025295 Ga0209564_1055873 Ga0209564_10558732 205
219 3300025297 Ga0209758_1054840 Ga0209758_10548401 205
220 3300025297 Ga0209758_1089619 Ga0209758_10896192 205
221 3300025298 Ga0209050_1000256 Ga0209050_100025628 205
222 3300025302 Ga0207426_1002135 Ga0207426_10021354 205
223 3300025304 Ga0209257_1000659 Ga0209257_100065941 205
224 3300025315 Ga0207697_10022305 Ga0207697_100223052 205
225 3300025893 Ga0207682_10055453 Ga0207682_100554532 205
226 3300025900 Ga0207710_10007493 Ga0207710_100074934 205
227 3300025901 Ga0207688_10009232 Ga0207688_100092325 205
228 3300025907 Ga0207645_10004909 Ga0207645_100049094 205
229 3300025907 Ga0207645_10012587 Ga0207645_100125874 205
230 3300025920 Ga0207649_10000644 Ga0207649_1000064415 205
231 3300025922 Ga0207646_10294582 Ga0207646_102945822 205
232 3300025925 Ga0207650_10126841 Ga0207650_101268413 205
233 3300025925 Ga0207650_10333146 Ga0207650_103331462 205
234 3300025926 Ga0207659_10126369 Ga0207659_101263692 205
235 3300025926 Ga0207659_10257909 Ga0207659_102579092 205
236 3300025932 Ga0207690_10096309 Ga0207690_100963092 205
237 3300025932 Ga0207690_10162545 Ga0207690_101625453 205
238 3300025932 Ga0207690_10708819 Ga0207690_107088192 205
239 3300025933 Ga0207706_10021869 Ga0207706_100218693 205
240 3300025934 Ga0207686_10060630 Ga0207686_100606302 205
241 3300025935 Ga0207709_10353357 Ga0207709_103533572 205
242 3300025936 Ga0207670_10030989 Ga0207670_100309893 205
243 3300025936 Ga0207670_10144557 Ga0207670_101445572 205
244 3300025937 Ga0207669_10020385 Ga0207669_100203853 205
245 3300025937 Ga0207669_10400584 Ga0207669_104005842 205
246 3300025938 Ga0207704_10348946 Ga0207704_103489461 205
247 3300025940 Ga0207691_10003310 Ga0207691_1000331015 205
248 3300025940 Ga0207691_10328873 Ga0207691_103288731 205
249 3300025940 Ga0207691_10358359 Ga0207691_103583592 205
250 3300025940 Ga0207691_10534650 Ga0207691_105346502 205
251 3300025942 Ga0207689_10001306 Ga0207689_1000130625 205
252 3300025942 Ga0207689_10005140 Ga0207689_1000514010 205
253 3300025942 Ga0207689_10035878 Ga0207689_100358785 205
254 3300025942 Ga0207689_10207479 Ga0207689_102074792 205
255 3300025944 Ga0207661_10000781 Ga0207661_1000078114 205
256 3300025944 Ga0207661_10064009 Ga0207661_100640093 205
257 3300025945 Ga0207679_10000733 Ga0207679_1000073318 205
258 3300025945 Ga0207679_10018467 Ga0207679_100184673 205
259 3300025945 Ga0207679_10488288 Ga0207679_104882882 205
260 3300025960 Ga0207651_10231939 Ga0207651_102319392 205
261 3300025961 Ga0207712_10001115 Ga0207712_1000111514 205
262 3300025961 Ga0207712_10035792 Ga0207712_100357922 205
263 3300025961 Ga0207712_10313002 Ga0207712_103130022 205
264 3300025972 Ga0207668_10047206 Ga0207668_100472063 205
265 3300025981 Ga0207640_10438451 Ga0207640_104384511 205
266 3300025986 Ga0207658_10065888 Ga0207658_100658883 205
267 3300026023 Ga0207677_10001784 Ga0207677_100017849 205
268 3300026023 Ga0207677_10004770 Ga0207677_100047704 205
269 3300026023 Ga0207677_10046029 Ga0207677_100460292 205
270 3300026023 Ga0207677_10061234 Ga0207677_100612342 205
271 3300026023 Ga0207677_10117690 Ga0207677_101176902 205
272 3300026035 Ga0207703_10047204 Ga0207703_100472041 205
273 3300026041 Ga0207639_10005779 Ga0207639_100057792 205
274 3300026041 Ga0207639_10018147 Ga0207639_100181474 205
275 3300026041 Ga0207639_10069909 Ga0207639_100699092 205
276 3300026067 Ga0207678_10076224 Ga0207678_100762244 205
277 3300026067 Ga0207678_10270462 Ga0207678_102704622 205
278 3300026088 Ga0207641_10063778 Ga0207641_100637783 205
279 3300026088 Ga0207641_10429034 Ga0207641_104290342 205
280 3300026089 Ga0207648_10010250 Ga0207648_100102506 205
281 3300026089 Ga0207648_10067801 Ga0207648_100678013 205
282 3300026089 Ga0207648_10071328 Ga0207648_100713281 205
283 3300026089 Ga0207648_10228999 Ga0207648_102289992 205
284 3300026089 Ga0207648_10363251 Ga0207648_103632512 205
285 3300026095 Ga0207676_10014205 Ga0207676_100142057 205
286 3300026095 Ga0207676_10128254 Ga0207676_101282543 205
287 3300026095 Ga0207676_10157442 Ga0207676_101574423 205
288 3300026116 Ga0207674_10003645 Ga0207674_100036455 205
289 3300026116 Ga0207674_10020593 Ga0207674_100205933 205
290 3300026118 Ga0207675_100032802 Ga0207675_1000328024 205
291 3300026118 Ga0207675_100122266 Ga0207675_1001222663 205
292 3300026118 Ga0207675_100137663 Ga0207675_1001376631 205
293 3300026118 Ga0207675_100543648 Ga0207675_1005436482 205
294 3300026121 Ga0207683_10077230 Ga0207683_100772303 205
295 3300026142 Ga0207698_10205497 Ga0207698_102054973 205
296 3300028379 Ga0268266_10036278 Ga0268266_100362785 205
297 3300028380 Ga0268265_10274133 Ga0268265_102741331 205
298 3300028380 Ga0268265_10470060 Ga0268265_104700602 205
299 3300028381 Ga0268264_10015517 Ga0268264_100155175 205
300 3300028381 Ga0268264_10364265 Ga0268264_103642652 205
301 3300028381 Ga0268264_10880004 Ga0268264_108800041 205
302 3300035092 Ga0373952_0090663 Ga0373952_0090663_12_632 205
303 3300035725 Ga0373947_0352750 Ga0373947_0352750_339_965 205
304 3300037418 Ga0395900_0786451 Ga0395900_0786451_179_796 205
305 3300041486 Ga0451807_2532153 Ga0451807_2532153_293_916 205
306 3300042127 Ga0450890_007223 Ga0450890_007223_174_881 205
307 3300042876 Ga0451577_0124682 Ga0451577_0124682_335_1000 205
308 3300044712 Ga0453684_0155487 Ga0453684_0155487_141_806 205
309 3300044712 Ga0453684_0273826 Ga0453684_0273826_1166_1786 205
310 3300046460 Ga0495638_0272172 Ga0495638_0272172_154_777 205
311 3300046472 Ga0495580_0249631 Ga0495580_0249631_465_1163 205
312 3300046516 Ga0495628_0579737 Ga0495628_0579737_123_740 205
313 3300046642 Ga0495634_0197006 Ga0495634_0197006_193_810 205
314 3300046663 Ga0495635_0184559 Ga0495635_0184559_731_1348 205
315 3300047320 Ga0495672_0045901 Ga0495672_0045901_722_1369 205
316 3300048913 Ga0496110_0318839 Ga0496110_0318839_387_1007 205
317 3300048913 Ga0496110_0561491 Ga0496110_0561491_375_995 205
318 3300049581 Ga0501047_0010114 Ga0501047_0010114_1537_2154 205
319 3300049661 Ga0501217_017481 Ga0501217_017481_327_944 205
320 3300049668 Ga0501233_033319 Ga0501233_033319_71_688 205
321 3300049682 Ga0501252_010336 Ga0501252_010336_415_1032 205
322 3300049704 Ga0501221_014469 Ga0501221_014469_611_1249 205
323 3300049742 Ga0501080_0194367 Ga0501080_0194367_485_1156 205
324 3300049744 Ga0501083_0129232 Ga0501083_0129232_356_991 205
325 3300049823 Ga0501044_0052083 Ga0501044_0052083_1223_1840 205
326 3300050493 nmdc:mga0k408_169163_c1 nmdc:mga0k408_169163_c1_304_933 205

