F408446
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 326 | 172 | 325 | 205 |
Family's Representative Sequence
| Representative Sequence | 3300042127|Ga0450890_007223|Ga0450890_007223_174_881 |
| Length | 235 |
| Sequence | MKIILSDAGKRFNRDWIFRHFTYTFEQGGSYAITGANGSGKSTLLQVLSGSMHFNEGSLRYEVDSSASSRISQSFGFAQDKSEMSPSTSLRMSEKLEIPHEKIYQHVSICAPYLEVVEEMTLKEFLDFHHGFKPFLPTINTGSIITRLGLEKAADKQIRYYSSGMKQRVKLAQCIFSDTVLVLLDEPCTNLDTAGIELYHELVSEYCGNRLVIVSSNDKVEYNFCKEVISIGDYK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 6 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 7 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 8 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 52 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 53 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 57 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 82 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 83 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 84 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 131 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 132 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 133 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 134 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 135 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 136 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 137 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 138 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 139 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 140 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 141 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 142 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 143 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 144 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 160 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 161 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 162 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 164 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 165 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 166 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 167 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 171 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 172 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.69 |
| Metatranscriptomes | 0 |
| Isolates | 0.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.44 |
| Nodule | 0 |
| Rhizoplane | 1.84 |
| Rhizosphere | 91.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10000573 | 3300001989 | Bacteria | 13281 |
| 2 | JGI25153J46596_10070445 | 3300003215 | Bacteria | 907 |
| 3 | JGI25160J50197_1046320 | 3300003354 | Bacteria | 955 |
| 4 | Ga0055526_1015321 | 3300003771 | Bacteria | 3084 |
| 5 | Ga0055528_1002059 | 3300003790 | Bacteria | 11231 |
| 6 | Ga0055530_10001651 | 3300003791 | Bacteria | 15904 |
| 7 | Ga0065165_1000579 | 3300005262 | Bacteria | 54043 |
| 8 | Ga0070676_10000340 | 3300005328 | Bacteria | 21336 |
| 9 | Ga0070676_10002087 | 3300005328 | Bacteria | 10167 |
| 10 | Ga0070683_100001004 | 3300005329 | Bacteria | 21143 |
| 11 | Ga0070683_100003956 | 3300005329 | Bacteria | 12127 |
| 12 | Ga0070683_100167855 | 3300005329 | Bacteria | 2083 |
| 13 | Ga0070690_100002532 | 3300005330 | Bacteria | 9833 |
| 14 | Ga0070677_10233947 | 3300005333 | Bacteria | 904 |
| 15 | Ga0068869_100000814 | 3300005334 | Bacteria | 17836 |
| 16 | Ga0068869_100007258 | 3300005334 | Bacteria | 7063 |
| 17 | Ga0068869_100032099 | 3300005334 | Bacteria | 3698 |
| 18 | Ga0070666_10021276 | 3300005335 | Bacteria | 4202 |
| 19 | Ga0070666_10054077 | 3300005335 | Bacteria | 2709 |
| 20 | Ga0068868_100001169 | 3300005338 | Bacteria | 17976 |
| 21 | Ga0068868_100023129 | 3300005338 | Bacteria | 4699 |
| 22 | Ga0068868_100089709 | 3300005338 | Bacteria | 2475 |
| 23 | Ga0068868_100099304 | 3300005338 | Bacteria | 2355 |
| 24 | Ga0070689_100016816 | 3300005340 | Bacteria | 5361 |
| 25 | Ga0070689_100117422 | 3300005340 | Bacteria | 2122 |
| 26 | Ga0070689_100301831 | 3300005340 | Bacteria | 1333 |
| 27 | Ga0070661_100000922 | 3300005344 | Bacteria | 21063 |
| 28 | Ga0070661_100015002 | 3300005344 | Bacteria | 5467 |
| 29 | Ga0070661_100265160 | 3300005344 | Bacteria | 1329 |
| 30 | Ga0070668_100028200 | 3300005347 | Bacteria | 4263 |
| 31 | Ga0070669_100294059 | 3300005353 | Bacteria | 1304 |
| 32 | Ga0070675_100060472 | 3300005354 | Unclassified | 3128 |
| 33 | Ga0070675_100379486 | 3300005354 | Bacteria | 1258 |
| 34 | Ga0070675_100763768 | 3300005354 | Bacteria | 882 |
| 35 | Ga0070671_100012956 | 3300005355 | Bacteria | 6718 |
| 36 | Ga0070671_100070130 | 3300005355 | Unclassified | 2924 |
| 37 | Ga0070671_100119702 | 3300005355 | Bacteria | 2215 |
| 38 | Ga0070674_100016991 | 3300005356 | Bacteria | 4568 |
| 39 | Ga0070674_100051123 | 3300005356 | Bacteria | 2847 |
| 40 | Ga0070673_100009950 | 3300005364 | Bacteria | 6410 |
| 41 | Ga0070673_100043296 | 3300005364 | Bacteria | 3478 |
| 42 | Ga0070688_100015476 | 3300005365 | Bacteria | 4342 |
| 43 | Ga0070688_100153509 | 3300005365 | Bacteria | 1576 |
| 44 | Ga0070688_100286824 | 3300005365 | Bacteria | 1185 |
| 45 | Ga0070659_100107572 | 3300005366 | Bacteria | 2249 |
| 46 | Ga0070659_100416492 | 3300005366 | Bacteria | 1136 |
| 47 | Ga0070667_100090570 | 3300005367 | Bacteria | 2629 |
| 48 | Ga0070667_100320605 | 3300005367 | Unclassified | 1398 |
| 49 | Ga0070663_100373549 | 3300005455 | Bacteria | 1159 |
| 50 | Ga0070678_100008073 | 3300005456 | Bacteria | 6280 |
| 51 | Ga0070662_100015192 | 3300005457 | Bacteria | 5153 |
| 52 | Ga0070662_100134806 | 3300005457 | Bacteria | 1908 |
| 53 | Ga0068867_100026945 | 3300005459 | Bacteria | 4130 |
| 54 | Ga0068867_100048067 | 3300005459 | Bacteria | 3138 |
| 55 | Ga0068867_100068726 | 3300005459 | Bacteria | 2644 |
