F408545

General Info

Members Datasets Scaffolds Average Seq Length
326 233 326 101

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_26929_c1|nmdc:mga0k408_26929_c1_1354_1731
Length 125
Sequence MKHAVQRRRSDAALECRSHSPGDIMAKGYWIVRVDIRDPEQYKLYVAANAKPFAKYGARFLVRAGKYEAVEGSARSRNAVIEFASYEAALECWKSAEYQEVMKLRTGVSTADVVVIEGYDGPQPA

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
64 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
65 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
106 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
109 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
110 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
111 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
112 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
113 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
114 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
115 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
116 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
119 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
120 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
121 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
122 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
123 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
124 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
125 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
133 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
134 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
135 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
136 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
137 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
138 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
139 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
140 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
141 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
142 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
143 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
144 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
145 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
146 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
147 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
151 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
156 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
157 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
163 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
164 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
165 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
166 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
169 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
170 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
171 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
172 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
173 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
174 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
175 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
176 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
177 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
188 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
210 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
211 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
212 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
213 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
214 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
215 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
216 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
224 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
225 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
226 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
227 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
228 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
229 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
230 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
231 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
232 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
233 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.11
Nodule 0
Rhizoplane 2.45
Rhizosphere 77.3
Stem 0
Stem Tuber 0
Unclassified 6.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214544912 2209111006 Bacteria 25181
2 ARcpr5oldR_c000017 3300000041 Bacteria 33564
3 ARSoilYngRDRAFT_c00051 3300000042 Bacteria 18662
4 ARcpr5yngRDRAFT_c000050 3300000043 Bacteria 18670
5 ARSoilOldRDRAFT_c000022 3300000044 Bacteria 35130
6 ARCol0oldRDRAFT_c01395 3300000045 Bacteria 1606
7 ARCol0yngRDRAFT_1000073 3300000652 Bacteria 18682
8 Ga0065716_1001886 3300005277 Bacteria 2867
9 Ga0065704_10586555 3300005289 Bacteria 615
10 Ga0070658_10407024 3300005327 Bacteria 1169
11 Ga0070658_10883258 3300005327 Bacteria 777
12 Ga0070676_10267007 3300005328 Bacteria 1148
13 Ga0070676_10949325 3300005328 Bacteria 643
14 Ga0070683_100037802 3300005329 Bacteria 4420
15 Ga0070670_100185603 3300005331 Bacteria 1806
16 Ga0068869_100576991 3300005334 Bacteria 948
17 Ga0070680_100792865 3300005336 Bacteria 816
18 Ga0070682_100024918 3300005337 Bacteria 3566
