F408539

General Info

Members Datasets Scaffolds Average Seq Length
326 222 324 643

Family's Representative Sequence

Representative Sequence 3300049674|Ga0501242_000054|Ga0501242_000054_1492_3615
Length 707
Sequence MSAAVDGLIAGNTFFKVLKNRAKTALKRANAGPSTGPDQNFKQKKNLSQKSINIEYNTAPMKNAMLFVIILVLASTPLFGQNKKEAGNLVYENIPEIPDTLKERMNQYQNARGASPSSWNPSGESMLMTTRFAETSQIHLITAPLGARKQITFFQEPVGGGSFCPNPMYNGFTFTKDVGGNEFRQLFWFDLNTGKYEMISDGGRTQNSNVLWSEDGLRFIYVSTRRNKKDYDLYIAGMDAPKDAKPILEKSGSWAPVDWSVDQKKLLVKNSISANRSYLHILDLTSGSLTQVNPSEAEIAYGTGAWTADGRGFFYTSDENSEFKTLRYYEVASRKSTVITQGLTWDVDDVTINKSRTRIIFSVNENGIFKLYEMNTTTKKYAPLPGLPTALVVPVDFHPNGKVFSLIINSPKSPSDIYTYDLEAKSLTQWTESEVGGLDNSLFVTPTIIEYETFDKVNGKPRKIPAFYYKPRDAKGKVPVLIDIHGGPEAQSVPYFSAFRAFLTNELGIAIIEPNVRGSAGYGKSFLKLDNGYKREESVQDIGKLLDWIAKQPELDADRVAVTGGSYGGYMVLASMVHYNDRIRCGIDVVGISNFVTFLQNTEDYRKDLRRVEYGDERDPKMKEFLLSISPANQVDKITKPLFIIQGLNDPRVPASESEQMKNNLQAKEKEVWYLVAKDEGHGFRKKENVVFQQLAEVLFLKKFLLN