| 56 | Ga0070685_10018591 | 3300005466 | Bacteria | 3740 |
| 57 | Ga0070685_10097756 | 3300005466 | Bacteria | 1788 |
| 58 | Ga0070707_100223184 | 3300005468 | Unclassified | 1835 |
| 59 | Ga0070684_100000042 | 3300005535 | Bacteria | 89896 |
| 60 | Ga0070684_100001002 | 3300005535 | Bacteria | 20102 |
| 61 | Ga0070684_100149801 | 3300005535 | Bacteria | 2113 |
| 62 | Ga0068853_100025669 | 3300005539 | Bacteria | 4945 |
| 63 | Ga0068853_100035590 | 3300005539 | Bacteria | 4230 |
| 64 | Ga0068853_100579118 | 3300005539 | Bacteria | 1065 |
| 65 | Ga0070672_100096782 | 3300005543 | Bacteria | 2388 |
| 66 | Ga0070672_100224418 | 3300005543 | Bacteria | 1577 |
| 67 | Ga0070672_100591331 | 3300005543 | Bacteria | 966 |
| 68 | Ga0070686_100009323 | 3300005544 | Bacteria | 5513 |
| 69 | Ga0070686_100009493 | 3300005544 | Bacteria | 5471 |
| 70 | Ga0070665_100757822 | 3300005548 | Bacteria | 984 |
| 71 | Ga0070664_100000266 | 3300005564 | Bacteria | 37671 |
| 72 | Ga0070664_100004702 | 3300005564 | Bacteria | 10950 |
| 73 | Ga0070664_100011145 | 3300005564 | Bacteria | 7292 |
| 74 | Ga0070664_100018138 | 3300005564 | Bacteria | 5777 |
| 75 | Ga0070664_100098601 | 3300005564 | Bacteria | 2539 |
| 76 | Ga0070664_100204314 | 3300005564 | Bacteria | 1764 |
| 77 | Ga0068857_100006612 | 3300005577 | Bacteria | 9955 |
| 78 | Ga0068857_100013547 | 3300005577 | Bacteria | 7103 |
| 79 | Ga0068857_100349782 | 3300005577 | Bacteria | 1368 |
| 80 | Ga0068854_100007009 | 3300005578 | Bacteria | 7188 |
| 81 | Ga0068854_100155432 | 3300005578 | Unclassified | 1767 |
| 82 | Ga0068856_100148502 | 3300005614 | Bacteria | 2352 |
| 83 | Ga0070702_100026654 | 3300005615 | Bacteria | 3108 |
| 84 | Ga0068852_100044800 | 3300005616 | Bacteria | 3761 |
| 85 | Ga0068852_100060389 | 3300005616 | Bacteria | 3291 |
| 86 | Ga0068859_100015728 | 3300005617 | Bacteria | 7604 |
| 87 | Ga0068859_100016137 | 3300005617 | Bacteria | 7501 |
| 88 | Ga0068859_100049033 | 3300005617 | Bacteria | 4241 |
| 89 | Ga0068859_100055696 | 3300005617 | Bacteria | 3978 |
| 90 | Ga0068864_100015849 | 3300005618 | Bacteria | 6269 |
| 91 | Ga0068864_100018371 | 3300005618 | Bacteria | 5841 |
| 92 | Ga0068864_100124337 | 3300005618 | Bacteria | 2310 |
| 93 | Ga0068864_100467234 | 3300005618 | Bacteria | 1209 |
| 94 | Ga0068861_100032440 | 3300005719 | Bacteria | 3845 |
| 95 | Ga0068861_100354207 | 3300005719 | Bacteria | 1289 |
| 96 | Ga0068863_100015060 | 3300005841 | Bacteria | 7430 |
| 97 | Ga0068863_100329937 | 3300005841 | Bacteria | 1483 |
| 98 | Ga0068863_100656753 | 3300005841 | Bacteria | 1040 |
| 99 | Ga0068858_100011874 | 3300005842 | Bacteria | 8208 |
| 100 | Ga0068858_100520560 | 3300005842 | Bacteria | 1150 |
| 101 | Ga0068858_100559235 | 3300005842 | Bacteria | 1108 |
| 102 | Ga0068860_100033852 | 3300005843 | Bacteria | 4902 |
| 103 | Ga0068862_100120534 | 3300005844 | Bacteria | 2311 |
| 104 | Ga0068862_100184761 | 3300005844 | Bacteria | 1873 |
| 105 | Ga0081539_10092209 | 3300005985 | Bacteria | 1562 |
| 106 | Ga0075362_10267682 | 3300006177 | Bacteria | 843 |
| 107 | Ga0075366_10083987 | 3300006195 | Bacteria | 1903 |
| 108 | Ga0075366_10193737 | 3300006195 | Bacteria | 1235 |
| 109 | Ga0097621_100042428 | 3300006237 | Bacteria | 3664 |
| 110 | Ga0068871_100030374 | 3300006358 | Bacteria | 4254 |
| 111 | Ga0068871_100713030 | 3300006358 | Bacteria | 920 |
| 112 | Ga0068865_100092722 | 3300006881 | Unclassified | 2195 |
| 113 | Ga0068865_100122705 | 3300006881 | Bacteria | 1935 |
| 114 | Ga0068865_100197948 | 3300006881 | Bacteria | 1558 |
| 115 | Ga0097620_100015728 | 3300006931 | Bacteria | 7604 |
| 116 | Ga0097620_100016137 | 3300006931 | Bacteria | 7501 |
| 117 | Ga0097620_100049030 | 3300006931 | Bacteria | 4241 |
| 118 | Ga0097620_100055693 | 3300006931 | Bacteria | 3978 |
| 119 | Ga0111539_10181068 | 3300009094 | Bacteria | 2461 |
| 120 | Ga0105247_10001069 | 3300009101 | Bacteria | 20467 |
| 121 | Ga0114129_10060217 | 3300009147 | Bacteria | 5308 |
| 122 | Ga0105243_10445969 | 3300009148 | Bacteria | 1213 |
| 123 | Ga0105241_10030148 | 3300009174 | Unclassified | 4052 |
| 124 | Ga0105241_10240612 | 3300009174 | Unclassified | 1530 |
| 125 | Ga0105241_10806243 | 3300009174 | Unclassified | 865 |
| 126 | Ga0105242_10075649 | 3300009176 | Bacteria | 2804 |
| 127 | Ga0105248_10115064 | 3300009177 | Bacteria | 3034 |
| 128 | Ga0105249_10003825 | 3300009553 | Bacteria | 12985 |
| 129 | Ga0105249_10037314 | 3300009553 | Bacteria | 4410 |
| 130 | Ga0105249_10038530 | 3300009553 | Bacteria | 4338 |
| 131 | Ga0105249_10313965 | 3300009553 | Bacteria | 1577 |
| 132 | Ga0105246_10154089 | 3300011119 | Bacteria | 1743 |
| 133 | Ga0157373_10150619 | 3300013100 | Unclassified | 1636 |
| 134 | Ga0157373_10291482 | 3300013100 | Bacteria | 1157 |
| 135 | Ga0157373_10568873 | 3300013100 | Unclassified | 823 |
| 136 | Ga0157371_10052204 | 3300013102 | Unclassified | 2904 |
| 137 | Ga0157371_10059745 | 3300013102 | Bacteria | 2702 |
| 138 | Ga0157371_10133338 | 3300013102 | Bacteria | 1768 |
| 139 | Ga0157370_10010588 | 3300013104 | Bacteria | 9709 |
| 140 | Ga0157374_10003156 | 3300013296 | Bacteria | 13854 |
| 141 | Ga0157374_10014456 | 3300013296 | Bacteria | 6907 |
| 142 | Ga0157374_10024656 | 3300013296 | Bacteria | 5393 |
| 143 | Ga0157374_10673503 | 3300013296 | Bacteria | 1047 |
| 144 | Ga0157374_10757180 | 3300013296 | Bacteria | 986 |
| 145 | Ga0157378_10024568 | 3300013297 | Bacteria | 5305 |
| 146 | Ga0157378_10031632 | 3300013297 | Bacteria | 4674 |
| 147 | Ga0157378_10059700 | 3300013297 | Bacteria | 3403 |
| 148 | Ga0157378_10109452 | 3300013297 | Unclassified | 2531 |
| 149 | Ga0163162_10001770 | 3300013306 | Bacteria | 20242 |
| 150 | Ga0163162_10151282 | 3300013306 | Bacteria | 2439 |
| 151 | Ga0163162_10213544 | 3300013306 | Unclassified | 2059 |
| 152 | Ga0163162_10221084 | 3300013306 | Unclassified | 2024 |
| 153 | Ga0163162_10381994 | 3300013306 | Bacteria | 1542 |