19 Ga0070692_11308109 3300005345 Unclassified 520
20 Ga0070668_100241711 3300005347 Bacteria 1496
21 Ga0070668_100829132 3300005347 Bacteria 823
22 Ga0070675_101027609 3300005354 Bacteria 757
23 Ga0070675_101108000 3300005354 Unclassified 728
24 Ga0070671_100250260 3300005355 Bacteria 1505
25 Ga0070671_100586405 3300005355 Bacteria 963
26 Ga0070674_101043626 3300005356 Bacteria 719
27 Ga0070674_101380310 3300005356 Bacteria 630
28 Ga0070701_10017562 3300005438 Bacteria 3345
29 Ga0070700_100150786 3300005441 Bacteria 1590
30 Ga0070708_100501751 3300005445 Bacteria 1145
31 Ga0070678_100438235 3300005456 Bacteria 1142
32 Ga0068867_100064695 3300005459 Bacteria 2719
33 Ga0070685_10229295 3300005466 Bacteria 1221
34 Ga0070679_100010911 3300005530 Bacteria 8632
35 Ga0070672_100466746 3300005543 Bacteria 1089
36 Ga0070665_102199378 3300005548 Bacteria 555
37 Ga0068855_100005924 3300005563 Bacteria 14902
38 Ga0070664_101870053 3300005564 Bacteria 569
39 Ga0068857_100567171 3300005577 Bacteria 1071
40 Ga0068854_100827778 3300005578 Bacteria 809
41 Ga0068856_100400648 3300005614 Unclassified 1392
42 Ga0070702_100548399 3300005615 Bacteria 858
43 Ga0068864_101881017 3300005618 Bacteria 604
44 Ga0068861_100637245 3300005719 Bacteria 983
45 Ga0068861_100656535 3300005719 Bacteria 969
46 Ga0068861_101362845 3300005719 Bacteria 692
47 Ga0068860_100975595 3300005843 Bacteria 865
48 Ga0068860_102568524 3300005843 Unclassified 529
49 Ga0081538_10017534 3300005981 Bacteria 5429
50 Ga0075362_10032639 3300006177 Bacteria 2261
51 Ga0075367_10077015 3300006178 Bacteria 2013
52 Ga0075427_10036649 3300006194 Bacteria 818
53 Ga0075366_10007074 3300006195 Bacteria 6176
54 Ga0075366_10011373 3300006195 Bacteria 5023
55 Ga0075366_10039155 3300006195 Bacteria 2801
56 Ga0097621_101776791 3300006237 Bacteria 588
57 Ga0075370_10018029 3300006353 Bacteria 3824
58 Ga0075370_10023750 3300006353 Bacteria 3380
59 Ga0075370_10044916 3300006353 Bacteria 2497
60 Ga0075370_10108735 3300006353 Bacteria 1609
61 Ga0075370_10291734 3300006353 Bacteria 969
62 Ga0075370_10313097 3300006353 Bacteria 934
63 Ga0075370_10803868 3300006353 Bacteria 573
64 Ga0068871_100595275 3300006358 Bacteria 1005
65 Ga0075428_100003575 3300006844 Bacteria 17024
66 Ga0075430_100396047 3300006846 Bacteria 1140
67 Ga0075431_100004553 3300006847 Bacteria 13616
68 Ga0075431_100007265 3300006847 Bacteria 11026
69 Ga0075433_10068032 3300006852 Bacteria 3126
70 Ga0075433_10638259 3300006852 Bacteria 934
71 Ga0075434_100659148 3300006871 Bacteria 1065
72 Ga0075429_100002407 3300006880 Bacteria 15758
73 Ga0075429_100344354 3300006880 Bacteria 1305
74 Ga0075429_101230779 3300006880 Bacteria 653
75 Ga0068865_100212652 3300006881 Bacteria 1508
76 Ga0068865_101748332 3300006881 Unclassified 561
77 Ga0075435_100517598 3300007076 Bacteria 1032
78 Ga0105240_10004043 3300009093 Bacteria 22563
79 Ga0111539_10000115 3300009094 Bacteria 88645
80 Ga0111539_10003667 3300009094 Bacteria 20224
81 Ga0111539_10384259 3300009094 Bacteria 1635
82 Ga0111539_13124442 3300009094 Bacteria 534
83 Ga0114129_10001209 3300009147 Bacteria 34278
84 Ga0114129_11078291 3300009147 Bacteria 1007
85 Ga0105243_10272514 3300009148 Bacteria 1520
86 Ga0105243_12639887 3300009148 Bacteria 542
87 Ga0105238_10033009 3300009551 Bacteria 5268
88 Ga0105239_10475028 3300010375 Bacteria 1420
89 Ga0105239_11842359 3300010375 Bacteria 701
90 Ga0105246_12033061 3300011119 Bacteria 555
91 Ga0157337_1019055 3300012483 Bacteria 618
92 Ga0157326_1005647 3300012513 Bacteria 1325
93 Ga0157338_1000349 3300012515 Bacteria 2584
94 Ga0163162_10240352 3300013306 Bacteria 1942
95 Ga0157375_10302722 3300013308 Bacteria 1762
96 Ga0163163_11991668 3300014325 Bacteria 641
97 Ga0157380_10194158 3300014326 Bacteria 1795
98 Ga0182008_10089806 3300014497 Bacteria 1514
99 Ga0157376_11374025 3300014969 Bacteria 737
100 Ga0163161_10218775 3300017792 Bacteria 1474
101 Ga0163161_10580765 3300017792 Bacteria 922
102 Ga0213876_10014594 3300021384 Bacteria 4162
103 Ga0209257_1117070 3300025304 Bacteria 628
104 Ga0207688_10099789 3300025901 Bacteria 1675
105 Ga0207705_10229587 3300025909 Bacteria 1411
106 Ga0207705_10335676 3300025909 Bacteria 1163
107 Ga0207695_10234359 3300025913 Bacteria 1739
108 Ga0207657_10056678 3300025919 Bacteria 3380
109 Ga0207652_10209455 3300025921 Bacteria 1755
110 Ga0207694_10937903 3300025924 Unclassified 732
111 Ga0207650_10289350 3300025925 Bacteria 1336
112 Ga0207659_10970081 3300025926 Unclassified 731
113 Ga0207687_10302250 3300025927 Bacteria 1289
114 Ga0207644_10539399 3300025931 Bacteria 965
115 Ga0207644_10605110 3300025931 Bacteria 910
116 Ga0207686_10472140 3300025934 Unclassified 969
117 Ga0207709_10007340 3300025935 Bacteria 6144
118 Ga0207669_10650826 3300025937 Bacteria 862
119 Ga0207669_11072223 3300025937 Bacteria 679
120 Ga0207691_10436455 3300025940 Bacteria 1115
121 Ga0207679_11956634 3300025945 Bacteria 534
122 Ga0207667_10236089 3300025949 Bacteria 1872
123 Ga0207651_11479607 3300025960 Bacteria 612
124 Ga0207712_10249000 3300025961 Bacteria 1435
125 Ga0207668_11519717 3300025972 Bacteria 604
126 Ga0207640_10507568 3300025981 Bacteria 1005
127 Ga0207639_10245801 3300026041 Bacteria 1558
128 Ga0207702_11585102 3300026078 Unclassified 648
129 Ga0207641_11016683 3300026088 Bacteria 826