Samples

Sample ID Description Type Environment
1 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
2 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
78 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
114 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
115 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
118 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
119 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
120 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
121 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
129 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
130 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
131 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
132 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
133 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
137 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
142 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
143 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
144 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
145 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
146 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
147 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
148 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
149 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
153 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
161 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
162 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
163 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
164 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
165 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
166 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
169 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
170 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
171 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
172 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
173 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
174 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
175 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
176 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
191 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
200 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
201 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
202 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
203 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
204 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
219 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
220 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0
Isolates 0.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.23
Nodule 0
Rhizoplane 1.84
Rhizosphere 93.25
Stem 0
Stem Tuber 0
Unclassified 3.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10001354 3300003322 Bacteria 8211
2 Ga0070683_100000251 3300005329 Bacteria 36812
3 Ga0070683_100013321 3300005329 Bacteria 7168
4 Ga0068869_100002862 3300005334 Bacteria 10468
5 Ga0070666_10004487 3300005335 Bacteria 8508
6 Ga0070680_100028076 3300005336 Bacteria 4512
7 Ga0070682_100007191 3300005337 Bacteria 6272
8 Ga0070660_100036415 3300005339 Bacteria 3727
9 Ga0070689_100041279 3300005340 Bacteria 3541
10 Ga0070691_10001726 3300005341 Bacteria 9487
11 Ga0070661_100004789 3300005344 Bacteria 9319
12 Ga0070692_10031003 3300005345 Bacteria 2678
13 Ga0070669_100000010 3300005353 Bacteria 222186
14 Ga0070669_100088231 3300005353 Bacteria 2321
15 Ga0070675_100001707 3300005354 Bacteria 16213
16 Ga0070675_100002942 3300005354 Bacteria 12847
17 Ga0070675_100020999 3300005354 Bacteria 5215
18 Ga0070675_100038113 3300005354 Bacteria 3916
19 Ga0070674_100028962 3300005356 Bacteria 3641
20 Ga0070674_100106404 3300005356 Bacteria 2052
21 Ga0070709_10000016 3300005434 Bacteria 145008
22 Ga0070714_100002130 3300005435 Bacteria 14549
23 Ga0070714_100006017 3300005435 Bacteria 9314
24 Ga0070714_100012565 3300005435 Bacteria 6764
25 Ga0070713_100000150 3300005436 Bacteria 46676
26 Ga0070713_100006267 3300005436 Bacteria 8235
27 Ga0070713_100019634 3300005436 Bacteria 5167
28 Ga0070711_100032394 3300005439 Bacteria 3475
29 Ga0070705_100002721 3300005440 Bacteria 8830
30 Ga0070700_100015889 3300005441 Bacteria 4277
31 Ga0070708_100001196 3300005445 Bacteria 19971
32 Ga0070708_100015724 3300005445 Bacteria 6254
33 Ga0070708_100045507 3300005445 Bacteria 3866
34 Ga0070678_100054878 3300005456 Bacteria 2906
35 Ga0070681_10003650 3300005458 Bacteria 14445
36 Ga0070685_10024052 3300005466 Bacteria 3343
37 Ga0070706_100002065 3300005467 Bacteria 20516
38 Ga0070706_100003846 3300005467 Bacteria 14674
39 Ga0070707_100001029 3300005468 Bacteria 27615
40 Ga0070707_100017721 3300005468 Bacteria 6697
41 Ga0070698_100013662 3300005471 Bacteria 8597
42 Ga0070699_100106211 3300005518 Archaea 2463
43 Ga0070679_100014255 3300005530 Bacteria 7631
44 Ga0070679_100038983 3300005530 Bacteria 4724
45 Ga0070684_100004486 3300005535 Bacteria 10626
46 Ga0070697_100001550 3300005536 Bacteria 17485
47 Ga0070697_100008546 3300005536 Bacteria 7996
48 Ga0070697_100097392 3300005536 Bacteria 2441
49 Ga0068853_100009146 3300005539 Bacteria 7978
50 Ga0070672_100003690 3300005543 Bacteria 9954
51 Ga0070686_100030761 3300005544 Bacteria 3277
52 Ga0070686_100040155 3300005544 Bacteria 2918
53 Ga0070695_100038649 3300005545 Bacteria 3013
54 Ga0070665_100000866 3300005548 Bacteria 39221
55 Ga0070665_100005673 3300005548 Bacteria 12825
56 Ga0070665_100013625 3300005548 Bacteria 8178
57 Ga0070665_100022528 3300005548 Bacteria 6340
58 Ga0070704_100053345 3300005549 Bacteria 2857
59 Ga0068855_100038402 3300005563 Bacteria 5689
60 Ga0070664_100002268 3300005564 Bacteria 15470
61 Ga0068857_100000843 3300005577 Bacteria 22970
62 Ga0068857_100002115 3300005577 Bacteria 16151
63 Ga0068856_100000550 3300005614 Bacteria 41435
64 Ga0068856_100011226 3300005614 Bacteria 8695
65 Ga0068852_100015452 3300005616 Bacteria 5922
66 Ga0068859_100145485 3300005617 Bacteria 2445
67 Ga0068861_100013710 3300005719 Bacteria 5675
68 Ga0068861_100019556 3300005719 Bacteria 4837