| 154 | Ga0157372_10866014 | 3300013307 | Bacteria | 1049 |
| 155 | Ga0157375_10010150 | 3300013308 | Bacteria | 8284 |
| 156 | Ga0157375_10037870 | 3300013308 | Bacteria | 4626 |
| 157 | Ga0157375_10060743 | 3300013308 | Unclassified | 3750 |
| 158 | Ga0157375_10066049 | 3300013308 | Bacteria | 3609 |
| 159 | Ga0157375_10256300 | 3300013308 | Bacteria | 1911 |
| 160 | Ga0163163_10001563 | 3300014325 | Bacteria | 19320 |
| 161 | Ga0163163_10016374 | 3300014325 | Bacteria | 6886 |
| 162 | Ga0163163_10330688 | 3300014325 | Bacteria | 1578 |
| 163 | Ga0157380_10106943 | 3300014326 | Bacteria | 2342 |
| 164 | Ga0157380_10164932 | 3300014326 | Unclassified | 1929 |
| 165 | Ga0157377_10012497 | 3300014745 | Unclassified | 4272 |
| 166 | Ga0157377_10013045 | 3300014745 | Bacteria | 4196 |
| 167 | Ga0157377_10554978 | 3300014745 | Bacteria | 812 |
| 168 | Ga0157379_10027741 | 3300014968 | Bacteria | 5040 |
| 169 | Ga0157379_10040924 | 3300014968 | Bacteria | 4137 |
| 170 | Ga0157376_10014145 | 3300014969 | Bacteria | 5976 |
| 171 | Ga0157376_10433339 | 3300014969 | Bacteria | 1278 |
| 172 | Ga0163161_10003877 | 3300017792 | Bacteria | 10489 |
| 173 | Ga0163161_10074553 | 3300017792 | Bacteria | 2488 |
| 174 | Ga0163161_10158494 | 3300017792 | Unclassified | 1725 |
| 175 | Ga0163161_10196520 | 3300017792 | Bacteria | 1553 |
| 176 | Ga0209673_1000339 | 3300025273 | Bacteria | 85906 |
| 177 | Ga0209675_1031836 | 3300025291 | Bacteria | 1242 |
| 178 | Ga0209564_1003365 | 3300025295 | Bacteria | 11060 |
| 179 | Ga0209564_1055873 | 3300025295 | Bacteria | 921 |
| 180 | Ga0209758_1054840 | 3300025297 | Bacteria | 1359 |
| 181 | Ga0209758_1089619 | 3300025297 | Bacteria | 904 |
| 182 | Ga0209050_1000256 | 3300025298 | Bacteria | 114192 |
| 183 | Ga0207426_1002135 | 3300025302 | Bacteria | 13503 |
| 184 | Ga0209257_1000659 | 3300025304 | Bacteria | 54234 |
| 185 | Ga0207697_10022305 | 3300025315 | Bacteria | 2593 |
| 186 | Ga0207682_10055453 | 3300025893 | Bacteria | 1648 |
| 187 | Ga0207710_10007493 | 3300025900 | Bacteria | 4621 |
| 188 | Ga0207688_10009232 | 3300025901 | Bacteria | 5374 |
| 189 | Ga0207645_10004909 | 3300025907 | Bacteria | 9808 |
| 190 | Ga0207645_10012587 | 3300025907 | Bacteria | 5737 |
| 191 | Ga0207643_10369056 | 3300025908 | Bacteria | 903 |
| 192 | Ga0207654_10142540 | 3300025911 | Unclassified | 1530 |
| 193 | Ga0207649_10000644 | 3300025920 | Bacteria | 23288 |
| 194 | Ga0207646_10294582 | 3300025922 | Bacteria | 1466 |
| 195 | Ga0207650_10126841 | 3300025925 | Bacteria | 1993 |
| 196 | Ga0207650_10333146 | 3300025925 | Bacteria | 1245 |
| 197 | Ga0207659_10126369 | 3300025926 | Bacteria | 1967 |
| 198 | Ga0207659_10257909 | 3300025926 | Bacteria | 1417 |
| 199 | Ga0207644_10289286 | 3300025931 | Bacteria | 1317 |
| 200 | Ga0207690_10096309 | 3300025932 | Bacteria | 2104 |
| 201 | Ga0207690_10162545 | 3300025932 | Bacteria | 1666 |
| 202 | Ga0207690_10708819 | 3300025932 | Bacteria | 828 |
| 203 | Ga0207706_10004084 | 3300025933 | Bacteria | 13789 |
| 204 | Ga0207706_10021869 | 3300025933 | Bacteria | 5740 |
| 205 | Ga0207686_10060630 | 3300025934 | Bacteria | 2395 |
| 206 | Ga0207709_10353357 | 3300025935 | Bacteria | 1110 |
| 207 | Ga0207670_10030989 | 3300025936 | Bacteria | 3421 |
| 208 | Ga0207670_10144557 | 3300025936 | Bacteria | 1757 |
| 209 | Ga0207669_10003587 | 3300025937 | Bacteria | 6731 |
| 210 | Ga0207669_10020385 | 3300025937 | Bacteria | 3477 |
| 211 | Ga0207669_10400584 | 3300025937 | Bacteria | 1075 |
| 212 | Ga0207704_10348946 | 3300025938 | Bacteria | 1151 |
| 213 | Ga0207691_10003310 | 3300025940 | Bacteria | 15699 |
| 214 | Ga0207691_10328873 | 3300025940 | Bacteria | 1310 |
| 215 | Ga0207691_10358359 | 3300025940 | Bacteria | 1247 |
| 216 | Ga0207691_10534650 | 3300025940 | Bacteria | 994 |
| 217 | Ga0207689_10001306 | 3300025942 | Bacteria | 24017 |
| 218 | Ga0207689_10005140 | 3300025942 | Bacteria | 11766 |
| 219 | Ga0207689_10035878 | 3300025942 | Bacteria | 4116 |
| 220 | Ga0207689_10207479 | 3300025942 | Bacteria | 1618 |
| 221 | Ga0207689_10278425 | 3300025942 | Bacteria | 1385 |
| 222 | Ga0207661_10000781 | 3300025944 | Bacteria | 20721 |
| 223 | Ga0207661_10064009 | 3300025944 | Bacteria | 2980 |
| 224 | Ga0207679_10000733 | 3300025945 | Bacteria | 21828 |
| 225 | Ga0207679_10018467 | 3300025945 | Bacteria | 4673 |
| 226 | Ga0207679_10129179 | 3300025945 | Bacteria | 2024 |
| 227 | Ga0207679_10488288 | 3300025945 | Bacteria | 1097 |
| 228 | Ga0207651_10041219 | 3300025960 | Bacteria | 3063 |
| 229 | Ga0207651_10231939 | 3300025960 | Bacteria | 1499 |
| 230 | Ga0207712_10001115 | 3300025961 | Bacteria | 18744 |
| 231 | Ga0207712_10035792 | 3300025961 | Bacteria | 3376 |
| 232 | Ga0207712_10313002 | 3300025961 | Unclassified | 1293 |
| 233 | Ga0207668_10047206 | 3300025972 | Bacteria | 2947 |
| 234 | Ga0207640_10013226 | 3300025981 | Bacteria | 4725 |
| 235 | Ga0207640_10438451 | 3300025981 | Unclassified | 1073 |
| 236 | Ga0207658_10065888 | 3300025986 | Bacteria | 2723 |
| 237 | Ga0207677_10001784 | 3300026023 | Bacteria | 11359 |
| 238 | Ga0207677_10004770 | 3300026023 | Bacteria | 7314 |
| 239 | Ga0207677_10046029 | 3300026023 | Bacteria | 2918 |
| 240 | Ga0207677_10061234 | 3300026023 | Bacteria | 2605 |
| 241 | Ga0207677_10063631 | 3300026023 | Bacteria | 2565 |
| 242 | Ga0207677_10117690 | 3300026023 | Bacteria | 1992 |
| 243 | Ga0207703_10047204 | 3300026035 | Bacteria | 3472 |
| 244 | Ga0207639_10005779 | 3300026041 | Bacteria | 8376 |
| 245 | Ga0207639_10018147 | 3300026041 | Bacteria | 4996 |
| 246 | Ga0207639_10069909 | 3300026041 | Bacteria | 2741 |
| 247 | Ga0207678_10076224 | 3300026067 | Bacteria | 2873 |
| 248 | Ga0207678_10270462 | 3300026067 | Bacteria | 1457 |
| 249 | Ga0207641_10063778 | 3300026088 | Bacteria | 3148 |
| 250 | Ga0207641_10429034 | 3300026088 | Bacteria | 1274 |
| 251 | Ga0207641_10713384 | 3300026088 | Bacteria | 988 |