130 Ga0207648_10033875 3300026089 Bacteria 4504
131 Ga0207648_10178672 3300026089 Bacteria 1878
132 Ga0207675_100352751 3300026118 Bacteria 1442
133 Ga0207675_100740463 3300026118 Bacteria 994
134 Ga0207675_100985995 3300026118 Unclassified 861
135 Ga0207683_10058887 3300026121 Bacteria 3373
136 Ga0207428_10002405 3300027907 Bacteria 18695
137 Ga0207428_10017457 3300027907 Bacteria 6159
138 Ga0268266_11763529 3300028379 Unclassified 594
139 Ga0268266_11985259 3300028379 Bacteria 555
140 Ga0268265_10409482 3300028380 Unclassified 1256
141 Ga0268265_10652027 3300028380 Bacteria 1012
142 Ga0268264_11554986 3300028381 Bacteria 672
143 Ga0307517_10179340 3300028786 Bacteria 1371
144 Ga0307517_10401419 3300028786 Bacteria 725
145 Ga0307515_10029256 3300028794 Bacteria 9323
146 Ga0307515_10065385 3300028794 Bacteria 5062
147 Ga0307515_10161610 3300028794 Bacteria 2281
148 Ga0265338_10770866 3300028800 Bacteria 660
149 Ga0265330_10016666 3300031235 Bacteria 3387
150 Ga0265328_10318915 3300031239 Bacteria 602
151 Ga0265325_10015264 3300031241 Bacteria 4323
152 Ga0265325_10019993 3300031241 Bacteria 3695
153 Ga0265340_10327714 3300031247 Bacteria 677
154 Ga0265339_10028656 3300031249 Bacteria 3165
155 Ga0265331_10330932 3300031250 Bacteria 682
156 Ga0265316_10051837 3300031344 Bacteria 3222
157 Ga0307513_10244507 3300031456 Bacteria 1596
158 Ga0307509_10832859 3300031507 Bacteria 587
159 Ga0307408_100358182 3300031548 Bacteria 1240
160 Ga0307408_100386939 3300031548 Bacteria 1197
161 Ga0265313_10000227 3300031595 Bacteria 60770
162 Ga0265313_10005651 3300031595 Bacteria 9139
163 Ga0307508_10000007 3300031616 Bacteria 268359
164 Ga0307508_10705299 3300031616 Unclassified 619
165 Ga0307514_10001060 3300031649 Bacteria 39303
166 Ga0307514_10006250 3300031649 Bacteria 10430
167 Ga0316575_10061802 3300031665 Bacteria 1497
168 Ga0316579_10009513 3300031691 Bacteria 4089
169 Ga0265314_10112601 3300031711 Bacteria 1727
170 Ga0265342_10006898 3300031712 Bacteria 8395
171 Ga0307516_10207547 3300031730 Bacteria 1675
172 Ga0307516_10596237 3300031730 Bacteria 759
173 Ga0307516_10749250 3300031730 Bacteria 636
174 Ga0307516_10771009 3300031730 Bacteria 622
175 Ga0307405_11546199 3300031731 Bacteria 584
176 Ga0307405_11842899 3300031731 Bacteria 539
177 Ga0307406_10329348 3300031901 Bacteria 1185
178 Ga0307407_10532203 3300031903 Bacteria 866
179 Ga0307407_10907636 3300031903 Bacteria 676
180 Ga0307412_10414790 3300031911 Bacteria 1100
181 Ga0307412_10756027 3300031911 Bacteria 840
182 Ga0307416_101739432 3300032002 Bacteria 728
183 Ga0307411_10468652 3300032005 Bacteria 1058
184 Ga0316583_10017764 3300032133 Unclassified 2555
185 Ga0307507_10100795 3300033179 Bacteria 2418
186 Ga0373950_0010989 3300034818 Bacteria 1472
187 Ga0373938_0000064 3300034957 Bacteria 13771
188 Ga0373940_0000741 3300035088 Bacteria 5323
189 Ga0373932_0000203 3300035112 Bacteria 17502
190 Ga0373941_0000089 3300035115 Bacteria 15092
191 Ga0373953_0255293 3300035117 Bacteria 762
192 Ga0373954_0036248 3300035118 Bacteria 2289
193 Ga0373957_0325174 3300035120 Bacteria 654
194 Ga0373960_0004247 3300035121 Bacteria 3272
195 Ga0373946_0092839 3300035171 Bacteria 1340
196 Ga0373955_0041710 3300035172 Bacteria 2461
197 Ga0373942_0000091 3300035207 Bacteria 19864
198 Ga0373961_0002565 3300035241 Bacteria 4680
199 Ga0373933_0063703 3300035724 Bacteria 2229
200 Ga0373947_0278637 3300035725 Bacteria 1111
201 Ga0373937_0002116 3300036401 Bacteria 16600
202 Ga0316582_0366484 3300036647 Bacteria 991
203 Ga0316584_0424337 3300036712 Bacteria 944
204 Ga0373925_0084537 3300037068 Bacteria 2418
205 Ga0373925_0086866 3300037068 Bacteria 2387
206 Ga0316581_0056770 3300037588 Bacteria 1200
207 Ga0436365_1681640 3300039437 Bacteria 9732
208 Ga0436365_1813544 3300039437 Bacteria 622
209 Ga0436361_0699898 3300039447 Bacteria 1136
210 Ga0439465_0017645 3300041413 Bacteria 2230
211 Ga0451577_0168847 3300042876 Bacteria 1971
212 Ga0451577_0322588 3300042876 Bacteria 1401
213 Ga0466966_0272797 3300044684 Bacteria 1018
214 Ga0453684_0033560 3300044712 Bacteria 7152
215 Ga0453684_0279713 3300044712 Bacteria 1904
216 Ga0466968_0533528 3300044735 Bacteria 587
217 Ga0451576_0004687 3300045051 Bacteria 17589
218 Ga0495583_0213758 3300046506 Unclassified 781
219 Ga0495620_0153357 3300046515 Unclassified 897
220 Ga0495631_0097000 3300046518 Bacteria 1269
221 Ga0495632_0080785 3300046519 Bacteria 1550
222 Ga0495654_0207477 3300046530 Unclassified 835
223 Ga0495640_0179657 3300046533 Bacteria 1349
224 Ga0495598_0172097 3300046537 Bacteria 768
225 Ga0495621_0018582 3300046539 Bacteria 2259
226 Ga0495597_0008200 3300046542 Bacteria 5251
227 Ga0495597_0346707 3300046542 Bacteria 570
228 Ga0495625_0089599 3300046660 Bacteria 2129
229 Ga0495625_0284824 3300046660 Bacteria 1062
230 Ga0495623_0738678 3300046679 Bacteria 502
231 Ga0495649_0003079 3300046694 Bacteria 11414
232 Ga0495660_0005268 3300046810 Bacteria 7752
233 Ga0495636_0167216 3300047318 Bacteria 993
234 Ga0495672_0233395 3300047320 Bacteria 902
235 Ga0495687_000733 3300047443 Bacteria 36127
236 Ga0495687_069809 3300047443 Bacteria 1412
237 Ga0495684_0663377 3300047471 Bacteria 696
238 Ga0495626_0096446 3300048091 Bacteria 1294
239 Ga0496101_0835547 3300048904 Bacteria 726