69 Ga0068870_10012027 3300005840 Bacteria 4031
70 Ga0068860_100030698 3300005843 Bacteria 5168
71 Ga0068862_100030793 3300005844 Bacteria 4523
72 Ga0081455_10000460 3300005937 Bacteria 53331
73 Ga0081455_10029839 3300005937 Bacteria 4967
74 Ga0081539_10000007 3300005985 Bacteria 532790
75 Ga0081539_10029317 3300005985 Bacteria 3440
76 Ga0070717_10001192 3300006028 Bacteria 17611
77 Ga0070717_10011322 3300006028 Bacteria 6769
78 Ga0070716_100016602 3300006173 Bacteria 3803
79 Ga0068871_100012027 3300006358 Bacteria 6369
80 Ga0075428_100009804 3300006844 Bacteria 10645
81 Ga0075428_100028689 3300006844 Bacteria 6157
82 Ga0075430_100022199 3300006846 Bacteria 5396
83 Ga0075431_100013822 3300006847 Bacteria 8152
84 Ga0075433_10001014 3300006852 Bacteria 20003
85 Ga0075433_10017847 3300006852 Bacteria 5889
86 Ga0075433_10018418 3300006852 Bacteria 5804
87 Ga0075434_100069112 3300006871 Bacteria 3521
88 Ga0075429_100009852 3300006880 Bacteria 8285
89 Ga0075436_100000059 3300006914 Bacteria 65361
90 Ga0097620_100145481 3300006931 Bacteria 2445
91 Ga0105240_10008918 3300009093 Bacteria 14259
92 Ga0105240_10098944 3300009093 Bacteria 3551
93 Ga0111539_10000179 3300009094 Bacteria 73753
94 Ga0114129_10030825 3300009147 Bacteria 7584
95 Ga0114129_10307069 3300009147 Bacteria 2113
96 Ga0105243_10038248 3300009148 Bacteria 3736
97 Ga0105243_10059312 3300009148 Bacteria 3054
98 Ga0105241_10064590 3300009174 Bacteria 2826
99 Ga0105242_10013804 3300009176 Bacteria 6252
100 Ga0105238_10000329 3300009551 Bacteria 51763
101 Ga0105238_10002866 3300009551 Bacteria 17240
102 Ga0157370_10018961 3300013104 Bacteria 6917
103 Ga0157369_10003627 3300013105 Bacteria 18322
104 Ga0157369_10009135 3300013105 Bacteria 11343
105 Ga0157372_10011422 3300013307 Bacteria 9446
106 Ga0157375_10015049 3300013308 Bacteria 6919
107 Ga0163163_10019857 3300014325 Bacteria 6320
108 Ga0157380_10002572 3300014326 Bacteria 12262
109 Ga0157380_10006803 3300014326 Bacteria 8079
110 Ga0157380_10038265 3300014326 Bacteria 3723
111 Ga0157379_10023357 3300014968 Bacteria 5486
112 Ga0213874_10000079 3300021377 Bacteria 14789
113 Ga0213871_10003791 3300021441 Bacteria 2958
114 Ga0207699_10000027 3300025906 Bacteria 152171
115 Ga0207645_10019625 3300025907 Bacteria 4430
116 Ga0207643_10007353 3300025908 Bacteria 5909
117 Ga0207684_10003293 3300025910 Bacteria 15851
118 Ga0207684_10003377 3300025910 Bacteria 15639
119 Ga0207684_10028743 3300025910 Bacteria 4736
120 Ga0207693_10016764 3300025915 Bacteria 5850
121 Ga0207663_10003287 3300025916 Bacteria 7884
122 Ga0207660_10051014 3300025917 Bacteria 2940
123 Ga0207657_10017302 3300025919 Bacteria 6917
124 Ga0207652_10007934 3300025921 Bacteria 8524
125 Ga0207646_10000531 3300025922 Bacteria 50930
126 Ga0207646_10004155 3300025922 Bacteria 15885
127 Ga0207646_10017787 3300025922 Bacteria 6641
128 Ga0207681_10000011 3300025923 Bacteria 366878
129 Ga0207694_10002407 3300025924 Bacteria 15294
130 Ga0207694_10019134 3300025924 Bacteria 5176
131 Ga0207650_10091754 3300025925 Bacteria 2322
132 Ga0207700_10000354 3300025928 Bacteria 26833
133 Ga0207700_10082127 3300025928 Bacteria 2519
134 Ga0207664_10008579 3300025929 Bacteria 7141
135 Ga0207670_10010321 3300025936 Bacteria 5372
136 Ga0207669_10016148 3300025937 Bacteria 3786
137 Ga0207691_10109515 3300025940 Bacteria 2457
138 Ga0207711_10053851 3300025941 Bacteria 3451
139 Ga0207661_10006720 3300025944 Bacteria 8138
140 Ga0207661_10209996 3300025944 Bacteria 1715
141 Ga0207679_10033586 3300025945 Bacteria 3611
142 Ga0207679_10056534 3300025945 Bacteria 2897
143 Ga0207679_10082782 3300025945 Bacteria 2458
144 Ga0207667_10005028 3300025949 Bacteria 16166
145 Ga0207658_10045718 3300025986 Bacteria 3193
146 Ga0207639_10007205 3300026041 Bacteria 7577
147 Ga0207708_10019460 3300026075 Bacteria 5118
148 Ga0207708_10020021 3300026075 Bacteria 5045
149 Ga0207702_10004397 3300026078 Bacteria 12553
150 Ga0207702_10006694 3300026078 Bacteria 9901
151 Ga0207648_10019655 3300026089 Bacteria 6096
152 Ga0207648_10029147 3300026089 Bacteria 4895
153 Ga0207674_10000302 3300026116 Bacteria 62546
154 Ga0207674_10000643 3300026116 Bacteria 45442
155 Ga0207675_100012272 3300026118 Bacteria 8004
156 Ga0207675_100019708 3300026118 Bacteria 6295
157 Ga0207675_100074745 3300026118 Bacteria 3171
158 Ga0207683_10062469 3300026121 Bacteria 3280
159 Ga0207698_10011711 3300026142 Bacteria 5700
160 Ga0268266_10005944 3300028379 Bacteria 11283
161 Ga0268266_10084403 3300028379 Bacteria 2773
162 Ga0268265_10052489 3300028380 Bacteria 3084
163 Ga0268264_10041105 3300028381 Bacteria 3822
164 Ga0307515_10076934 3300028794 Bacteria 4415
165 Ga0307513_10004271 3300031456 Bacteria 19120
166 Ga0307513_10078202 3300031456 Bacteria 3422
167 Ga0307509_10028856 3300031507 Bacteria 6165
168 Ga0307408_100005287 3300031548 Bacteria 8649
169 Ga0307514_10046876 3300031649 Bacteria 3376
170 Ga0316575_10003850 3300031665 Bacteria 5236
171 Ga0316575_10015227 3300031665 Bacteria 2897
172 Ga0316579_10003413 3300031691 Bacteria 6188
173 Ga0316576_10007676 3300031727 Bacteria 6804
174 Ga0316576_10007702 3300031727 Bacteria 6793
175 Ga0316576_10020200 3300031727 Bacteria 4577
176 Ga0316576_10022290 3300031727 Bacteria 4396
177 Ga0316576_10078065 3300031727 Bacteria 2453
178 Ga0316578_10009534 3300031728 Bacteria 4995
179 Ga0307405_10017141 3300031731 Bacteria 3968
180 Ga0316577_10022583 3300031733 Bacteria 3494
181 Ga0307413_10004196 3300031824 Bacteria 6224
182 Ga0307413_10013320 3300031824 Bacteria 4130
183 Ga0307410_10002015 3300031852 Bacteria 9572
184 Ga0307406_10006982 3300031901 Bacteria 6253
185 Ga0307409_100001473 3300031995 Bacteria 11603
186 Ga0307409_100005994 3300031995 Bacteria 7085
187 Ga0307409_100009060 3300031995 Bacteria 6089
188 Ga0307409_100092435 3300031995 Bacteria 2483
189 Ga0316583_10008251 3300032133 Bacteria 3754
190 Ga0316585_10000687 3300032137 Bacteria 8441
191 Ga0316585_10005825 3300032137 Bacteria 3493
192 Ga0373929_0000002 3300035085 Bacteria 683932
193 Ga0373936_0004595 3300035113 Bacteria 5221
194 Ga0373956_0000070 3300035119 Bacteria 33906
195 Ga0316574_0001414 3300035398 Bacteria 11379