| 252 | Ga0207648_10010250 | 3300026089 | Bacteria | 8901 |
| 253 | Ga0207648_10067801 | 3300026089 | Bacteria | 3110 |
| 254 | Ga0207648_10071328 | 3300026089 | Bacteria | 3027 |
| 255 | Ga0207648_10228999 | 3300026089 | Bacteria | 1653 |
| 256 | Ga0207648_10363251 | 3300026089 | Bacteria | 1306 |
| 257 | Ga0207676_10014205 | 3300026095 | Bacteria | 5721 |
| 258 | Ga0207676_10128254 | 3300026095 | Bacteria | 2152 |
| 259 | Ga0207676_10157442 | 3300026095 | Bacteria | 1964 |
| 260 | Ga0207676_10415532 | 3300026095 | Bacteria | 1260 |
| 261 | Ga0207674_10003645 | 3300026116 | Bacteria | 18783 |
| 262 | Ga0207674_10020593 | 3300026116 | Bacteria | 7122 |
| 263 | Ga0207675_100032802 | 3300026118 | Bacteria | 4838 |
| 264 | Ga0207675_100067944 | 3300026118 | Bacteria | 3331 |
| 265 | Ga0207675_100122266 | 3300026118 | Bacteria | 2464 |
| 266 | Ga0207675_100137663 | 3300026118 | Bacteria | 2318 |
| 267 | Ga0207675_100543648 | 3300026118 | Bacteria | 1160 |
| 268 | Ga0207683_10007976 | 3300026121 | Bacteria | 9060 |
| 269 | Ga0207683_10077230 | 3300026121 | Bacteria | 2949 |
| 270 | Ga0207698_10205497 | 3300026142 | Bacteria | 1767 |
| 271 | Ga0207698_11186100 | 3300026142 | Bacteria | 777 |
| 272 | Ga0268266_10036278 | 3300028379 | Bacteria | 4196 |
| 273 | Ga0268265_10274133 | 3300028380 | Bacteria | 1506 |
| 274 | Ga0268265_10470060 | 3300028380 | Bacteria | 1179 |
| 275 | Ga0268264_10015517 | 3300028381 | Bacteria | 6245 |
| 276 | Ga0268264_10364265 | 3300028381 | Bacteria | 1380 |
| 277 | Ga0268264_10880004 | 3300028381 | Bacteria | 898 |
| 278 | Ga0307414_10355762 | 3300032004 | Unclassified | 1258 |
| 279 | Ga0373952_0090663 | 3300035092 | Bacteria | 793 |
| 280 | Ga0373955_0363909 | 3300035172 | Bacteria | 877 |
| 281 | Ga0373933_0119870 | 3300035724 | Bacteria | 1647 |
| 282 | Ga0373947_0352750 | 3300035725 | Bacteria | 987 |
| 283 | Ga0373947_0445525 | 3300035725 | Unclassified | 877 |
| 284 | Ga0395900_0786451 | 3300037418 | Unclassified | 880 |
| 285 | Ga0439439_0010419 | 3300041406 | Bacteria | 2222 |
| 286 | Ga0451807_0864671 | 3300041486 | Bacteria | 1522 |
| 287 | Ga0451807_2532153 | 3300041486 | Bacteria | 1272 |
| 288 | Ga0439431_0016596 | 3300041997 | Unclassified | 1725 |
| 289 | Ga0439433_0046463 | 3300041999 | Bacteria | 1018 |
| 290 | Ga0439445_0015799 | 3300042004 | Bacteria | 1853 |
| 291 | Ga0450890_007223 | 3300042127 | Bacteria | 1419 |
| 292 | Ga0451577_0124682 | 3300042876 | Unclassified | 2308 |
| 293 | Ga0453684_0155487 | 3300044712 | Bacteria | 2712 |
| 294 | Ga0453684_0273826 | 3300044712 | Bacteria | 1928 |
| 295 | Ga0495629_0162024 | 3300046459 | Bacteria | 1554 |
| 296 | Ga0495638_0272172 | 3300046460 | Unclassified | 924 |
| 297 | Ga0495650_0121227 | 3300046471 | Bacteria | 962 |
| 298 | Ga0495580_0249631 | 3300046472 | Bacteria | 1215 |
| 299 | Ga0495608_0022753 | 3300046511 | Bacteria | 4299 |
| 300 | Ga0495628_0579737 | 3300046516 | Bacteria | 803 |
| 301 | Ga0495586_0275845 | 3300046535 | Unclassified | 962 |
| 302 | Ga0495634_0197006 | 3300046642 | Bacteria | 1253 |
| 303 | Ga0495635_0184559 | 3300046663 | Bacteria | 1417 |
| 304 | Ga0495657_0203113 | 3300046675 | Unclassified | 1207 |
| 305 | Ga0495600_0072214 | 3300046809 | Bacteria | 2255 |
| 306 | Ga0495672_0007731 | 3300047320 | Bacteria | 8045 |
| 307 | Ga0495672_0045901 | 3300047320 | Bacteria | 2610 |
| 308 | Ga0495676_0138558 | 3300047321 | Unclassified | 1746 |
| 309 | Ga0495680_0073831 | 3300047322 | Bacteria | 2591 |
| 310 | Ga0495684_0444866 | 3300047471 | Bacteria | 902 |
| 311 | Ga0496105_0326585 | 3300048908 | Bacteria | 1229 |
| 312 | Ga0496110_0318839 | 3300048913 | Bacteria | 1416 |
| 313 | Ga0496110_0561491 | 3300048913 | Unclassified | 1037 |
| 314 | Ga0496114_0381942 | 3300048917 | Bacteria | 1247 |
| 315 | Ga0501047_0010114 | 3300049581 | Bacteria | 8918 |
| 316 | Ga0501217_017481 | 3300049661 | Bacteria | 1654 |
| 317 | Ga0501233_033319 | 3300049668 | Bacteria | 1176 |
| 318 | Ga0501252_010336 | 3300049682 | Bacteria | 1102 |
| 319 | Ga0501221_014469 | 3300049704 | Unclassified | 1467 |
| 320 | Ga0501080_0194367 | 3300049742 | Bacteria | 1864 |
| 321 | Ga0501083_0129232 | 3300049744 | Bacteria | 1656 |
| 322 | Ga0501044_0052083 | 3300049823 | Bacteria | 4220 |
| 323 | nmdc:mga0k408_169163_c1 | 3300050493 | Bacteria | 1303 |
| 324 | Ga0500628_060054 | 3300053129 | Bacteria | 926 |
| 325 | Ga0500611_000004 | 3300053727 | Bacteria | 253326 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013307 | Ga0157372_10866014 | Ga0157372_108660141 | 183 |
| 2 | 3300005355 | Ga0070671_100119702 | Ga0070671_1001197023 | 186 |
| 3 | 3300005614 | Ga0068856_100148502 | Ga0068856_1001485022 | 186 |
| 4 | 3300013297 | Ga0157378_10109452 | Ga0157378_101094523 | 186 |
| 5 | 3300025960 | Ga0207651_10041219 | Ga0207651_100412193 | 186 |
| 6 | 3300046471 | Ga0495650_0121227 | Ga0495650_0121227_194_814 | 186 |
| 7 | 3300048917 | Ga0496114_0381942 | Ga0496114_0381942_73_693 | 186 |
| 8 | 3300014326 | Ga0157380_10106943 | Ga0157380_101069434 | 187 |
| 9 | 3300041486 | Ga0451807_0864671 | Ga0451807_0864671_408_1028 | 187 |
| 10 | 3300047321 | Ga0495676_0138558 | Ga0495676_0138558_921_1541 | 187 |
| 11 | 3300005355 | Ga0070671_100070130 | Ga0070671_1000701303 | 188 |
| 12 | 3300026088 | Ga0207641_10713384 | Ga0207641_107133841 | 188 |
| 13 | 3300047320 | Ga0495672_0007731 | Ga0495672_0007731_3124_3777 | 188 |
| 14 | 3300005335 | Ga0070666_10021276 | Ga0070666_100212764 | 189 |
| 15 | 3300005338 | Ga0068868_100023129 | Ga0068868_1000231292 | 189 |
| 16 | 3300005340 | Ga0070689_100117422 | Ga0070689_1001174223 | 189 |
| 17 | 3300005354 | Ga0070675_100379486 | Ga0070675_1003794862 | 189 |
| 18 | 3300005365 | Ga0070688_100286824 | Ga0070688_1002868242 | 189 |
| 19 | 3300005456 | Ga0070678_100008073 | Ga0070678_1000080737 | 189 |
| 20 | 3300005457 | Ga0070662_100015192 | Ga0070662_1000151924 | 189 |