240 Ga0496105_0949731 3300048908 Bacteria 646
241 Ga0496106_0012909 3300048909 Bacteria 6164
242 Ga0496107_0115753 3300048910 Bacteria 1973
243 Ga0496110_0123619 3300048913 Bacteria 2333
244 Ga0496110_1672600 3300048913 Bacteria 546
245 Ga0496113_0367897 3300048916 Bacteria 1154
246 Ga0496115_1214222 3300048918 Bacteria 566
247 Ga0496120_0090953 3300048923 Bacteria 1630
248 Ga0495682_0098176 3300049460 Unclassified 1051
249 Ga0501031_0871016 3300049568 Bacteria 577
250 Ga0501032_0048728 3300049569 Bacteria 2860
251 Ga0501034_0006111 3300049571 Bacteria 12992
252 Ga0501034_0013752 3300049571 Bacteria 8326
253 Ga0501036_0013440 3300049572 Bacteria 6803
254 Ga0501037_0176593 3300049573 Bacteria 1517
255 Ga0501038_0106783 3300049574 Bacteria 2323
256 Ga0501039_0914969 3300049575 Bacteria 683
257 Ga0501043_0002744 3300049579 Bacteria 14726
258 Ga0501043_0036802 3300049579 Bacteria 3850
259 Ga0501046_0027771 3300049580 Bacteria 4614
260 Ga0501047_0000097 3300049581 Bacteria 107310
261 Ga0501047_0628798 3300049581 Bacteria 894
262 Ga0501047_1094997 3300049581 Bacteria 610
263 Ga0501069_0568412 3300049585 Bacteria 679
264 Ga0501070_0017576 3300049586 Bacteria 6003
265 Ga0501070_0124426 3300049586 Bacteria 2131
266 Ga0501072_1019155 3300049588 Bacteria 645
267 Ga0501073_0079246 3300049589 Bacteria 2286
268 Ga0501074_0046619 3300049590 Bacteria 3134
269 Ga0501074_0377881 3300049590 Bacteria 1005
270 Ga0501076_1545000 3300049592 Bacteria 545
271 Ga0501080_0002313 3300049742 Bacteria 16617
272 Ga0501080_0556668 3300049742 Bacteria 1021
273 Ga0501083_0001106 3300049744 Bacteria 18055
274 Ga0501083_0054207 3300049744 Bacteria 2691
275 Ga0501035_0045839 3300049822 Bacteria 3933
276 Ga0501035_0589779 3300049822 Bacteria 907
277 Ga0501044_0014471 3300049823 Bacteria 8515
278 Ga0501044_0434049 3300049823 Bacteria 1222
279 Ga0501044_1145699 3300049823 Bacteria 646
280 Ga0501045_0238318 3300049824 Bacteria 1354
281 nmdc:mga03683_58206_c1 3300050489 Bacteria 1628
282 nmdc:mga03683_72952_c1 3300050489 Bacteria 1471
283 nmdc:mga03n38_587029_c1 3300050490 Bacteria 633
284 nmdc:mga03n38_650424_c1 3300050490 Bacteria 604
285 nmdc:mga03n38_73836_c1 3300050490 Unclassified 1585
286 nmdc:mga0yw44_610338_c1 3300050492 Bacteria 741
287 nmdc:mga0yw44_959987_c1 3300050492 Unclassified 579
288 nmdc:mga0k408_24648_c1 3300050493 Bacteria 3402
289 nmdc:mga0k408_249062_c1 3300050493 Bacteria 1061
290 nmdc:mga0k408_26929_c1 3300050493 Bacteria 3262
291 nmdc:mga0k408_40196_c1 3300050493 Bacteria 2690
292 nmdc:mga0k408_81159_c1 3300050493 Bacteria 1899
293 nmdc:mga06z11_248071_c1 3300050494 Bacteria 1048
294 nmdc:mga04h51_289331_c1 3300050495 Bacteria 665
295 nmdc:mga04h51_356896_c1 3300050495 Bacteria 605
296 nmdc:mga07m45_100362_c1 3300050496 Bacteria 1662
297 nmdc:mga07m45_1604_c1 3300050496 Bacteria 10411
298 nmdc:mga07m45_176889_c1 3300050496 Bacteria 1241
299 nmdc:mga07m45_25803_c1 3300050496 Bacteria 1824
300 nmdc:mga07m45_591871_c1 3300050496 Bacteria 641
301 nmdc:mga07m45_6246_c1 3300050496 Bacteria 6016
302 nmdc:mga07m45_87343_c1 3300050496 Bacteria 1785
303 nmdc:mga05p37_7481_c1 3300050507 Bacteria 12877
304 nmdc:mga09592_1529_c1 3300050508 Bacteria 18637
305 nmdc:mga09592_445865_c1 3300050508 Unclassified 1117
306 nmdc:mga0qj67_27114_c1 3300050509 Bacteria 4438
307 nmdc:mga06r32_229588_c1 3300050510 Bacteria 1844
308 nmdc:mga06r32_322202_c1 3300050510 Bacteria 1531
309 nmdc:mga06r32_47_c1 3300050510 Bacteria 74242
310 nmdc:mga08y16_25205_c1 3300050511 Bacteria 6271
311 nmdc:mga08y16_341903_c1 3300050511 Bacteria 1538
312 nmdc:mga08y16_72_c1 3300050511 Bacteria 84439
313 nmdc:mga0n895_409033_c1 3300050512 Bacteria 1372
314 nmdc:mga0a205_490796_c1 3300050515 Bacteria 1086
315 nmdc:mga0a205_523305_c1 3300050515 Bacteria 1042
316 nmdc:mga0sz30_53613_c1 3300050516 Bacteria 1714
317 Ga0500578_0514154 3300053086 Bacteria 671
318 Ga0500554_079357 3300053102 Bacteria 1079
319 Ga0500608_008714 3300053122 Bacteria 4276
320 Ga0500658_0002823 3300053134 Bacteria 6666
321 Ga0500658_0009163 3300053134 Bacteria 3653
322 Ga0500559_0000072 3300053136 Bacteria 79568
323 Ga0500564_244453 3300053138 Bacteria 714
324 Ga0500568_0006889 3300053139 Bacteria 5652
325 Ga0500624_083533 3300053157 Bacteria 639
326 Ga0500633_0135724 3300053160 Unclassified 919

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035171 Ga0373946_0092839 Ga0373946_0092839_30_389 98
2 3300035725 Ga0373947_0278637 Ga0373947_0278637_717_1076 98
3 3300037068 Ga0373925_0084537 Ga0373925_0084537_2019_2378 98
4 2209111006 2214544912 2213593214 100
5 3300000041 ARcpr5oldR_c000017 ARcpr5oldR_00001713 100
6 3300000042 ARSoilYngRDRAFT_c00051 ARSoilYngRDRAFT_0005116 100
7 3300000043 ARcpr5yngRDRAFT_c000050 ARcpr5yngRDRAFT_0000507 100
8 3300000044 ARSoilOldRDRAFT_c000022 ARSoilOldRDRAFT_00002225 100
9 3300000045 ARCol0oldRDRAFT_c01395 ARCol0oldRDRAFT_013951 100
10 3300000652 ARCol0yngRDRAFT_1000073 ARCol0yngRDRAFT_10000737 100
11 3300005277 Ga0065716_1001886 Ga0065716_10018864 100
12 3300005289 Ga0065704_10586555 Ga0065704_105865552 100
13 3300005327 Ga0070658_10407024 Ga0070658_104070241 100
14 3300005327 Ga0070658_10883258 Ga0070658_108832581 100
15 3300005328 Ga0070676_10267007 Ga0070676_102670072 100
16 3300005328 Ga0070676_10949325 Ga0070676_109493251 100