196 Ga0316574_0018317 3300035398 Bacteria 4113
197 Ga0316574_0025985 3300035398 Bacteria 3519
198 Ga0373935_0002575 3300035692 Bacteria 10420
199 Ga0373927_0000737 3300035695 Bacteria 24973
200 Ga0373927_0001550 3300035695 Bacteria 17254
201 Ga0316582_0011622 3300036647 Bacteria 4875
202 Ga0316582_0024965 3300036647 Bacteria 3582
203 Ga0316584_0002222 3300036712 Bacteria 12171
204 Ga0316584_0002783 3300036712 Bacteria 11192
205 Ga0373925_0000241 3300037068 Bacteria 57902
206 Ga0436361_0159329 3300039447 Bacteria 3031
207 Ga0436361_0878784 3300039447 Bacteria 4747
208 Ga0436363_0573202 3300039450 Bacteria 14386
209 Ga0436363_1278714 3300039450 Bacteria 8953
210 Ga0439453_0002951 3300041408 Bacteria 2402
211 Ga0451837_0414199 3300041494 Bacteria 2323
212 Ga0439433_0006665 3300041999 Bacteria 2490
213 Ga0439446_0000341 3300042156 Bacteria 8954
214 Ga0450908_003788 3300042184 Bacteria 2926
215 Ga0451577_0000179 3300042876 Bacteria 137689
216 Ga0451577_0001619 3300042876 Bacteria 29289
217 Ga0451577_0002051 3300042876 Bacteria 24933
218 Ga0451577_0004024 3300042876 Bacteria 15808
219 Ga0466969_0007555 3300044656 Bacteria 5776
220 Ga0466969_0017271 3300044656 Bacteria 3770
221 Ga0466972_0001962 3300044658 Bacteria 10082
222 Ga0453683_0002863 3300044673 Bacteria 13072
223 Ga0466966_0002096 3300044684 Bacteria 12947
224 Ga0466961_0062590 3300044693 Unclassified 2365
225 Ga0453684_0000033 3300044712 Bacteria 734012
226 Ga0466960_0011787 3300044901 Bacteria 3671
227 Ga0466959_0078895 3300045049 Bacteria 2374
228 Ga0451576_0000274 3300045051 Bacteria 126413
229 Ga0451576_0000364 3300045051 Bacteria 108727
230 Ga0466958_0078163 3300045836 Unclassified 2033
231 Ga0495590_0006561 3300046457 Bacteria 4538
232 Ga0495629_0000009 3300046459 Bacteria 348242
233 Ga0495580_0010643 3300046472 Bacteria 7148
234 Ga0495639_0000515 3300046475 Bacteria 18156
235 Ga0495616_0001435 3300046513 Bacteria 16584
236 Ga0495628_0034310 3300046516 Bacteria 4082
237 Ga0495666_0000785 3300046526 Bacteria 14681
238 Ga0495586_0000515 3300046535 Bacteria 22845
239 Ga0495645_0042656 3300046543 Bacteria 3308
240 Ga0495625_0011553 3300046660 Bacteria 7193
241 Ga0495625_0013059 3300046660 Bacteria 6695
242 Ga0495635_0001176 3300046663 Bacteria 17448
243 Ga0495658_0027348 3300046683 Bacteria 3068
244 Ga0495649_0001323 3300046694 Bacteria 18865
245 Ga0495600_0002771 3300046809 Bacteria 10161
246 Ga0495581_0053333 3300047315 Bacteria 2335
247 Ga0495672_0000327 3300047320 Bacteria 62456
248 Ga0495676_0047632 3300047321 Bacteria 3463
249 Ga0495680_0002515 3300047322 Bacteria 18745
250 Ga0495684_0005274 3300047471 Bacteria 10065
251 Ga0495626_0004380 3300048091 Bacteria 8687
252 Ga0496104_0021568 3300048907 Bacteria 5916
253 Ga0496108_0000740 3300048911 Bacteria 25411
254 Ga0496112_0001194 3300048915 Bacteria 19475
255 Ga0496112_0101245 3300048915 Bacteria 2851
256 Ga0496114_0000004 3300048917 Bacteria 591126
257 Ga0496114_0047068 3300048917 Bacteria 3586
258 Ga0501032_0003355 3300049569 Bacteria 12289
259 Ga0501032_0007346 3300049569 Bacteria 8054
260 Ga0501034_0003644 3300049571 Bacteria 17433
261 Ga0501034_0004045 3300049571 Bacteria 16451
262 Ga0501037_0015715 3300049573 Bacteria 5569
263 Ga0501038_0006042 3300049574 Bacteria 11209
264 Ga0501039_0007053 3300049575 Bacteria 8555
265 Ga0501039_0066603 3300049575 Bacteria 2796
266 Ga0501040_0000448 3300049576 Archaea 24508
267 Ga0501042_0009559 3300049578 Bacteria 6466
268 Ga0501042_0103779 3300049578 Bacteria 2045
269 Ga0501046_0019036 3300049580 Bacteria 5698
270 Ga0501047_0036319 3300049581 Bacteria 4762
271 Ga0501068_0001142 3300049584 Bacteria 14054
272 Ga0501069_0035537 3300049585 Bacteria 2746
273 Ga0501070_0026358 3300049586 Bacteria 4878
274 Ga0501070_0053634 3300049586 Bacteria 3343
275 Ga0501071_0002927 3300049587 Bacteria 10545
276 Ga0501071_0007549 3300049587 Bacteria 7156
277 Ga0501072_0017044 3300049588 Bacteria 5581
278 Ga0501073_0002858 3300049589 Bacteria 12930
279 Ga0501073_0005700 3300049589 Bacteria 9316
280 Ga0501073_0020555 3300049589 Bacteria 4760
281 Ga0501074_0002017 3300049590 Bacteria 13992
282 Ga0501074_0033226 3300049590 Bacteria 3738
283 Ga0501075_0004696 3300049591 Bacteria 9271
284 Ga0501076_0033454 3300049592 Bacteria 4013
285 Ga0501077_0000300 3300049593 Bacteria 29383
286 Ga0501077_0041534 3300049593 Bacteria 2927
287 Ga0501198_000010 3300049649 Bacteria 119733
288 Ga0501222_000009 3300049662 Bacteria 118560
289 Ga0501242_000054 3300049674 Bacteria 7111
290 Ga0501257_000896 3300049686 Bacteria 6015
291 Ga0501259_000963 3300049688 Bacteria 4767
292 Ga0501079_0034259 3300049741 Bacteria 3907
293 Ga0501079_0039763 3300049741 Bacteria 3628
294 Ga0501079_0060372 3300049741 Bacteria 2924
295 Ga0501080_0001882 3300049742 Bacteria 18048
296 Ga0501080_0001982 3300049742 Bacteria 17643
297 Ga0501080_0013178 3300049742 Bacteria 7596
298 Ga0501080_0030660 3300049742 Bacteria 5010
299 Ga0501080_0053917 3300049742 Bacteria 3745
300 Ga0501083_0009861 3300049744 Bacteria 6743
301 Ga0501035_0009034 3300049822 Bacteria 9269
302 Ga0501044_0111252 3300049823 Bacteria 2747
303 Ga0501044_0118654 3300049823 Bacteria 2648
304 nmdc:mga05p37_39726_c1 3300050507 Bacteria 5777
305 nmdc:mga09592_20495_c1 3300050508 Bacteria 5438
306 nmdc:mga09592_579_c1 3300050508 Bacteria 27730
307 nmdc:mga0qj67_23340_c1 3300050509 Bacteria 4758
308 nmdc:mga0n895_95706_c1 3300050512 Bacteria 2974
309 nmdc:mga0rr50_18617_c1 3300050513 Bacteria 4669
310 nmdc:mga08x19_104_c1 3300050514 Bacteria 74778
311 nmdc:mga0a205_12106_c1 3300050515 Bacteria 7972
312 nmdc:mga0a205_42494_c1 3300050515 Bacteria 4023
313 Ga0495619_0013247 3300053085 Bacteria 5198
314 Ga0500556_0008097 3300053104 Bacteria 3027
315 Ga0500568_0002663 3300053139 Bacteria 10360
316 Ga0500616_0000074 3300053153 Bacteria 222910
317 Ga0500616_0011672 3300053153 Bacteria 5176
318 Ga0501084_0007063 3300054114 Bacteria 9253
319 Ga0501084_0049747 3300054114 Bacteria 3508
320 Ga0501084_0066459 3300054114 Bacteria 3017
321 Ga0501082_0000288 3300060353 Bacteria 44400
322 Ga0501082_0003274 3300060353 Bacteria 14138
323 Ga0501082_0008739 3300060353 Bacteria 8730
324 Ga0501082_0018611 3300060353 Bacteria 5986