| 21 | 3300005459 | Ga0068867_100026945 | Ga0068867_1000269453 | 189 |
| 22 | 3300005564 | Ga0070664_100098601 | Ga0070664_1000986012 | 189 |
| 23 | 3300005578 | Ga0068854_100007009 | Ga0068854_1000070094 | 189 |
| 24 | 3300005616 | Ga0068852_100044800 | Ga0068852_1000448002 | 189 |
| 25 | 3300005618 | Ga0068864_100467234 | Ga0068864_1004672342 | 189 |
| 26 | 3300006237 | Ga0097621_100042428 | Ga0097621_1000424283 | 189 |
| 27 | 3300006358 | Ga0068871_100030374 | Ga0068871_1000303744 | 189 |
| 28 | 3300009174 | Ga0105241_10030148 | Ga0105241_100301482 | 189 |
| 29 | 3300009177 | Ga0105248_10115064 | Ga0105248_101150643 | 189 |
| 30 | 3300013102 | Ga0157371_10052204 | Ga0157371_100522042 | 189 |
| 31 | 3300013296 | Ga0157374_10014456 | Ga0157374_100144563 | 189 |
| 32 | 3300013306 | Ga0163162_10213544 | Ga0163162_102135442 | 189 |
| 33 | 3300013308 | Ga0157375_10010150 | Ga0157375_100101503 | 189 |
| 34 | 3300014968 | Ga0157379_10027741 | Ga0157379_100277412 | 189 |
| 35 | 3300014969 | Ga0157376_10014145 | Ga0157376_100141454 | 189 |
| 36 | 3300017792 | Ga0163161_10003877 | Ga0163161_100038773 | 189 |
| 37 | 3300025908 | Ga0207643_10369056 | Ga0207643_103690562 | 189 |
| 38 | 3300025911 | Ga0207654_10142540 | Ga0207654_101425402 | 189 |
| 39 | 3300025931 | Ga0207644_10289286 | Ga0207644_102892861 | 189 |
| 40 | 3300025933 | Ga0207706_10004084 | Ga0207706_100040849 | 189 |
| 41 | 3300025942 | Ga0207689_10278425 | Ga0207689_102784252 | 189 |
| 42 | 3300025945 | Ga0207679_10129179 | Ga0207679_101291792 | 189 |
| 43 | 3300025981 | Ga0207640_10013226 | Ga0207640_100132263 | 189 |
| 44 | 3300026023 | Ga0207677_10063631 | Ga0207677_100636313 | 189 |
| 45 | 3300026095 | Ga0207676_10415532 | Ga0207676_104155322 | 189 |
| 46 | 3300026118 | Ga0207675_100067944 | Ga0207675_1000679443 | 189 |
| 47 | 3300026121 | Ga0207683_10007976 | Ga0207683_1000797610 | 189 |
| 48 | 3300026142 | Ga0207698_11186100 | Ga0207698_111861002 | 189 |
| 49 | 3300041406 | Ga0439439_0010419 | Ga0439439_0010419_205_900 | 189 |
| 50 | 3300041997 | Ga0439431_0016596 | Ga0439431_0016596_866_1513 | 189 |
| 51 | 3300041999 | Ga0439433_0046463 | Ga0439433_0046463_118_765 | 189 |
| 52 | 3300048908 | Ga0496105_0326585 | Ga0496105_0326585_427_1047 | 189 |
| 53 | 3300005985 | Ga0081539_10092209 | Ga0081539_100922092 | 191 |
| 54 | 3300035172 | Ga0373955_0363909 | Ga0373955_0363909_222_842 | 191 |
| 55 | 3300035724 | Ga0373933_0119870 | Ga0373933_0119870_52_750 | 191 |
| 56 | 3300046511 | Ga0495608_0022753 | Ga0495608_0022753_2883_3503 | 191 |
| 57 | 3300046535 | Ga0495586_0275845 | Ga0495586_0275845_279_899 | 191 |
| 58 | 3300046809 | Ga0495600_0072214 | Ga0495600_0072214_738_1358 | 191 |
| 59 | 3300047322 | Ga0495680_0073831 | Ga0495680_0073831_64_684 | 191 |
| 60 | 3300005367 | Ga0070667_100320605 | Ga0070667_1003206052 | 192 |
| 61 | 3300032004 | Ga0307414_10355762 | Ga0307414_103557622 | 192 |
| 62 | 3300005356 | Ga0070674_100016991 | Ga0070674_1000169912 | 193 |
| 63 | 3300025937 | Ga0207669_10003587 | Ga0207669_100035876 | 193 |
| 64 | 3300042004 | Ga0439445_0015799 | Ga0439445_0015799_246_941 | 193 |
| 65 | 3300035725 | Ga0373947_0445525 | Ga0373947_0445525_57_677 | 195 |
| 66 | 3300046459 | Ga0495629_0162024 | Ga0495629_0162024_147_767 | 195 |
| 67 | 3300046675 | Ga0495657_0203113 | Ga0495657_0203113_81_701 | 195 |
| 68 | 3300047471 | Ga0495684_0444866 | Ga0495684_0444866_246_866 | 195 |
| 69 | 3300013102 | Ga0157371_10133338 | Ga0157371_101333382 | 198 |
| 70 | iso_pu_bacteria | 2881955468 | 2881957006 | 202 |
| 71 | 3300053727 | Ga0500611_000004 | Ga0500611_000004_90032_90649 | 203 |
| 72 | 3300014969 | Ga0157376_10433339 | Ga0157376_104333391 | 204 |
| 73 | 3300053129 | Ga0500628_060054 | Ga0500628_060054_64_678 | 204 |
| 74 | 3300001989 | JGI24739J22299_10000573 | JGI24739J22299_100005736 | 205 |
| 75 | 3300003215 | JGI25153J46596_10070445 | JGI25153J46596_100704451 | 205 |
| 76 | 3300003354 | JGI25160J50197_1046320 | JGI25160J50197_10463202 | 205 |
| 77 | 3300003771 | Ga0055526_1015321 | Ga0055526_10153214 | 205 |
| 78 | 3300003790 | Ga0055528_1002059 | Ga0055528_10020598 | 205 |
| 79 | 3300003791 | Ga0055530_10001651 | Ga0055530_100016517 | 205 |
| 80 | 3300005262 | Ga0065165_1000579 | Ga0065165_100057918 | 205 |
| 81 | 3300005328 | Ga0070676_10000340 | Ga0070676_1000034021 | 205 |
| 82 | 3300005328 | Ga0070676_10002087 | Ga0070676_100020877 | 205 |
| 83 | 3300005329 | Ga0070683_100001004 | Ga0070683_10000100415 | 205 |
| 84 | 3300005329 | Ga0070683_100003956 | Ga0070683_10000395610 | 205 |
| 85 | 3300005329 | Ga0070683_100167855 | Ga0070683_1001678553 | 205 |
| 86 | 3300005330 | Ga0070690_100002532 | Ga0070690_1000025329 | 205 |
| 87 | 3300005333 | Ga0070677_10233947 | Ga0070677_102339471 | 205 |
| 88 | 3300005334 | Ga0068869_100000814 | Ga0068869_10000081418 | 205 |
| 89 | 3300005334 | Ga0068869_100007258 | Ga0068869_1000072586 | 205 |
| 90 | 3300005334 | Ga0068869_100032099 | Ga0068869_1000320992 | 205 |
| 91 | 3300005335 | Ga0070666_10054077 | Ga0070666_100540773 | 205 |
| 92 | 3300005338 | Ga0068868_100001169 | Ga0068868_1000011692 | 205 |
| 93 | 3300005338 | Ga0068868_100089709 | Ga0068868_1000897092 | 205 |
| 94 | 3300005338 | Ga0068868_100099304 | Ga0068868_1000993042 | 205 |
| 95 | 3300005340 | Ga0070689_100016816 | Ga0070689_1000168163 | 205 |
| 96 | 3300005340 | Ga0070689_100301831 | Ga0070689_1003018311 | 205 |
| 97 | 3300005344 | Ga0070661_100000922 | Ga0070661_10000092217 | 205 |
| 98 | 3300005344 | Ga0070661_100015002 | Ga0070661_1000150023 | 205 |
| 99 | 3300005344 | Ga0070661_100265160 | Ga0070661_1002651602 | 205 |
| 100 | 3300005347 | Ga0070668_100028200 | Ga0070668_1000282003 | 205 |
| 101 | 3300005353 | Ga0070669_100294059 | Ga0070669_1002940592 | 205 |
| 102 | 3300005354 | Ga0070675_100060472 | Ga0070675_1000604722 | 205 |
| 103 | 3300005354 | Ga0070675_100763768 | Ga0070675_1007637682 | 205 |