17 3300005329 Ga0070683_100037802 Ga0070683_1000378026 100
18 3300005331 Ga0070670_100185603 Ga0070670_1001856032 100
19 3300005334 Ga0068869_100576991 Ga0068869_1005769912 100
20 3300005336 Ga0070680_100792865 Ga0070680_1007928652 100
21 3300005337 Ga0070682_100024918 Ga0070682_1000249183 100
22 3300005345 Ga0070692_11308109 Ga0070692_113081091 100
23 3300005347 Ga0070668_100241711 Ga0070668_1002417112 100
24 3300005347 Ga0070668_100829132 Ga0070668_1008291322 100
25 3300005354 Ga0070675_101027609 Ga0070675_1010276091 100
26 3300005354 Ga0070675_101108000 Ga0070675_1011080001 100
27 3300005355 Ga0070671_100250260 Ga0070671_1002502603 100
28 3300005355 Ga0070671_100586405 Ga0070671_1005864052 100
29 3300005356 Ga0070674_101043626 Ga0070674_1010436262 100
30 3300005356 Ga0070674_101380310 Ga0070674_1013803102 100
31 3300005438 Ga0070701_10017562 Ga0070701_100175624 100
32 3300005441 Ga0070700_100150786 Ga0070700_1001507863 100
33 3300005445 Ga0070708_100501751 Ga0070708_1005017512 100
34 3300005456 Ga0070678_100438235 Ga0070678_1004382352 100
35 3300005459 Ga0068867_100064695 Ga0068867_1000646954 100
36 3300005466 Ga0070685_10229295 Ga0070685_102292952 100
37 3300005530 Ga0070679_100010911 Ga0070679_1000109115 100
38 3300005543 Ga0070672_100466746 Ga0070672_1004667462 100
39 3300005548 Ga0070665_102199378 Ga0070665_1021993781 100
40 3300005563 Ga0068855_100005924 Ga0068855_10000592417 100
41 3300005564 Ga0070664_101870053 Ga0070664_1018700531 100
42 3300005577 Ga0068857_100567171 Ga0068857_1005671712 100
43 3300005578 Ga0068854_100827778 Ga0068854_1008277782 100
44 3300005614 Ga0068856_100400648 Ga0068856_1004006483 100
45 3300005615 Ga0070702_100548399 Ga0070702_1005483992 100
46 3300005618 Ga0068864_101881017 Ga0068864_1018810171 100
47 3300005719 Ga0068861_100637245 Ga0068861_1006372452 100
48 3300005719 Ga0068861_100656535 Ga0068861_1006565352 100
49 3300005719 Ga0068861_101362845 Ga0068861_1013628452 100
50 3300005843 Ga0068860_100975595 Ga0068860_1009755952 100
51 3300005843 Ga0068860_102568524 Ga0068860_1025685242 100
52 3300005981 Ga0081538_10017534 Ga0081538_100175346 100
53 3300006177 Ga0075362_10032639 Ga0075362_100326393 100
54 3300006178 Ga0075367_10077015 Ga0075367_100770153 100
55 3300006194 Ga0075427_10036649 Ga0075427_100366493 100
56 3300006195 Ga0075366_10007074 Ga0075366_100070742 100
57 3300006195 Ga0075366_10011373 Ga0075366_100113737 100
58 3300006195 Ga0075366_10039155 Ga0075366_100391552 100
59 3300006237 Ga0097621_101776791 Ga0097621_1017767911 100
60 3300006353 Ga0075370_10018029 Ga0075370_100180293 100
61 3300006353 Ga0075370_10023750 Ga0075370_100237505 100
62 3300006353 Ga0075370_10044916 Ga0075370_100449162 100
63 3300006353 Ga0075370_10108735 Ga0075370_101087352 100
64 3300006353 Ga0075370_10291734 Ga0075370_102917341 100
65 3300006353 Ga0075370_10313097 Ga0075370_103130972 100
66 3300006353 Ga0075370_10803868 Ga0075370_108038681 100
67 3300006358 Ga0068871_100595275 Ga0068871_1005952752 100
68 3300006844 Ga0075428_100003575 Ga0075428_1000035756 100
69 3300006846 Ga0075430_100396047 Ga0075430_1003960472 100
70 3300006847 Ga0075431_100004553 Ga0075431_10000455314 100
71 3300006847 Ga0075431_100007265 Ga0075431_10000726515 100
72 3300006852 Ga0075433_10068032 Ga0075433_100680323 100
73 3300006852 Ga0075433_10638259 Ga0075433_106382592 100
74 3300006871 Ga0075434_100659148 Ga0075434_1006591481 100
75 3300006880 Ga0075429_100002407 Ga0075429_10000240720 100
76 3300006880 Ga0075429_100344354 Ga0075429_1003443541 100
77 3300006880 Ga0075429_101230779 Ga0075429_1012307791 100
78 3300006881 Ga0068865_100212652 Ga0068865_1002126523 100
79 3300006881 Ga0068865_101748332 Ga0068865_1017483321 100
80 3300007076 Ga0075435_100517598 Ga0075435_1005175982 100
81 3300009093 Ga0105240_10004043 Ga0105240_1000404315 100
82 3300009094 Ga0111539_10000115 Ga0111539_1000011568 100
83 3300009094 Ga0111539_10003667 Ga0111539_100036676 100
84 3300009094 Ga0111539_10384259 Ga0111539_103842593 100
85 3300009094 Ga0111539_13124442 Ga0111539_131244421 100
86 3300009147 Ga0114129_10001209 Ga0114129_1000120911 100
87 3300009147 Ga0114129_11078291 Ga0114129_110782913 100
88 3300009148 Ga0105243_10272514 Ga0105243_102725142 100
89 3300009148 Ga0105243_12639887 Ga0105243_126398872 100
90 3300009551 Ga0105238_10033009 Ga0105238_100330095 100
91 3300010375 Ga0105239_10475028 Ga0105239_104750282 100
92 3300010375 Ga0105239_11842359 Ga0105239_118423591 100
93 3300011119 Ga0105246_12033061 Ga0105246_120330612 100
94 3300012483 Ga0157337_1019055 Ga0157337_10190552 100
95 3300012513 Ga0157326_1005647 Ga0157326_10056472 100
96 3300012515 Ga0157338_1000349 Ga0157338_10003493 100
97 3300013306 Ga0163162_10240352 Ga0163162_102403522 100
98 3300013308 Ga0157375_10302722 Ga0157375_103027223 100
99 3300014325 Ga0163163_11991668 Ga0163163_119916681 100
100 3300014326 Ga0157380_10194158 Ga0157380_101941583 100
101 3300014497 Ga0182008_10089806 Ga0182008_100898063 100
102 3300014969 Ga0157376_11374025 Ga0157376_113740252 100
103 3300017792 Ga0163161_10218775 Ga0163161_102187752 100
104 3300017792 Ga0163161_10580765 Ga0163161_105807651 100
105 3300021384 Ga0213876_10014594 Ga0213876_100145944 100
106 3300025304 Ga0209257_1117070 Ga0209257_11170701 100