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045836 Ga0466958_0078163 Ga0466958_0078163_497_2002 466
2 3300025944 Ga0207661_10209996 Ga0207661_102099961 497
3 3300048907 Ga0496104_0021568 Ga0496104_0021568_11_1603 525
4 3300050515 nmdc:mga0a205_42494_c1 nmdc:mga0a205_42494_c1_2397_4004 527
5 3300049589 Ga0501073_0020555 Ga0501073_0020555_3031_4725 557
6 3300049575 Ga0501039_0007053 Ga0501039_0007053_6839_8545 566
7 3300044656 Ga0466969_0017271 Ga0466969_0017271_221_2056 567
8 3300044693 Ga0466961_0062590 Ga0466961_0062590_175_2010 567
9 3300039447 Ga0436361_0159329 Ga0436361_0159329_266_1999 568
10 3300025944 Ga0207661_10006720 Ga0207661_100067201 575
11 3300048091 Ga0495626_0004380 Ga0495626_0004380_87_2060 577
12 3300006844 Ga0075428_100009804 Ga0075428_1000098044 580
13 3300046543 Ga0495645_0042656 Ga0495645_0042656_1479_3245 580
14 3300005329 Ga0070683_100000251 Ga0070683_10000025125 581
15 3300005341 Ga0070691_10001726 Ga0070691_100017263 581
16 3300005435 Ga0070714_100002130 Ga0070714_1000021306 581
17 3300005436 Ga0070713_100000150 Ga0070713_10000015027 581
18 3300005535 Ga0070684_100004486 Ga0070684_1000044863 581
19 3300005577 Ga0068857_100000843 Ga0068857_1000008439 581
20 3300005614 Ga0068856_100000550 Ga0068856_10000055025 581
21 3300013105 Ga0157369_10003627 Ga0157369_100036279 581
22 3300025928 Ga0207700_10000354 Ga0207700_100003544 581
23 3300025945 Ga0207679_10082782 Ga0207679_100827821 581
24 3300026078 Ga0207702_10004397 Ga0207702_1000439711 581
25 3300026116 Ga0207674_10000643 Ga0207674_1000064311 581
26 3300006847 Ga0075431_100013822 Ga0075431_1000138222 582
27 3300006880 Ga0075429_100009852 Ga0075429_1000098525 582
28 3300009147 Ga0114129_10307069 Ga0114129_103070691 582
29 3300050508 nmdc:mga09592_20495_c1 nmdc:mga09592_20495_c1_2745_4715 582
30 3300049576 Ga0501040_0000448 Ga0501040_0000448_13252_15048 583
31 3300044658 Ga0466972_0001962 Ga0466972_0001962_54_1853 584
32 3300005468 Ga0070707_100017721 Ga0070707_1000177212 585
33 3300025922 Ga0207646_10017787 Ga0207646_100177874 585
34 3300006852 Ga0075433_10017847 Ga0075433_100178475 586
35 3300048911 Ga0496108_0000740 Ga0496108_0000740_5643_7454 586
36 3300050515 nmdc:mga0a205_12106_c1 nmdc:mga0a205_12106_c1_2646_4457 586
37 3300021377 Ga0213874_10000079 Ga0213874_100000792 588
38 3300031727 Ga0316576_10007676 Ga0316576_100076762 588
39 3300035119 Ga0373956_0000070 Ga0373956_0000070_19629_21470 588
40 3300039450 Ga0436363_0573202 Ga0436363_0573202_10967_12799 588
41 3300048915 Ga0496112_0101245 Ga0496112_0101245_816_2780 588
42 3300005329 Ga0070683_100013321 Ga0070683_1000133212 589
43 3300005445 Ga0070708_100001196 Ga0070708_10000119611 589
44 3300005445 Ga0070708_100045507 Ga0070708_1000455071 589
45 3300005467 Ga0070706_100003846 Ga0070706_10000384610 589
46 3300005468 Ga0070707_100001029 Ga0070707_1000010297 589
47 3300005536 Ga0070697_100001550 Ga0070697_1000015501 589
48 3300005536 Ga0070697_100008546 Ga0070697_1000085462 589
49 3300006028 Ga0070717_10011322 Ga0070717_100113224 589
50 3300025910 Ga0207684_10003377 Ga0207684_100033779 589
51 3300025910 Ga0207684_10028743 Ga0207684_100287432 589
52 3300025922 Ga0207646_10000531 Ga0207646_1000053147 589
53 3300025922 Ga0207646_10004155 Ga0207646_1000415510 589
54 3300031665 Ga0316575_10003850 Ga0316575_100038502 589
55 3300031691 Ga0316579_10003413 Ga0316579_100034133 589
56 3300031727 Ga0316576_10007702 Ga0316576_100077024 589
57 3300032133 Ga0316583_10008251 Ga0316583_100082512 589
58 3300032137 Ga0316585_10000687 Ga0316585_100006875 589
59 3300035398 Ga0316574_0001414 Ga0316574_0001414_9407_11257 589
60 3300036647 Ga0316582_0011622 Ga0316582_0011622_2339_4189 589
61 3300036712 Ga0316584_0002783 Ga0316584_0002783_6615_8465 589
62 3300035695 Ga0373927_0000737 Ga0373927_0000737_4463_6319 590
63 3300005530 Ga0070679_100038983 Ga0070679_1000389831 591
64 3300049589 Ga0501073_0002858 Ga0501073_0002858_736_2697 591
65 3300049590 Ga0501074_0033226 Ga0501074_0033226_1669_3630 591
66 3300049593 Ga0501077_0041534 Ga0501077_0041534_358_2319 591
67 3300049741 Ga0501079_0034259 Ga0501079_0034259_482_2443 591
68 3300049742 Ga0501080_0001882 Ga0501080_0001882_3656_5617 591
69 3300054114 Ga0501084_0007063 Ga0501084_0007063_235_2196 591
70 3300060353 Ga0501082_0008739 Ga0501082_0008739_4139_6100 591
71 3300049578 Ga0501042_0103779 Ga0501042_0103779_207_2003 592
72 3300047320 Ga0495672_0000327 Ga0495672_0000327_32260_34188 593
73 3300006871 Ga0075434_100069112 Ga0075434_1000691122 596
74 3300031727 Ga0316576_10022290 Ga0316576_100222903 601
75 3300005518 Ga0070699_100106211 Ga0070699_1001062111 603
76 3300005436 Ga0070713_100006267 Ga0070713_1000062674 605
77 3300005353 Ga0070669_100000010 Ga0070669_100000010166 606
78 3300025923 Ga0207681_10000011 Ga0207681_1000001118 606
79 3300006846 Ga0075430_100022199 Ga0075430_1000221996 610
80 3300006852 Ga0075433_10001014 Ga0075433_100010144 610
81 3300006852 Ga0075433_10018418 Ga0075433_100184182 610
82 3300050509 nmdc:mga0qj67_23340_c1 nmdc:mga0qj67_23340_c1_609_2486 610
83 3300044673 Ga0453683_0002863 Ga0453683_0002863_7377_9365 612
84 3300044901 Ga0466960_0011787 Ga0466960_0011787_762_2627 612
85 3300005467 Ga0070706_100002065 Ga0070706_1000020656 613
86 3300021441 Ga0213871_10003791 Ga0213871_100037912 613
87 3300035695 Ga0373927_0001550 Ga0373927_0001550_2087_4060 614
88 3300005548 Ga0070665_100000866 Ga0070665_10000086611 616
89 3300028379 Ga0268266_10005944 Ga0268266_1000594411 616
90 3300005548 Ga0070665_100013625 Ga0070665_1000136258 619
91 3300026118 Ga0207675_100074745 Ga0207675_1000747452 619
92 3300045051 Ga0451576_0000274 Ga0451576_0000274_120651_122618 619
93 3300050513 nmdc:mga0rr50_18617_c1 nmdc:mga0rr50_18617_c1_59_2071 619
94 3300005337 Ga0070682_100007191 Ga0070682_1000071917 620
95 3300005354 Ga0070675_100001707 Ga0070675_10000170710 620
96 3300005356 Ga0070674_100106404 Ga0070674_1001064041 620
97 3300005434 Ga0070709_10000016 Ga0070709_1000001650 620
98 3300005456 Ga0070678_100054878 Ga0070678_1000548782 620
99 3300005543 Ga0070672_100003690 Ga0070672_1000036907 620
100 3300005840 Ga0068870_10012027 Ga0068870_100120273 620
101 3300006028 Ga0070717_10001192 Ga0070717_100011925 620
102 3300025906 Ga0207699_10000027 Ga0207699_1000002773 620
103 3300025907 Ga0207645_10019625 Ga0207645_100196252 620
104 3300025908 Ga0207643_10007353 Ga0207643_100073536 620
105 3300025925 Ga0207650_10091754 Ga0207650_100917542 620
106 3300025937 Ga0207669_10016148 Ga0207669_100161482 620
107 3300026075 Ga0207708_10019460 Ga0207708_100194604 620
108 3300026089 Ga0207648_10019655 Ga0207648_100196556 620
109 3300026121 Ga0207683_10062469 Ga0207683_100624691 620