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

18

189

0.86

PF13555

AAA_29

P-loop containing region of AAA domain

15

60

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7o17-assembly1.cif.gz_B abc transporter nosdfy e154q, atp-bound in lipid nanodisc 0.8754 1 186
7cag-assembly1.cif.gz_D mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state 0.8742 1 189
7e7q-assembly1.cif.gz_A cryo-em structure of human abca4 in atp-bound state 0.8738 3 188
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.8645 1 201
7w02-assembly1.cif.gz_A cryo-em structure of atp-bound abca3 0.8558 3 201
ID Description Score Start End Superfamily
af_Q0E8Q7_1247_1483_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.889 3 201 3.40.50.300
af_Q9VRG3_531_774_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8817 3 188 3.40.50.300
af_Q69XA0_568_896_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8795 3 203 3.40.50.300
af_A4HV32_726_961_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8762 3 188 3.40.50.300
af_A0A0R0KFM3_480_665_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8746 84 190 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1T5PCN8-F1-model_v4 ABC-type multidrug transport system, ATPase component 0.9975 1 205 GO:0005524
GO:0016887
AF-A0A1Z5SDF2-F1-model_v4 ABC transporter ATP-binding protein 0.9927 1 205 GO:0005524
GO:0016887
AF-A0A838F569-F1-model_v4 ATP-binding cassette domain-containing protein 0.991 1 205 GO:0005524
GO:0016887
AF-A0A4R3KWS2-F1-model_v4 ABC-type multidrug transport system ATPase subunit 0.9904 1 205 GO:0005524
GO:0016887
AF-A0A258WW00-F1-model_v4 ABC transporter ATP-binding protein 0.99 1 205 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
96.35 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map