107 3300025901 Ga0207688_10099789 Ga0207688_100997892 100
108 3300025909 Ga0207705_10229587 Ga0207705_102295872 100
109 3300025909 Ga0207705_10335676 Ga0207705_103356762 100
110 3300025913 Ga0207695_10234359 Ga0207695_102343594 100
111 3300025919 Ga0207657_10056678 Ga0207657_100566782 100
112 3300025921 Ga0207652_10209455 Ga0207652_102094552 100
113 3300025924 Ga0207694_10937903 Ga0207694_109379032 100
114 3300025925 Ga0207650_10289350 Ga0207650_102893502 100
115 3300025926 Ga0207659_10970081 Ga0207659_109700812 100
116 3300025927 Ga0207687_10302250 Ga0207687_103022503 100
117 3300025931 Ga0207644_10539399 Ga0207644_105393992 100
118 3300025931 Ga0207644_10605110 Ga0207644_106051102 100
119 3300025934 Ga0207686_10472140 Ga0207686_104721402 100
120 3300025935 Ga0207709_10007340 Ga0207709_100073402 100
121 3300025937 Ga0207669_10650826 Ga0207669_106508262 100
122 3300025937 Ga0207669_11072223 Ga0207669_110722232 100
123 3300025940 Ga0207691_10436455 Ga0207691_104364552 100
124 3300025945 Ga0207679_11956634 Ga0207679_119566341 100
125 3300025949 Ga0207667_10236089 Ga0207667_102360893 100
126 3300025960 Ga0207651_11479607 Ga0207651_114796072 100
127 3300025961 Ga0207712_10249000 Ga0207712_102490003 100
128 3300025972 Ga0207668_11519717 Ga0207668_115197172 100
129 3300025981 Ga0207640_10507568 Ga0207640_105075682 100
130 3300026041 Ga0207639_10245801 Ga0207639_102458013 100
131 3300026078 Ga0207702_11585102 Ga0207702_115851021 100
132 3300026088 Ga0207641_11016683 Ga0207641_110166832 100
133 3300026089 Ga0207648_10033875 Ga0207648_100338752 100
134 3300026089 Ga0207648_10178672 Ga0207648_101786723 100
135 3300026118 Ga0207675_100352751 Ga0207675_1003527512 100
136 3300026118 Ga0207675_100740463 Ga0207675_1007404632 100
137 3300026118 Ga0207675_100985995 Ga0207675_1009859951 100
138 3300026121 Ga0207683_10058887 Ga0207683_100588871 100
139 3300027907 Ga0207428_10002405 Ga0207428_100024054 100
140 3300027907 Ga0207428_10017457 Ga0207428_100174572 100
141 3300028379 Ga0268266_11763529 Ga0268266_117635292 100
142 3300028379 Ga0268266_11985259 Ga0268266_119852591 100
143 3300028380 Ga0268265_10409482 Ga0268265_104094822 100
144 3300028380 Ga0268265_10652027 Ga0268265_106520271 100
145 3300028381 Ga0268264_11554986 Ga0268264_115549862 100
146 3300028786 Ga0307517_10179340 Ga0307517_101793401 100
147 3300028786 Ga0307517_10401419 Ga0307517_104014191 100
148 3300028794 Ga0307515_10029256 Ga0307515_100292566 100
149 3300028794 Ga0307515_10065385 Ga0307515_100653854 100
150 3300028794 Ga0307515_10161610 Ga0307515_101616103 100
151 3300028800 Ga0265338_10770866 Ga0265338_107708662 100
152 3300031235 Ga0265330_10016666 Ga0265330_100166665 100
153 3300031239 Ga0265328_10318915 Ga0265328_103189152 100
154 3300031241 Ga0265325_10015264 Ga0265325_100152645 100
155 3300031241 Ga0265325_10019993 Ga0265325_100199935 100
156 3300031247 Ga0265340_10327714 Ga0265340_103277142 100
157 3300031249 Ga0265339_10028656 Ga0265339_100286564 100
158 3300031250 Ga0265331_10330932 Ga0265331_103309322 100
159 3300031344 Ga0265316_10051837 Ga0265316_100518372 100
160 3300031456 Ga0307513_10244507 Ga0307513_102445072 100
161 3300031507 Ga0307509_10832859 Ga0307509_108328592 100
162 3300031548 Ga0307408_100358182 Ga0307408_1003581822 100
163 3300031548 Ga0307408_100386939 Ga0307408_1003869392 100
164 3300031595 Ga0265313_10000227 Ga0265313_1000022725 100
165 3300031595 Ga0265313_10005651 Ga0265313_100056518 100
166 3300031616 Ga0307508_10000007 Ga0307508_10000007102 100
167 3300031616 Ga0307508_10705299 Ga0307508_107052992 100
168 3300031649 Ga0307514_10001060 Ga0307514_1000106020 100
169 3300031649 Ga0307514_10006250 Ga0307514_100062502 100
170 3300031665 Ga0316575_10061802 Ga0316575_100618023 100
171 3300031691 Ga0316579_10009513 Ga0316579_100095135 100
172 3300031711 Ga0265314_10112601 Ga0265314_101126013 100
173 3300031712 Ga0265342_10006898 Ga0265342_100068989 100
174 3300031730 Ga0307516_10207547 Ga0307516_102075472 100
175 3300031730 Ga0307516_10596237 Ga0307516_105962371 100
176 3300031730 Ga0307516_10749250 Ga0307516_107492501 100
177 3300031730 Ga0307516_10771009 Ga0307516_107710092 100
178 3300031731 Ga0307405_11546199 Ga0307405_115461991 100
179 3300031731 Ga0307405_11842899 Ga0307405_118428991 100
180 3300031901 Ga0307406_10329348 Ga0307406_103293482 100
181 3300031903 Ga0307407_10532203 Ga0307407_105322031 100
182 3300031903 Ga0307407_10907636 Ga0307407_109076362 100
183 3300031911 Ga0307412_10414790 Ga0307412_104147902 100
184 3300031911 Ga0307412_10756027 Ga0307412_107560272 100
185 3300032002 Ga0307416_101739432 Ga0307416_1017394322 100
186 3300032005 Ga0307411_10468652 Ga0307411_104686521 100
187 3300032133 Ga0316583_10017764 Ga0316583_100177643 100
188 3300033179 Ga0307507_10100795 Ga0307507_101007953 100
189 3300034818 Ga0373950_0010989 Ga0373950_0010989_546_848 100
190 3300034957 Ga0373938_0000064 Ga0373938_0000064_3763_4065 100
191 3300035088 Ga0373940_0000741 Ga0373940_0000741_713_1015 100
192 3300035112 Ga0373932_0000203 Ga0373932_0000203_14194_14496 100
193 3300035115 Ga0373941_0000089 Ga0373941_0000089_10700_11002 100
194 3300035117 Ga0373953_0255293 Ga0373953_0255293_361_663 100
195 3300035118 Ga0373954_0036248 Ga0373954_0036248_1467_1769 100
196 3300035120 Ga0373957_0325174 Ga0373957_0325174_319_621 100