110 3300031507 Ga0307509_10028856 Ga0307509_100288563 620
111 3300031649 Ga0307514_10046876 Ga0307514_100468762 620
112 3300031995 Ga0307409_100009060 Ga0307409_1000090602 620
113 3300046694 Ga0495649_0001323 Ga0495649_0001323_9760_11667 620
114 3300005435 Ga0070714_100012565 Ga0070714_1000125651 621
115 3300009148 Ga0105243_10038248 Ga0105243_100382483 621
116 3300028380 Ga0268265_10052489 Ga0268265_100524892 621
117 3300048917 Ga0496114_0047068 Ga0496114_0047068_40_2079 621
118 3300005353 Ga0070669_100088231 Ga0070669_1000882311 622
119 3300005354 Ga0070675_100020999 Ga0070675_1000209995 622
120 3300005545 Ga0070695_100038649 Ga0070695_1000386492 622
121 3300005617 Ga0068859_100145485 Ga0068859_1001454852 622
122 3300005844 Ga0068862_100030793 Ga0068862_1000307931 622
123 3300006931 Ga0097620_100145481 Ga0097620_1001454812 622
124 3300025940 Ga0207691_10109515 Ga0207691_101095152 622
125 3300026089 Ga0207648_10029147 Ga0207648_100291474 622
126 3300028794 Ga0307515_10076934 Ga0307515_100769345 622
127 3300031456 Ga0307513_10004271 Ga0307513_100042714 622
128 iso_pu_bacteria 2687453257 2688070267 622
129 3300048915 Ga0496112_0001194 Ga0496112_0001194_12080_14059 623
130 3300028381 Ga0268264_10041105 Ga0268264_100411052 624
131 3300039447 Ga0436361_0878784 Ga0436361_0878784_207_2135 624
132 3300025910 Ga0207684_10003293 Ga0207684_1000329313 625
133 3300005439 Ga0070711_100032394 Ga0070711_1000323943 626
134 3300009551 Ga0105238_10000329 Ga0105238_1000032921 626
135 3300025924 Ga0207694_10002407 Ga0207694_100024072 626
136 3300049571 Ga0501034_0003644 Ga0501034_0003644_4599_6551 626
137 3300005441 Ga0070700_100015889 Ga0070700_1000158894 627
138 3300005445 Ga0070708_100015724 Ga0070708_1000157242 627
139 3300005536 Ga0070697_100097392 Ga0070697_1000973922 627
140 3300005719 Ga0068861_100013710 Ga0068861_1000137104 627
141 3300006844 Ga0075428_100028689 Ga0075428_1000286895 627
142 3300009147 Ga0114129_10030825 Ga0114129_100308255 627
143 3300025945 Ga0207679_10033586 Ga0207679_100335863 627
144 3300026075 Ga0207708_10020021 Ga0207708_100200213 627
145 3300026118 Ga0207675_100019708 Ga0207675_1000197084 627
146 3300046472 Ga0495580_0010643 Ga0495580_0010643_3930_5873 627
147 3300005336 Ga0070680_100028076 Ga0070680_1000280762 628
148 3300005339 Ga0070660_100036415 Ga0070660_1000364152 628
149 3300005344 Ga0070661_100004789 Ga0070661_1000047894 628
150 3300005356 Ga0070674_100028962 Ga0070674_1000289622 628
151 3300005435 Ga0070714_100006017 Ga0070714_1000060171 628
152 3300005458 Ga0070681_10003650 Ga0070681_100036503 628
153 3300005539 Ga0068853_100009146 Ga0068853_1000091462 628
154 3300005563 Ga0068855_100038402 Ga0068855_1000384024 628
155 3300005564 Ga0070664_100002268 Ga0070664_1000022685 628
156 3300005577 Ga0068857_100002115 Ga0068857_1000021154 628
157 3300005614 Ga0068856_100011226 Ga0068856_1000112264 628
158 3300005616 Ga0068852_100015452 Ga0068852_1000154524 628
159 3300009093 Ga0105240_10008918 Ga0105240_1000891811 628
160 3300009174 Ga0105241_10064590 Ga0105241_100645901 628
161 3300009551 Ga0105238_10002866 Ga0105238_100028667 628
162 3300013104 Ga0157370_10018961 Ga0157370_100189615 628
163 3300013105 Ga0157369_10009135 Ga0157369_100091358 628
164 3300013307 Ga0157372_10011422 Ga0157372_100114225 628
165 3300014326 Ga0157380_10038265 Ga0157380_100382654 628
166 3300025917 Ga0207660_10051014 Ga0207660_100510142 628
167 3300025919 Ga0207657_10017302 Ga0207657_100173023 628
168 3300025921 Ga0207652_10007934 Ga0207652_100079346 628
169 3300025924 Ga0207694_10019134 Ga0207694_100191343 628
170 3300025929 Ga0207664_10008579 Ga0207664_100085792 628
171 3300025949 Ga0207667_10005028 Ga0207667_100050286 628
172 3300026041 Ga0207639_10007205 Ga0207639_100072052 628
173 3300026078 Ga0207702_10006694 Ga0207702_100066946 628
174 3300026116 Ga0207674_10000302 Ga0207674_1000030239 628
175 3300026142 Ga0207698_10011711 Ga0207698_100117113 628
176 3300042876 Ga0451577_0002051 Ga0451577_0002051_21815_23857 628
177 3300045051 Ga0451576_0000364 Ga0451576_0000364_23105_25147 628
178 3300049744 Ga0501083_0009861 Ga0501083_0009861_2111_4117 628
179 3300005334 Ga0068869_100002862 Ga0068869_1000028629 629
180 3300005340 Ga0070689_100041279 Ga0070689_1000412793 629
181 3300005345 Ga0070692_10031003 Ga0070692_100310032 629
182 3300005354 Ga0070675_100002942 Ga0070675_1000029425 629
183 3300005436 Ga0070713_100019634 Ga0070713_1000196343 629
184 3300005440 Ga0070705_100002721 Ga0070705_1000027214 629
185 3300005471 Ga0070698_100013662 Ga0070698_1000136625 629
186 3300005544 Ga0070686_100040155 Ga0070686_1000401552 629
187 3300005843 Ga0068860_100030698 Ga0068860_1000306983 629
188 3300005937 Ga0081455_10029839 Ga0081455_100298394 629
189 3300006358 Ga0068871_100012027 Ga0068871_1000120277 629
190 3300006914 Ga0075436_100000059 Ga0075436_10000005935 629
191 3300025916 Ga0207663_10003287 Ga0207663_100032874 629
192 3300025928 Ga0207700_10082127 Ga0207700_100821272 629
193 3300025936 Ga0207670_10010321 Ga0207670_100103213 629
194 3300026118 Ga0207675_100012272 Ga0207675_1000122728 629
195 3300031824 Ga0307413_10013320 Ga0307413_100133202 629
196 3300042876 Ga0451577_0001619 Ga0451577_0001619_18854_20854 629
197 3300046516 Ga0495628_0034310 Ga0495628_0034310_1683_3629 629
198 3300049575 Ga0501039_0066603 Ga0501039_0066603_18_1985 629
199 3300050514 nmdc:mga08x19_104_c1 nmdc:mga08x19_104_c1_12139_14160 629
200 3300005466 Ga0070685_10024052 Ga0070685_100240523 630
201 3300005719 Ga0068861_100019556 Ga0068861_1000195566 630
202 3300005937 Ga0081455_10000460 Ga0081455_1000046028 630
203 3300005985 Ga0081539_10029317 Ga0081539_100293173 630
204 3300009093 Ga0105240_10098944 Ga0105240_100989442 630
205 3300009094 Ga0111539_10000179 Ga0111539_1000017952 630
206 3300009148 Ga0105243_10059312 Ga0105243_100593122 630
207 3300009176 Ga0105242_10013804 Ga0105242_100138046 630
208 3300013308 Ga0157375_10015049 Ga0157375_100150494 630
209 3300014325 Ga0163163_10019857 Ga0163163_100198575 630
210 3300014326 Ga0157380_10006803 Ga0157380_100068033 630
211 3300014968 Ga0157379_10023357 Ga0157379_100233574 630
212 3300025941 Ga0207711_10053851 Ga0207711_100538512 630
213 3300025945 Ga0207679_10056534 Ga0207679_100565342 630
214 3300031548 Ga0307408_100005287 Ga0307408_1000052873 630
215 3300031731 Ga0307405_10017141 Ga0307405_100171412 630
216 3300031824 Ga0307413_10004196 Ga0307413_100041965 630
217 3300031852 Ga0307410_10002015 Ga0307410_100020154 630
218 3300031901 Ga0307406_10006982 Ga0307406_100069822 630
219 3300031995 Ga0307409_100001473 Ga0307409_1000014734 630
220 3300046457 Ga0495590_0006561 Ga0495590_0006561_2253_4193 630
221 3300046660 Ga0495625_0011553 Ga0495625_0011553_1967_3907 630