| 104 | 3300005355 | Ga0070671_100012956 | Ga0070671_1000129564 | 205 |
| 105 | 3300005356 | Ga0070674_100051123 | Ga0070674_1000511232 | 205 |
| 106 | 3300005364 | Ga0070673_100009950 | Ga0070673_1000099506 | 205 |
| 107 | 3300005364 | Ga0070673_100043296 | Ga0070673_1000432963 | 205 |
| 108 | 3300005365 | Ga0070688_100015476 | Ga0070688_1000154764 | 205 |
| 109 | 3300005365 | Ga0070688_100153509 | Ga0070688_1001535092 | 205 |
| 110 | 3300005366 | Ga0070659_100107572 | Ga0070659_1001075722 | 205 |
| 111 | 3300005366 | Ga0070659_100416492 | Ga0070659_1004164921 | 205 |
| 112 | 3300005367 | Ga0070667_100090570 | Ga0070667_1000905703 | 205 |
| 113 | 3300005455 | Ga0070663_100373549 | Ga0070663_1003735491 | 205 |
| 114 | 3300005457 | Ga0070662_100134806 | Ga0070662_1001348063 | 205 |
| 115 | 3300005459 | Ga0068867_100048067 | Ga0068867_1000480671 | 205 |
| 116 | 3300005459 | Ga0068867_100068726 | Ga0068867_1000687263 | 205 |
| 117 | 3300005466 | Ga0070685_10018591 | Ga0070685_100185914 | 205 |
| 118 | 3300005466 | Ga0070685_10097756 | Ga0070685_100977561 | 205 |
| 119 | 3300005468 | Ga0070707_100223184 | Ga0070707_1002231843 | 205 |
| 120 | 3300005535 | Ga0070684_100000042 | Ga0070684_1000000428 | 205 |
| 121 | 3300005535 | Ga0070684_100001002 | Ga0070684_1000010022 | 205 |
| 122 | 3300005535 | Ga0070684_100149801 | Ga0070684_1001498013 | 205 |
| 123 | 3300005539 | Ga0068853_100025669 | Ga0068853_1000256692 | 205 |
| 124 | 3300005539 | Ga0068853_100035590 | Ga0068853_1000355904 | 205 |
| 125 | 3300005539 | Ga0068853_100579118 | Ga0068853_1005791182 | 205 |
| 126 | 3300005543 | Ga0070672_100096782 | Ga0070672_1000967822 | 205 |
| 127 | 3300005543 | Ga0070672_100224418 | Ga0070672_1002244182 | 205 |
| 128 | 3300005543 | Ga0070672_100591331 | Ga0070672_1005913312 | 205 |
| 129 | 3300005544 | Ga0070686_100009323 | Ga0070686_1000093232 | 205 |
| 130 | 3300005544 | Ga0070686_100009493 | Ga0070686_1000094933 | 205 |
| 131 | 3300005548 | Ga0070665_100757822 | Ga0070665_1007578222 | 205 |
| 132 | 3300005564 | Ga0070664_100000266 | Ga0070664_10000026636 | 205 |
| 133 | 3300005564 | Ga0070664_100004702 | Ga0070664_1000047022 | 205 |
| 134 | 3300005564 | Ga0070664_100011145 | Ga0070664_1000111456 | 205 |
| 135 | 3300005564 | Ga0070664_100018138 | Ga0070664_1000181387 | 205 |
| 136 | 3300005564 | Ga0070664_100204314 | Ga0070664_1002043142 | 205 |
| 137 | 3300005577 | Ga0068857_100006612 | Ga0068857_1000066125 | 205 |
| 138 | 3300005577 | Ga0068857_100013547 | Ga0068857_1000135473 | 205 |
| 139 | 3300005577 | Ga0068857_100349782 | Ga0068857_1003497822 | 205 |
| 140 | 3300005578 | Ga0068854_100155432 | Ga0068854_1001554321 | 205 |
| 141 | 3300005615 | Ga0070702_100026654 | Ga0070702_1000266542 | 205 |
| 142 | 3300005616 | Ga0068852_100060389 | Ga0068852_1000603893 | 205 |
| 143 | 3300005617 | Ga0068859_100015728 | Ga0068859_1000157288 | 205 |
| 144 | 3300005617 | Ga0068859_100016137 | Ga0068859_1000161379 | 205 |
| 145 | 3300005617 | Ga0068859_100049033 | Ga0068859_1000490332 | 205 |
| 146 | 3300005617 | Ga0068859_100055696 | Ga0068859_1000556962 | 205 |
| 147 | 3300005618 | Ga0068864_100015849 | Ga0068864_1000158497 | 205 |
| 148 | 3300005618 | Ga0068864_100018371 | Ga0068864_1000183713 | 205 |
| 149 | 3300005618 | Ga0068864_100124337 | Ga0068864_1001243372 | 205 |
| 150 | 3300005719 | Ga0068861_100032440 | Ga0068861_1000324404 | 205 |
| 151 | 3300005719 | Ga0068861_100354207 | Ga0068861_1003542072 | 205 |
| 152 | 3300005841 | Ga0068863_100015060 | Ga0068863_1000150602 | 205 |
| 153 | 3300005841 | Ga0068863_100329937 | Ga0068863_1003299372 | 205 |
| 154 | 3300005841 | Ga0068863_100656753 | Ga0068863_1006567532 | 205 |
| 155 | 3300005842 | Ga0068858_100011874 | Ga0068858_1000118748 | 205 |
| 156 | 3300005842 | Ga0068858_100520560 | Ga0068858_1005205602 | 205 |
| 157 | 3300005842 | Ga0068858_100559235 | Ga0068858_1005592352 | 205 |
| 158 | 3300005843 | Ga0068860_100033852 | Ga0068860_1000338523 | 205 |
| 159 | 3300005844 | Ga0068862_100120534 | Ga0068862_1001205342 | 205 |
| 160 | 3300005844 | Ga0068862_100184761 | Ga0068862_1001847612 | 205 |
| 161 | 3300006177 | Ga0075362_10267682 | Ga0075362_102676822 | 205 |
| 162 | 3300006195 | Ga0075366_10083987 | Ga0075366_100839872 | 205 |
| 163 | 3300006195 | Ga0075366_10193737 | Ga0075366_101937372 | 205 |
| 164 | 3300006358 | Ga0068871_100713030 | Ga0068871_1007130302 | 205 |
| 165 | 3300006881 | Ga0068865_100092722 | Ga0068865_1000927224 | 205 |
| 166 | 3300006881 | Ga0068865_100122705 | Ga0068865_1001227052 | 205 |
| 167 | 3300006881 | Ga0068865_100197948 | Ga0068865_1001979482 | 205 |
| 168 | 3300006931 | Ga0097620_100015728 | Ga0097620_1000157288 | 205 |
| 169 | 3300006931 | Ga0097620_100016137 | Ga0097620_1000161379 | 205 |
| 170 | 3300006931 | Ga0097620_100049030 | Ga0097620_1000490302 | 205 |
| 171 | 3300006931 | Ga0097620_100055693 | Ga0097620_1000556934 | 205 |
| 172 | 3300009094 | Ga0111539_10181068 | Ga0111539_101810682 | 205 |
| 173 | 3300009101 | Ga0105247_10001069 | Ga0105247_100010694 | 205 |
| 174 | 3300009147 | Ga0114129_10060217 | Ga0114129_100602171 | 205 |
| 175 | 3300009148 | Ga0105243_10445969 | Ga0105243_104459692 | 205 |
| 176 | 3300009174 | Ga0105241_10240612 | Ga0105241_102406122 | 205 |
| 177 | 3300009174 | Ga0105241_10806243 | Ga0105241_108062431 | 205 |
| 178 | 3300009176 | Ga0105242_10075649 | Ga0105242_100756492 | 205 |
| 179 | 3300009553 | Ga0105249_10003825 | Ga0105249_100038259 | 205 |
| 180 | 3300009553 | Ga0105249_10037314 | Ga0105249_100373144 | 205 |
| 181 | 3300009553 | Ga0105249_10038530 | Ga0105249_100385303 | 205 |
| 182 | 3300009553 | Ga0105249_10313965 | Ga0105249_103139652 | 205 |
| 183 | 3300011119 | Ga0105246_10154089 | Ga0105246_101540892 | 205 |
| 184 | 3300013100 | Ga0157373_10150619 | Ga0157373_101506192 | 205 |
| 185 | 3300013100 | Ga0157373_10291482 | Ga0157373_102914822 | 205 |