197 3300035121 Ga0373960_0004247 Ga0373960_0004247_1899_2201 100
198 3300035172 Ga0373955_0041710 Ga0373955_0041710_887_1189 100
199 3300035207 Ga0373942_0000091 Ga0373942_0000091_14024_14326 100
200 3300035241 Ga0373961_0002565 Ga0373961_0002565_2480_2782 100
201 3300035724 Ga0373933_0063703 Ga0373933_0063703_1421_1723 100
202 3300036401 Ga0373937_0002116 Ga0373937_0002116_8653_8955 100
203 3300036647 Ga0316582_0366484 Ga0316582_0366484_198_503 100
204 3300036712 Ga0316584_0424337 Ga0316584_0424337_549_854 100
205 3300037068 Ga0373925_0086866 Ga0373925_0086866_952_1254 100
206 3300037588 Ga0316581_0056770 Ga0316581_0056770_150_455 100
207 3300039437 Ga0436365_1681640 Ga0436365_1681640_3120_3425 100
208 3300039437 Ga0436365_1813544 Ga0436365_1813544_153_461 100
209 3300039447 Ga0436361_0699898 Ga0436361_0699898_17_325 100
210 3300041413 Ga0439465_0017645 Ga0439465_0017645_102_404 100
211 3300042876 Ga0451577_0168847 Ga0451577_0168847_1314_1616 100
212 3300042876 Ga0451577_0322588 Ga0451577_0322588_268_576 100
213 3300044684 Ga0466966_0272797 Ga0466966_0272797_93_398 100
214 3300044712 Ga0453684_0033560 Ga0453684_0033560_4612_4920 100
215 3300044712 Ga0453684_0279713 Ga0453684_0279713_712_1014 100
216 3300044735 Ga0466968_0533528 Ga0466968_0533528_146_454 100
217 3300045051 Ga0451576_0004687 Ga0451576_0004687_617_919 100
218 3300046506 Ga0495583_0213758 Ga0495583_0213758_310_615 100
219 3300046515 Ga0495620_0153357 Ga0495620_0153357_567_872 100
220 3300046518 Ga0495631_0097000 Ga0495631_0097000_687_992 100
221 3300046519 Ga0495632_0080785 Ga0495632_0080785_1100_1405 100
222 3300046530 Ga0495654_0207477 Ga0495654_0207477_494_799 100
223 3300046533 Ga0495640_0179657 Ga0495640_0179657_49_351 100
224 3300046537 Ga0495598_0172097 Ga0495598_0172097_308_610 100
225 3300046539 Ga0495621_0018582 Ga0495621_0018582_215_517 100
226 3300046542 Ga0495597_0008200 Ga0495597_0008200_3035_3340 100
227 3300046542 Ga0495597_0346707 Ga0495597_0346707_106_411 100
228 3300046660 Ga0495625_0089599 Ga0495625_0089599_1006_1311 100
229 3300046660 Ga0495625_0284824 Ga0495625_0284824_143_454 100
230 3300046679 Ga0495623_0738678 Ga0495623_0738678_124_426 100
231 3300046694 Ga0495649_0003079 Ga0495649_0003079_9637_9942 100
232 3300046810 Ga0495660_0005268 Ga0495660_0005268_4562_4867 100
233 3300047318 Ga0495636_0167216 Ga0495636_0167216_675_977 100
234 3300047320 Ga0495672_0233395 Ga0495672_0233395_139_441 100
235 3300047443 Ga0495687_000733 Ga0495687_000733_29961_30266 100
236 3300047443 Ga0495687_069809 Ga0495687_069809_180_485 100
237 3300047471 Ga0495684_0663377 Ga0495684_0663377_204_506 100
238 3300048091 Ga0495626_0096446 Ga0495626_0096446_47_352 100
239 3300048904 Ga0496101_0835547 Ga0496101_0835547_168_476 100
240 3300048908 Ga0496105_0949731 Ga0496105_0949731_100_408 100
241 3300048909 Ga0496106_0012909 Ga0496106_0012909_624_926 100
242 3300048910 Ga0496107_0115753 Ga0496107_0115753_1101_1403 100
243 3300048913 Ga0496110_0123619 Ga0496110_0123619_1493_1795 100
244 3300048913 Ga0496110_1672600 Ga0496110_1672600_209_526 100
245 3300048916 Ga0496113_0367897 Ga0496113_0367897_115_417 100
246 3300048918 Ga0496115_1214222 Ga0496115_1214222_100_408 100
247 3300048923 Ga0496120_0090953 Ga0496120_0090953_507_815 100
248 3300049460 Ga0495682_0098176 Ga0495682_0098176_55_360 100
249 3300049568 Ga0501031_0871016 Ga0501031_0871016_200_511 100
250 3300049569 Ga0501032_0048728 Ga0501032_0048728_2184_2486 100
251 3300049571 Ga0501034_0006111 Ga0501034_0006111_11084_11386 100
252 3300049571 Ga0501034_0013752 Ga0501034_0013752_5157_5459 100
253 3300049572 Ga0501036_0013440 Ga0501036_0013440_5432_5734 100
254 3300049573 Ga0501037_0176593 Ga0501037_0176593_1194_1499 100
255 3300049574 Ga0501038_0106783 Ga0501038_0106783_1232_1534 100
256 3300049575 Ga0501039_0914969 Ga0501039_0914969_227_532 100
257 3300049579 Ga0501043_0002744 Ga0501043_0002744_13302_13604 100
258 3300049579 Ga0501043_0036802 Ga0501043_0036802_2066_2368 100
259 3300049580 Ga0501046_0027771 Ga0501046_0027771_4256_4558 100
260 3300049581 Ga0501047_0000097 Ga0501047_0000097_91986_92288 100
261 3300049581 Ga0501047_0628798 Ga0501047_0628798_25_330 100
262 3300049581 Ga0501047_1094997 Ga0501047_1094997_19_321 100
263 3300049585 Ga0501069_0568412 Ga0501069_0568412_61_366 100
264 3300049586 Ga0501070_0017576 Ga0501070_0017576_5231_5533 100
265 3300049586 Ga0501070_0124426 Ga0501070_0124426_339_644 100
266 3300049588 Ga0501072_1019155 Ga0501072_1019155_166_477 100
267 3300049589 Ga0501073_0079246 Ga0501073_0079246_13_315 100
268 3300049590 Ga0501074_0046619 Ga0501074_0046619_798_1100 100
269 3300049590 Ga0501074_0377881 Ga0501074_0377881_298_603 100
270 3300049592 Ga0501076_1545000 Ga0501076_1545000_47_358 100
271 3300049742 Ga0501080_0002313 Ga0501080_0002313_4362_4664 100
272 3300049742 Ga0501080_0556668 Ga0501080_0556668_694_999 100
273 3300049744 Ga0501083_0001106 Ga0501083_0001106_13585_13887 100
274 3300049744 Ga0501083_0054207 Ga0501083_0054207_2320_2622 100
275 3300049822 Ga0501035_0045839 Ga0501035_0045839_634_939 100
276 3300049822 Ga0501035_0589779 Ga0501035_0589779_472_777 100
277 3300049823 Ga0501044_0014471 Ga0501044_0014471_5893_6195 100
278 3300049823 Ga0501044_0434049 Ga0501044_0434049_262_564 100