222 3300046660 Ga0495625_0013059 Ga0495625_0013059_2697_4631 630
223 3300049591 Ga0501075_0004696 Ga0501075_0004696_1307_3295 630
224 3300049593 Ga0501077_0000300 Ga0501077_0000300_23830_25818 630
225 3300049742 Ga0501080_0001982 Ga0501080_0001982_10287_12275 630
226 3300050508 nmdc:mga09592_579_c1 nmdc:mga09592_579_c1_11575_13857 630
227 3300050512 nmdc:mga0n895_95706_c1 nmdc:mga0n895_95706_c1_882_2855 630
228 3300053153 Ga0500616_0011672 Ga0500616_0011672_1477_3471 630
229 3300060353 Ga0501082_0000288 Ga0501082_0000288_19145_21133 630
230 3300005548 Ga0070665_100005673 Ga0070665_1000056734 631
231 3300005548 Ga0070665_100022528 Ga0070665_1000225286 631
232 3300025986 Ga0207658_10045718 Ga0207658_100457182 631
233 3300028379 Ga0268266_10084403 Ga0268266_100844032 631
234 3300046513 Ga0495616_0001435 Ga0495616_0001435_26_1969 631
235 3300053104 Ga0500556_0008097 Ga0500556_0008097_832_2868 631
236 3300005335 Ga0070666_10004487 Ga0070666_100044876 632
237 3300005530 Ga0070679_100014255 Ga0070679_1000142554 632
238 3300014326 Ga0157380_10002572 Ga0157380_100025722 632
239 3300031995 Ga0307409_100005994 Ga0307409_1000059945 632
240 3300035085 Ga0373929_0000002 Ga0373929_0000002_212263_214275 632
241 3300035692 Ga0373935_0002575 Ga0373935_0002575_4419_6455 632
242 3300048917 Ga0496114_0000004 Ga0496114_0000004_319099_321117 632
243 3300049584 Ga0501068_0001142 Ga0501068_0001142_7929_9875 632
244 3300049586 Ga0501070_0026358 Ga0501070_0026358_954_2900 632
245 3300049587 Ga0501071_0007549 Ga0501071_0007549_93_2039 632
246 3300049590 Ga0501074_0002017 Ga0501074_0002017_8326_10272 632
247 3300049741 Ga0501079_0060372 Ga0501079_0060372_426_2372 632
248 3300049742 Ga0501080_0013178 Ga0501080_0013178_4482_6428 632
249 3300053153 Ga0500616_0000074 Ga0500616_0000074_25884_27890 632
250 3300054114 Ga0501084_0049747 Ga0501084_0049747_277_2223 632
251 3300060353 Ga0501082_0018611 Ga0501082_0018611_1180_3126 632
252 3300005354 Ga0070675_100038113 Ga0070675_1000381135 633
253 3300005544 Ga0070686_100030761 Ga0070686_1000307611 633
254 3300005549 Ga0070704_100053345 Ga0070704_1000533452 633
255 3300006173 Ga0070716_100016602 Ga0070716_1000166022 633
256 3300025915 Ga0207693_10016764 Ga0207693_100167642 633
257 3300031456 Ga0307513_10078202 Ga0307513_100782022 633
258 3300035398 Ga0316574_0018317 Ga0316574_0018317_1972_3954 633
259 3300039450 Ga0436363_1278714 Ga0436363_1278714_6463_8544 633
260 3300042876 Ga0451577_0000179 Ga0451577_0000179_108227_110137 633
261 3300044656 Ga0466969_0007555 Ga0466969_0007555_708_2738 633
262 3300044684 Ga0466966_0002096 Ga0466966_0002096_139_2169 633
263 3300044712 Ga0453684_0000033 Ga0453684_0000033_239643_241553 633
264 3300045049 Ga0466959_0078895 Ga0466959_0078895_239_2269 633
265 3300049569 Ga0501032_0007346 Ga0501032_0007346_4032_5963 633
266 3300049578 Ga0501042_0009559 Ga0501042_0009559_4523_6454 633
267 3300049587 Ga0501071_0002927 Ga0501071_0002927_4942_6873 633
268 3300049588 Ga0501072_0017044 Ga0501072_0017044_808_2739 633
269 3300049592 Ga0501076_0033454 Ga0501076_0033454_1325_3256 633
270 3300049741 Ga0501079_0039763 Ga0501079_0039763_311_2242 633
271 3300049742 Ga0501080_0053917 Ga0501080_0053917_658_2589 633
272 3300049822 Ga0501035_0009034 Ga0501035_0009034_2394_4325 633
273 3300049823 Ga0501044_0111252 Ga0501044_0111252_220_2151 633
274 3300031995 Ga0307409_100092435 Ga0307409_1000924353 634
275 3300036647 Ga0316582_0024965 Ga0316582_0024965_1233_3227 634
276 3300041999 Ga0439433_0006665 Ga0439433_0006665_535_2469 634
277 3300042184 Ga0450908_003788 Ga0450908_003788_647_2578 634
278 3300046663 Ga0495635_0001176 Ga0495635_0001176_8605_10635 634
279 3300046809 Ga0495600_0002771 Ga0495600_0002771_4013_6043 634
280 3300047322 Ga0495680_0002515 Ga0495680_0002515_9126_11156 634
281 3300047471 Ga0495684_0005274 Ga0495684_0005274_1135_3165 634
282 3300050507 nmdc:mga05p37_39726_c1 nmdc:mga05p37_39726_c1_1202_3133 634
283 3300053085 Ga0495619_0013247 Ga0495619_0013247_1969_3999 634
284 iso_pu_bacteria 2524023250 2524612724 634
285 3300035113 Ga0373936_0004595 Ga0373936_0004595_2445_4478 635
286 3300041408 Ga0439453_0002951 Ga0439453_0002951_33_1973 635
287 3300042156 Ga0439446_0000341 Ga0439446_0000341_3266_5206 635
288 3300049649 Ga0501198_000010 Ga0501198_000010_26484_28541 635
289 3300049662 Ga0501222_000009 Ga0501222_000009_89969_92026 635
290 3300041494 Ga0451837_0414199 Ga0451837_0414199_256_2238 637
291 3300053139 Ga0500568_0002663 Ga0500568_0002663_1554_3494 637
292 3300054114 Ga0501084_0066459 Ga0501084_0066459_508_2448 637
293 3300060353 Ga0501082_0003274 Ga0501082_0003274_6549_8489 637
294 3300031665 Ga0316575_10015227 Ga0316575_100152272 639
295 3300031727 Ga0316576_10020200 Ga0316576_100202004 639
296 3300031733 Ga0316577_10022583 Ga0316577_100225832 639
297 3300049569 Ga0501032_0003355 Ga0501032_0003355_5456_7450 639
298 3300049571 Ga0501034_0004045 Ga0501034_0004045_1884_3878 639
299 3300049573 Ga0501037_0015715 Ga0501037_0015715_980_2974 639
300 3300049574 Ga0501038_0006042 Ga0501038_0006042_962_2956 639
301 3300049580 Ga0501046_0019036 Ga0501046_0019036_2289_4283 639
302 3300049581 Ga0501047_0036319 Ga0501047_0036319_387_2381 639
303 3300049585 Ga0501069_0035537 Ga0501069_0035537_562_2556 639
304 3300049586 Ga0501070_0053634 Ga0501070_0053634_387_2381 639
305 3300049589 Ga0501073_0005700 Ga0501073_0005700_5563_7557 639
306 3300049742 Ga0501080_0030660 Ga0501080_0030660_960_2954 639
307 3300049823 Ga0501044_0118654 Ga0501044_0118654_195_2135 639
308 3300005985 Ga0081539_10000007 Ga0081539_10000007179 640
309 3300035398 Ga0316574_0025985 Ga0316574_0025985_1490_3475 640
310 3300037068 Ga0373925_0000241 Ga0373925_0000241_27676_29766 640
311 3300042876 Ga0451577_0004024 Ga0451577_0004024_8529_10559 640
312 3300046475 Ga0495639_0000515 Ga0495639_0000515_1062_3152 640
313 3300046526 Ga0495666_0000785 Ga0495666_0000785_5323_7413 640
314 3300046535 Ga0495586_0000515 Ga0495586_0000515_5751_7841 640
315 3300046683 Ga0495658_0027348 Ga0495658_0027348_198_2288 640
316 3300047315 Ga0495581_0053333 Ga0495581_0053333_29_2119 640
317 3300047321 Ga0495676_0047632 Ga0495676_0047632_466_2556 640
318 3300031727 Ga0316576_10078065 Ga0316576_100780653 643
319 3300031728 Ga0316578_10009534 Ga0316578_100095343 643
320 3300032137 Ga0316585_10005825 Ga0316585_100058253 643
321 3300036712 Ga0316584_0002222 Ga0316584_0002222_9781_11733 643
322 3300046459 Ga0495629_0000009 Ga0495629_0000009_278705_280831 644
323 3300003322 rootL2_10001354 rootL2_100013547 646
324 3300049674 Ga0501242_000054 Ga0501242_000054_1492_3615 646
325 3300049686 Ga0501257_000896 Ga0501257_000896_3535_5658 646
326 3300049688 Ga0501259_000963 Ga0501259_000963_925_3048 646

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

523

704

0.92

PF00326

Peptidase_S9

Prolyl oligopeptidase family

494

707

0.89

PF20434

BD-FAE

BD-FAE

468

665

0.78

PF00930

DPPIV_N

Dipeptidyl peptidase IV (DPP IV) N-terminal region

208

415

0.77

PF02129

Peptidase_S15

X-Pro dipeptidyl-peptidase (S15 family)

462

602

0.76

PF05448

AXE1

Acetyl xylan esterase (AXE1)

436

695

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
5l8s-assembly2.cif.gz_D the crystal structure of a cold-adapted acylaminoacyl peptidase reveals a novel quaternary architecture based on the arm-exchange mechanism 0.9381 44 643
5l8s-assembly2.cif.gz_D the crystal structure of a cold-adapted acylaminoacyl peptidase reveals a novel quaternary architecture based on the arm-exchange mechanism 0.9095 44 643
4re6-assembly1.cif.gz_A acylaminoacyl peptidase complexed with a chloromethylketone inhibitor 0.8777 38 640
2bkl-assembly1.cif.gz_A structural and mechanistic analysis of two prolyl endopeptidases: role of inter-domain dynamics in catalysis and specificity 0.8756 33 646
2qr5-assembly1.cif.gz_A aeropyrum pernix acylaminoacyl peptidase, h367a mutant 0.8718 39 640
ID Description Score Start End Superfamily
af_Q69Y12_406_672_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9112 380 644 3.40.50.1820
af_O07178_411_672_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8992 385 644 3.40.50.1820
4hxgB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8943 386 644 3.40.50.1820
af_A0A1D6E3C1_444_645_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8923 376 569 3.40.50.1820
af_Q54IN4_407_688_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8894 377 641 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A0S8JTK3-F1-model_v4 Peptidase S9 prolyl oligopeptidase catalytic domain-containing protein 0.9893 20 646 GO:0004252
GO:0006508
AF-A0A0S8JTK3-F1-model_v4 Peptidase S9 prolyl oligopeptidase catalytic domain-containing protein 0.9784 20 646 GO:0004252
GO:0006508
AF-A0A7Y3JZI0-F1-model_v4 S9 family peptidase 0.9748 44 642 GO:0004252
GO:0006508
AF-A0A1M5F952-F1-model_v4 Dipeptidyl aminopeptidase/acylaminoacyl peptidase 0.9707 17 646 GO:0004177
GO:0004252
GO:0006508
AF-A0A2A5AKI0-F1-model_v4 S9 family peptidase 0.9689 38 644 GO:0004252
GO:0006508

Feature Viewer

pLDDT pTM Quality
93.25 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map