| 186 | 3300013100 | Ga0157373_10568873 | Ga0157373_105688731 | 205 |
| 187 | 3300013102 | Ga0157371_10059745 | Ga0157371_100597453 | 205 |
| 188 | 3300013104 | Ga0157370_10010588 | Ga0157370_100105882 | 205 |
| 189 | 3300013296 | Ga0157374_10003156 | Ga0157374_100031564 | 205 |
| 190 | 3300013296 | Ga0157374_10024656 | Ga0157374_100246564 | 205 |
| 191 | 3300013296 | Ga0157374_10673503 | Ga0157374_106735032 | 205 |
| 192 | 3300013296 | Ga0157374_10757180 | Ga0157374_107571801 | 205 |
| 193 | 3300013297 | Ga0157378_10024568 | Ga0157378_100245685 | 205 |
| 194 | 3300013297 | Ga0157378_10031632 | Ga0157378_100316325 | 205 |
| 195 | 3300013297 | Ga0157378_10059700 | Ga0157378_100597002 | 205 |
| 196 | 3300013306 | Ga0163162_10001770 | Ga0163162_1000177014 | 205 |
| 197 | 3300013306 | Ga0163162_10151282 | Ga0163162_101512823 | 205 |
| 198 | 3300013306 | Ga0163162_10221084 | Ga0163162_102210842 | 205 |
| 199 | 3300013306 | Ga0163162_10381994 | Ga0163162_103819941 | 205 |
| 200 | 3300013308 | Ga0157375_10037870 | Ga0157375_100378702 | 205 |
| 201 | 3300013308 | Ga0157375_10060743 | Ga0157375_100607435 | 205 |
| 202 | 3300013308 | Ga0157375_10066049 | Ga0157375_100660493 | 205 |
| 203 | 3300013308 | Ga0157375_10256300 | Ga0157375_102563002 | 205 |
| 204 | 3300014325 | Ga0163163_10001563 | Ga0163163_1000156317 | 205 |
| 205 | 3300014325 | Ga0163163_10016374 | Ga0163163_100163746 | 205 |
| 206 | 3300014325 | Ga0163163_10330688 | Ga0163163_103306882 | 205 |
| 207 | 3300014326 | Ga0157380_10164932 | Ga0157380_101649322 | 205 |
| 208 | 3300014745 | Ga0157377_10012497 | Ga0157377_100124972 | 205 |
| 209 | 3300014745 | Ga0157377_10013045 | Ga0157377_100130452 | 205 |
| 210 | 3300014745 | Ga0157377_10554978 | Ga0157377_105549782 | 205 |
| 211 | 3300014968 | Ga0157379_10040924 | Ga0157379_100409244 | 205 |
| 212 | 3300017792 | Ga0163161_10074553 | Ga0163161_100745533 | 205 |
| 213 | 3300017792 | Ga0163161_10158494 | Ga0163161_101584941 | 205 |
| 214 | 3300017792 | Ga0163161_10196520 | Ga0163161_101965202 | 205 |
| 215 | 3300025273 | Ga0209673_1000339 | Ga0209673_100033961 | 205 |
| 216 | 3300025291 | Ga0209675_1031836 | Ga0209675_10318362 | 205 |
| 217 | 3300025295 | Ga0209564_1003365 | Ga0209564_10033652 | 205 |
| 218 | 3300025295 | Ga0209564_1055873 | Ga0209564_10558732 | 205 |
| 219 | 3300025297 | Ga0209758_1054840 | Ga0209758_10548401 | 205 |
| 220 | 3300025297 | Ga0209758_1089619 | Ga0209758_10896192 | 205 |
| 221 | 3300025298 | Ga0209050_1000256 | Ga0209050_100025628 | 205 |
| 222 | 3300025302 | Ga0207426_1002135 | Ga0207426_10021354 | 205 |
| 223 | 3300025304 | Ga0209257_1000659 | Ga0209257_100065941 | 205 |
| 224 | 3300025315 | Ga0207697_10022305 | Ga0207697_100223052 | 205 |
| 225 | 3300025893 | Ga0207682_10055453 | Ga0207682_100554532 | 205 |
| 226 | 3300025900 | Ga0207710_10007493 | Ga0207710_100074934 | 205 |
| 227 | 3300025901 | Ga0207688_10009232 | Ga0207688_100092325 | 205 |
| 228 | 3300025907 | Ga0207645_10004909 | Ga0207645_100049094 | 205 |
| 229 | 3300025907 | Ga0207645_10012587 | Ga0207645_100125874 | 205 |
| 230 | 3300025920 | Ga0207649_10000644 | Ga0207649_1000064415 | 205 |
| 231 | 3300025922 | Ga0207646_10294582 | Ga0207646_102945822 | 205 |
| 232 | 3300025925 | Ga0207650_10126841 | Ga0207650_101268413 | 205 |
| 233 | 3300025925 | Ga0207650_10333146 | Ga0207650_103331462 | 205 |
| 234 | 3300025926 | Ga0207659_10126369 | Ga0207659_101263692 | 205 |
| 235 | 3300025926 | Ga0207659_10257909 | Ga0207659_102579092 | 205 |
| 236 | 3300025932 | Ga0207690_10096309 | Ga0207690_100963092 | 205 |
| 237 | 3300025932 | Ga0207690_10162545 | Ga0207690_101625453 | 205 |
| 238 | 3300025932 | Ga0207690_10708819 | Ga0207690_107088192 | 205 |
| 239 | 3300025933 | Ga0207706_10021869 | Ga0207706_100218693 | 205 |
| 240 | 3300025934 | Ga0207686_10060630 | Ga0207686_100606302 | 205 |
| 241 | 3300025935 | Ga0207709_10353357 | Ga0207709_103533572 | 205 |
| 242 | 3300025936 | Ga0207670_10030989 | Ga0207670_100309893 | 205 |
| 243 | 3300025936 | Ga0207670_10144557 | Ga0207670_101445572 | 205 |
| 244 | 3300025937 | Ga0207669_10020385 | Ga0207669_100203853 | 205 |
| 245 | 3300025937 | Ga0207669_10400584 | Ga0207669_104005842 | 205 |
| 246 | 3300025938 | Ga0207704_10348946 | Ga0207704_103489461 | 205 |
| 247 | 3300025940 | Ga0207691_10003310 | Ga0207691_1000331015 | 205 |
| 248 | 3300025940 | Ga0207691_10328873 | Ga0207691_103288731 | 205 |
| 249 | 3300025940 | Ga0207691_10358359 | Ga0207691_103583592 | 205 |
| 250 | 3300025940 | Ga0207691_10534650 | Ga0207691_105346502 | 205 |
| 251 | 3300025942 | Ga0207689_10001306 | Ga0207689_1000130625 | 205 |
| 252 | 3300025942 | Ga0207689_10005140 | Ga0207689_1000514010 | 205 |
| 253 | 3300025942 | Ga0207689_10035878 | Ga0207689_100358785 | 205 |
| 254 | 3300025942 | Ga0207689_10207479 | Ga0207689_102074792 | 205 |
| 255 | 3300025944 | Ga0207661_10000781 | Ga0207661_1000078114 | 205 |
| 256 | 3300025944 | Ga0207661_10064009 | Ga0207661_100640093 | 205 |
| 257 | 3300025945 | Ga0207679_10000733 | Ga0207679_1000073318 | 205 |
| 258 | 3300025945 | Ga0207679_10018467 | Ga0207679_100184673 | 205 |
| 259 | 3300025945 | Ga0207679_10488288 | Ga0207679_104882882 | 205 |
| 260 | 3300025960 | Ga0207651_10231939 | Ga0207651_102319392 | 205 |
| 261 | 3300025961 | Ga0207712_10001115 | Ga0207712_1000111514 | 205 |
| 262 | 3300025961 | Ga0207712_10035792 | Ga0207712_100357922 | 205 |
| 263 | 3300025961 | Ga0207712_10313002 | Ga0207712_103130022 | 205 |
| 264 | 3300025972 | Ga0207668_10047206 | Ga0207668_100472063 | 205 |
| 265 | 3300025981 | Ga0207640_10438451 | Ga0207640_104384511 | 205 |
| 266 | 3300025986 | Ga0207658_10065888 | Ga0207658_100658883 | 205 |
| 267 | 3300026023 | Ga0207677_10001784 | Ga0207677_100017849 | 205 |
| 268 | 3300026023 | Ga0207677_10004770 | Ga0207677_100047704 | 205 |
| 269 | 3300026023 | Ga0207677_10046029 | Ga0207677_100460292 | 205 |
| 270 | 3300026023 | Ga0207677_10061234 | Ga0207677_100612342 | 205 |