279 3300049823 Ga0501044_1145699 Ga0501044_1145699_326_631 100
280 3300049824 Ga0501045_0238318 Ga0501045_0238318_965_1276 100
281 3300050489 nmdc:mga03683_58206_c1 nmdc:mga03683_58206_c1_882_1187 100
282 3300050489 nmdc:mga03683_72952_c1 nmdc:mga03683_72952_c1_259_564 100
283 3300050490 nmdc:mga03n38_587029_c1 nmdc:mga03n38_587029_c1_90_395 100
284 3300050490 nmdc:mga03n38_650424_c1 nmdc:mga03n38_650424_c1_112_414 100
285 3300050490 nmdc:mga03n38_73836_c1 nmdc:mga03n38_73836_c1_1253_1558 100
286 3300050492 nmdc:mga0yw44_610338_c1 nmdc:mga0yw44_610338_c1_344_646 100
287 3300050492 nmdc:mga0yw44_959987_c1 nmdc:mga0yw44_959987_c1_189_494 100
288 3300050493 nmdc:mga0k408_24648_c1 nmdc:mga0k408_24648_c1_212_517 100
289 3300050493 nmdc:mga0k408_249062_c1 nmdc:mga0k408_249062_c1_276_581 100
290 3300050493 nmdc:mga0k408_26929_c1 nmdc:mga0k408_26929_c1_1354_1731 100
291 3300050493 nmdc:mga0k408_40196_c1 nmdc:mga0k408_40196_c1_174_479 100
292 3300050493 nmdc:mga0k408_81159_c1 nmdc:mga0k408_81159_c1_202_507 100
293 3300050494 nmdc:mga06z11_248071_c1 nmdc:mga06z11_248071_c1_385_690 100
294 3300050495 nmdc:mga04h51_289331_c1 nmdc:mga04h51_289331_c1_80_385 100
295 3300050495 nmdc:mga04h51_356896_c1 nmdc:mga04h51_356896_c1_285_587 100
296 3300050496 nmdc:mga07m45_100362_c1 nmdc:mga07m45_100362_c1_607_912 100
297 3300050496 nmdc:mga07m45_1604_c1 nmdc:mga07m45_1604_c1_7410_7787 100
298 3300050496 nmdc:mga07m45_176889_c1 nmdc:mga07m45_176889_c1_654_959 100
299 3300050496 nmdc:mga07m45_25803_c1 nmdc:mga07m45_25803_c1_408_713 100
300 3300050496 nmdc:mga07m45_591871_c1 nmdc:mga07m45_591871_c1_300_605 100
301 3300050496 nmdc:mga07m45_6246_c1 nmdc:mga07m45_6246_c1_881_1186 100
302 3300050496 nmdc:mga07m45_87343_c1 nmdc:mga07m45_87343_c1_675_980 100
303 3300050507 nmdc:mga05p37_7481_c1 nmdc:mga05p37_7481_c1_5600_5911 100
304 3300050508 nmdc:mga09592_1529_c1 nmdc:mga09592_1529_c1_15340_15651 100
305 3300050508 nmdc:mga09592_445865_c1 nmdc:mga09592_445865_c1_200_517 100
306 3300050509 nmdc:mga0qj67_27114_c1 nmdc:mga0qj67_27114_c1_225_542 100
307 3300050510 nmdc:mga06r32_229588_c1 nmdc:mga06r32_229588_c1_999_1316 100
308 3300050510 nmdc:mga06r32_322202_c1 nmdc:mga06r32_322202_c1_128_439 100
309 3300050510 nmdc:mga06r32_47_c1 nmdc:mga06r32_47_c1_664_975 100
310 3300050511 nmdc:mga08y16_25205_c1 nmdc:mga08y16_25205_c1_5261_5563 100
311 3300050511 nmdc:mga08y16_341903_c1 nmdc:mga08y16_341903_c1_529_840 100
312 3300050511 nmdc:mga08y16_72_c1 nmdc:mga08y16_72_c1_25624_25935 100
313 3300050512 nmdc:mga0n895_409033_c1 nmdc:mga0n895_409033_c1_716_1033 100
314 3300050515 nmdc:mga0a205_490796_c1 nmdc:mga0a205_490796_c1_589_891 100
315 3300050515 nmdc:mga0a205_523305_c1 nmdc:mga0a205_523305_c1_527_844 100
316 3300050516 nmdc:mga0sz30_53613_c1 nmdc:mga0sz30_53613_c1_954_1259 100
317 3300053086 Ga0500578_0514154 Ga0500578_0514154_282_587 100
318 3300053102 Ga0500554_079357 Ga0500554_079357_688_999 100
319 3300053122 Ga0500608_008714 Ga0500608_008714_1982_2293 100
320 3300053134 Ga0500658_0002823 Ga0500658_0002823_5135_5440 100
321 3300053134 Ga0500658_0009163 Ga0500658_0009163_3280_3591 100
322 3300053136 Ga0500559_0000072 Ga0500559_0000072_55693_56004 100
323 3300053138 Ga0500564_244453 Ga0500564_244453_216_527 100
324 3300053139 Ga0500568_0006889 Ga0500568_0006889_5156_5461 100
325 3300053157 Ga0500624_083533 Ga0500624_083533_214_525 100
326 3300053160 Ga0500633_0135724 Ga0500633_0135724_528_833 100

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07045

DUF1330

Domain of unknown function (DUF1330)

27

119

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fiu-assembly1.cif.gz_B crystal structure of the conserved protein of unknown function atu0297 from agrobacterium tumefaciens 0.9538 1 95
2fiu-assembly1.cif.gz_B crystal structure of the conserved protein of unknown function atu0297 from agrobacterium tumefaciens 0.9349 1 95
3lo3-assembly2.cif.gz_C the crystal structure of a conserved functionally unknown protein from colwellia psychrerythraea 34h. 0.9246 3 92
3lo3-assembly2.cif.gz_C the crystal structure of a conserved functionally unknown protein from colwellia psychrerythraea 34h. 0.8784 3 92
3dca-assembly2.cif.gz_D crystal structure of the rpa0582- protein of unknown function from rhodopseudomonas palustris- a structural genomics target 0.7556 2 97
ID Description Score Start End Superfamily
2fiuB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9442 3 90 3.30.70.100
2fiuB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8864 3 90 3.30.70.100
3lo3U00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.864 3 90 3.30.70.100
3lo3U00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8128 3 90 3.30.70.100
af_A0A1D6PLI0_180_283_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7553 2 95 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A2E1UK82-F1-model_v4 DUF1330 domain-containing protein 0.983 1 95
AF-A0A0J1HEI5-F1-model_v4 DUF1330 domain-containing protein 0.9768 3 95
AF-A0A251WW12-F1-model_v4 DUF1330 domain-containing protein 0.9761 1 95
AF-A0A355T6D6-F1-model_v4 DUF1330 domain-containing protein 0.9758 1 95
AF-A0A1D9ME47-F1-model_v4 DUF1330 domain-containing protein 0.9749 1 95

Feature Viewer

pLDDT pTM Quality
94.63 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map