| 271 | 3300026023 | Ga0207677_10117690 | Ga0207677_101176902 | 205 |
| 272 | 3300026035 | Ga0207703_10047204 | Ga0207703_100472041 | 205 |
| 273 | 3300026041 | Ga0207639_10005779 | Ga0207639_100057792 | 205 |
| 274 | 3300026041 | Ga0207639_10018147 | Ga0207639_100181474 | 205 |
| 275 | 3300026041 | Ga0207639_10069909 | Ga0207639_100699092 | 205 |
| 276 | 3300026067 | Ga0207678_10076224 | Ga0207678_100762244 | 205 |
| 277 | 3300026067 | Ga0207678_10270462 | Ga0207678_102704622 | 205 |
| 278 | 3300026088 | Ga0207641_10063778 | Ga0207641_100637783 | 205 |
| 279 | 3300026088 | Ga0207641_10429034 | Ga0207641_104290342 | 205 |
| 280 | 3300026089 | Ga0207648_10010250 | Ga0207648_100102506 | 205 |
| 281 | 3300026089 | Ga0207648_10067801 | Ga0207648_100678013 | 205 |
| 282 | 3300026089 | Ga0207648_10071328 | Ga0207648_100713281 | 205 |
| 283 | 3300026089 | Ga0207648_10228999 | Ga0207648_102289992 | 205 |
| 284 | 3300026089 | Ga0207648_10363251 | Ga0207648_103632512 | 205 |
| 285 | 3300026095 | Ga0207676_10014205 | Ga0207676_100142057 | 205 |
| 286 | 3300026095 | Ga0207676_10128254 | Ga0207676_101282543 | 205 |
| 287 | 3300026095 | Ga0207676_10157442 | Ga0207676_101574423 | 205 |
| 288 | 3300026116 | Ga0207674_10003645 | Ga0207674_100036455 | 205 |
| 289 | 3300026116 | Ga0207674_10020593 | Ga0207674_100205933 | 205 |
| 290 | 3300026118 | Ga0207675_100032802 | Ga0207675_1000328024 | 205 |
| 291 | 3300026118 | Ga0207675_100122266 | Ga0207675_1001222663 | 205 |
| 292 | 3300026118 | Ga0207675_100137663 | Ga0207675_1001376631 | 205 |
| 293 | 3300026118 | Ga0207675_100543648 | Ga0207675_1005436482 | 205 |
| 294 | 3300026121 | Ga0207683_10077230 | Ga0207683_100772303 | 205 |
| 295 | 3300026142 | Ga0207698_10205497 | Ga0207698_102054973 | 205 |
| 296 | 3300028379 | Ga0268266_10036278 | Ga0268266_100362785 | 205 |
| 297 | 3300028380 | Ga0268265_10274133 | Ga0268265_102741331 | 205 |
| 298 | 3300028380 | Ga0268265_10470060 | Ga0268265_104700602 | 205 |
| 299 | 3300028381 | Ga0268264_10015517 | Ga0268264_100155175 | 205 |
| 300 | 3300028381 | Ga0268264_10364265 | Ga0268264_103642652 | 205 |
| 301 | 3300028381 | Ga0268264_10880004 | Ga0268264_108800041 | 205 |
| 302 | 3300035092 | Ga0373952_0090663 | Ga0373952_0090663_12_632 | 205 |
| 303 | 3300035725 | Ga0373947_0352750 | Ga0373947_0352750_339_965 | 205 |
| 304 | 3300037418 | Ga0395900_0786451 | Ga0395900_0786451_179_796 | 205 |
| 305 | 3300041486 | Ga0451807_2532153 | Ga0451807_2532153_293_916 | 205 |
| 306 | 3300042127 | Ga0450890_007223 | Ga0450890_007223_174_881 | 205 |
| 307 | 3300042876 | Ga0451577_0124682 | Ga0451577_0124682_335_1000 | 205 |
| 308 | 3300044712 | Ga0453684_0155487 | Ga0453684_0155487_141_806 | 205 |
| 309 | 3300044712 | Ga0453684_0273826 | Ga0453684_0273826_1166_1786 | 205 |
| 310 | 3300046460 | Ga0495638_0272172 | Ga0495638_0272172_154_777 | 205 |
| 311 | 3300046472 | Ga0495580_0249631 | Ga0495580_0249631_465_1163 | 205 |
| 312 | 3300046516 | Ga0495628_0579737 | Ga0495628_0579737_123_740 | 205 |
| 313 | 3300046642 | Ga0495634_0197006 | Ga0495634_0197006_193_810 | 205 |
| 314 | 3300046663 | Ga0495635_0184559 | Ga0495635_0184559_731_1348 | 205 |
| 315 | 3300047320 | Ga0495672_0045901 | Ga0495672_0045901_722_1369 | 205 |
| 316 | 3300048913 | Ga0496110_0318839 | Ga0496110_0318839_387_1007 | 205 |
| 317 | 3300048913 | Ga0496110_0561491 | Ga0496110_0561491_375_995 | 205 |
| 318 | 3300049581 | Ga0501047_0010114 | Ga0501047_0010114_1537_2154 | 205 |
| 319 | 3300049661 | Ga0501217_017481 | Ga0501217_017481_327_944 | 205 |
| 320 | 3300049668 | Ga0501233_033319 | Ga0501233_033319_71_688 | 205 |
| 321 | 3300049682 | Ga0501252_010336 | Ga0501252_010336_415_1032 | 205 |
| 322 | 3300049704 | Ga0501221_014469 | Ga0501221_014469_611_1249 | 205 |
| 323 | 3300049742 | Ga0501080_0194367 | Ga0501080_0194367_485_1156 | 205 |
| 324 | 3300049744 | Ga0501083_0129232 | Ga0501083_0129232_356_991 | 205 |
| 325 | 3300049823 | Ga0501044_0052083 | Ga0501044_0052083_1223_1840 | 205 |
| 326 | 3300050493 | nmdc:mga0k408_169163_c1 | nmdc:mga0k408_169163_c1_304_933 | 205 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7o17-assembly1.cif.gz_B | abc transporter nosdfy e154q, atp-bound in lipid nanodisc | 0.8754 | 1 | 186 |
| 7cag-assembly1.cif.gz_D | mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state | 0.8742 | 1 | 189 |
| 7e7q-assembly1.cif.gz_A | cryo-em structure of human abca4 in atp-bound state | 0.8738 | 3 | 188 |
| 4p33-assembly1.cif.gz_A | crystal structure of e. coli lptb-e163q in complex with atp-sodium | 0.8645 | 1 | 201 |
| 7w02-assembly1.cif.gz_A | cryo-em structure of atp-bound abca3 | 0.8558 | 3 | 201 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q0E8Q7_1247_1483_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.889 | 3 | 201 | 3.40.50.300 |
| af_Q9VRG3_531_774_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8817 | 3 | 188 | 3.40.50.300 |
| af_Q69XA0_568_896_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8795 | 3 | 203 | 3.40.50.300 |
| af_A4HV32_726_961_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8762 | 3 | 188 | 3.40.50.300 |
| af_A0A0R0KFM3_480_665_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8746 | 84 | 190 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1T5PCN8-F1-model_v4 | ABC-type multidrug transport system, ATPase component | 0.9975 | 1 | 205 |
GO:0005524
GO:0016887 |
| AF-A0A1Z5SDF2-F1-model_v4 | ABC transporter ATP-binding protein | 0.9927 | 1 | 205 |
GO:0005524
GO:0016887 |
| AF-A0A838F569-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.991 | 1 | 205 |
GO:0005524
GO:0016887 |
| AF-A0A4R3KWS2-F1-model_v4 | ABC-type multidrug transport system ATPase subunit | 0.9904 | 1 | 205 |
GO:0005524
GO:0016887 |
| AF-A0A258WW00-F1-model_v4 | ABC transporter ATP-binding protein | 0.99 | 1 | 205 |
GO:0005524
GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar