F408554

General Info

Members Datasets Scaffolds Average Seq Length
326 235 652 218

Family's Representative Sequence

Representative Sequence 3300050511|nmdc:mga08y16_108551_c1|nmdc:mga08y16_108551_c1_646_1350
Length 234
Sequence LHDRHGLAADAGKGDTVNGVHDMGGMHGFGKVAPDADERPFHATWEARVLAMQRAIRFARAWNIDMSRDAIERQPPQRYLAASYYERWLMGMETSAVEKGLIDPDEIAAGHALRPGKSVARVMTKDDLGRPFTRGSFSRPPGHEARFKPGDRVRTKNINPATHTRLPRYARGREGLVEAVRGCHVFPDSVVTGHGEDPQWLYTVVFNGRQLWGANADPTLTVSIEAFEPYLEPA

Samples

Sample ID Description Type Environment
1 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
61 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
62 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
95 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
96 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
97 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
98 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
99 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
102 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
103 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
104 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
105 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
106 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
107 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
108 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
109 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
110 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
111 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
112 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
114 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
115 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
123 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
124 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
125 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
126 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
127 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
128 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
129 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
130 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
131 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
132 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
133 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
134 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
135 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
136 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
137 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
151 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
152 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
153 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
154 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
157 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
158 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
161 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
165 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
166 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
167 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
172 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
173 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
198 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
199 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
202 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
209 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
210 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
211 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
216 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
217 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
218 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
219 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
220 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
221 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
222 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
223 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
224 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
225 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
226 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
227 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
228 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
229 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
230 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
231 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
232 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
233 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
234 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
235 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.25
Metatranscriptomes 1.53
Isolates 5.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.52
Nodule 4.91
Rhizoplane 4.29
Rhizosphere 80.98
Stem 0
Stem Tuber 0
Unclassified 1.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08y16_108551_c1 3300050511 Bacteria 2889
2 JGI25150J39212_1026819 3300002774 Bacteria 829
3 JGI25153J46596_10012635 3300003215 Bacteria 3623
4 rootH2_10146089 3300003320 Bacteria 1926
5 Ga0070683_100001608 3300005329 Bacteria 17476
6 Ga0070683_100015944 3300005329 Bacteria 6610
7 Ga0070680_100056092 3300005336 Bacteria 3220
8 Ga0070680_100069534 3300005336 Bacteria 2891
9 Ga0070680_100134866 3300005336 Bacteria 2067
10 Ga0070680_101041030 3300005336 Bacteria 707
11 Ga0070682_100102011 3300005337 Bacteria 1896
12 Ga0070660_100040560 3300005339 Bacteria 3544
13 Ga0070668_100377450 3300005347 Bacteria 1206
14 Ga0070668_100911472 3300005347 Bacteria 786
15 Ga0070659_100146871 3300005366 Bacteria 1922
16 Ga0070709_10015246 3300005434 Bacteria 4368
17 Ga0070714_100060015 3300005435 Bacteria 3263
18 Ga0070714_100502743 3300005435 Bacteria 1156
19 Ga0070714_100936044 3300005435 Unclassified 842
20 Ga0070713_100022472 3300005436 Bacteria 4875
21 Ga0070713_100063046 3300005436 Bacteria 3106
22 Ga0070710_10019648 3300005437 Bacteria 3494
23 Ga0070708_100013114 3300005445 Bacteria 6780
24 Ga0070708_100354510 3300005445 Bacteria 1383
25 Ga0070662_100028313 3300005457 Bacteria 3898
26 Ga0070681_10017891 3300005458 Bacteria 7084
27 Ga0070681_10053558 3300005458 Bacteria 4022
28 Ga0070681_10225318 3300005458 Bacteria 1789
29 Ga0070681_10283441 3300005458 Bacteria 1568
30 Ga0070698_100952125 3300005471 Bacteria 805
31 Ga0070699_100093645 3300005518 Bacteria 2629
32 Ga0070699_100219116 3300005518 Bacteria 1696
33 Ga0070679_100011783 3300005530 Bacteria 8337
34 Ga0070679_100221158 3300005530 Bacteria 1854
35 Ga0070679_100670366 3300005530 Bacteria 980
36 Ga0070684_100007537 3300005535 Bacteria 8472
37 Ga0068853_100281599 3300005539 Bacteria 1533
38 Ga0070696_100066189 3300005546 Bacteria 2534
39 Ga0070696_100262068 3300005546 Bacteria 1311
40 Ga0070704_100203707 3300005549 Bacteria 1599
41 Ga0068855_100180461 3300005563 Bacteria 2387
42 Ga0068855_101084421 3300005563 Bacteria 838
43 Ga0068855_101102423 3300005563 Bacteria 830
44 Ga0070664_100041947 3300005564 Bacteria 3863
45 Ga0068857_100216143 3300005577 Bacteria 1750
46 Ga0068856_100032045 3300005614 Bacteria 5144
47 Ga0068862_100446355 3300005844 Bacteria 1218
48 Ga0081538_10005426 3300005981 Bacteria 11450
49 Ga0070717_10819573 3300006028 Bacteria 847
50 Ga0075365_10013262 3300006038 Bacteria 4918
51 Ga0075363_100012491 3300006048 Bacteria 4096
52 Ga0070716_100035211 3300006173 Bacteria 2752
53 Ga0075362_10027315 3300006177 Bacteria 2443
54 Ga0075367_10232684 3300006178 Bacteria 1154
55 Ga0075366_10012090 3300006195 Bacteria 4888
56 Ga0075366_10043820 3300006195 Bacteria 2651
57 Ga0075366_10082806 3300006195 Bacteria 1917
58 Ga0075366_10127064 3300006195 Bacteria 1538
59 Ga0075428_100456882 3300006844 Bacteria 1368
60 Ga0075433_10061418 3300006852 Bacteria 3292
61 Ga0075433_10629685 3300006852 Bacteria 941
62 Ga0075434_100008357 3300006871 Bacteria 9621
63 Ga0075434_100068375 3300006871 Bacteria 3538
64 Ga0075434_100095903 3300006871 Bacteria 2971
65 Ga0075435_100118501 3300007076 Bacteria 2207
66 Ga0075435_100284802 3300007076 Bacteria 1411
67 Ga0099794_10140065 3300007265 Bacteria 1225
68 Ga0099794_10169612 3300007265 Bacteria 1112
69 Ga0105240_10638871 3300009093 Bacteria 1168
70 Ga0111539_10012470 3300009094 Bacteria 10653
71 Ga0111539_10043093 3300009094 Bacteria 5413
72 Ga0111539_10138316 3300009094 Bacteria 2852
73 Ga0105241_10270998 3300009174 Bacteria 1446
74 Ga0105242_10250740 3300009176 Bacteria 1595
75 Ga0105248_10248101 3300009177 Unclassified 2004
76 Ga0105248_10879327 3300009177 Bacteria 1012
77 Ga0105238_10367370 3300009551 Bacteria 1429
78 Ga0105238_10484839 3300009551 Bacteria 1236
79 Ga0105249_10160733 3300009553 Bacteria 2171
80 Ga0123341_1000032 3300009765 Bacteria 62527
81 Ga0105239_10181054 3300010375 Bacteria 2358
82 Ga0157371_10256091 3300013102 Bacteria 1261
83 Ga0157370_10201241 3300013104 Bacteria 1847
84 Ga0157369_10010521 3300013105 Bacteria 10531
85 Ga0157369_10017675 3300013105 Bacteria 8011
86 Ga0163162_10639574 3300013306 Bacteria 1188
87 Ga0157372_10522658 3300013307 Bacteria 1383
88 Ga0157375_10292035 3300013308 Bacteria 1793
89 Ga0157375_10420863 3300013308 Bacteria 1502
90 Ga0182008_10008948 3300014497 Bacteria 5430
91 Ga0157379_10025417 3300014968 Bacteria 5261
92 Ga0182007_10015781 3300015262 Bacteria 2805
93 Ga0183362_10001 3300015683 Bacteria 2046624
94 Ga0206356_10188264 3300020070 Bacteria 1725
95 Ga0206354_10605015 3300020081 Bacteria 1873
96 Ga0206353_10571089 3300020082 Bacteria 1975
97 Ga0213876_10062569 3300021384 Bacteria 1965
98 Ga0213876_10134337 3300021384 Bacteria 1316
99 Ga0224712_10032637 3300022467 Bacteria 1899
100 Ga0224712_10073835 3300022467 Bacteria 1392
101 Ga0207692_10010022 3300025898 Bacteria 3976
102 Ga0207692_10198697 3300025898 Unclassified 1178
103 Ga0207699_10167177 3300025906 Bacteria 1469
104 Ga0207645_10231622 3300025907 Bacteria 1219
105 Ga0207684_10016995 3300025910 Bacteria 6250
106 Ga0207684_10644960 3300025910 Bacteria 902
107 Ga0207707_10000413 3300025912 Bacteria 44774
108 Ga0207695_10345096 3300025913 Bacteria 1376
109 Ga0207660_10046798 3300025917 Bacteria 3055
110 Ga0207660_10147019 3300025917 Bacteria 1807
111 Ga0207662_10514564 3300025918 Bacteria 825
112 Ga0207657_10122597 3300025919 Bacteria 2138
113 Ga0207652_10011754 3300025921 Bacteria 7066
114 Ga0207652_10148643 3300025921 Bacteria 2097
115 Ga0207646_10292998 3300025922 Bacteria 1470
116 Ga0207694_10343681 3300025924 Bacteria 1234
117 Ga0207694_10489469 3300025924 Bacteria 1029
118 Ga0207700_10015504 3300025928 Bacteria 5030
119 Ga0207700_10043098 3300025928 Bacteria 3313
120 Ga0207700_10049400 3300025928 Bacteria 3129
121 Ga0207664_10002993 3300025929 Bacteria 11226
122 Ga0207664_10093993 3300025929 Bacteria 2464
123 Ga0207664_10404872 3300025929 Bacteria 1214
124 Ga0207690_10310574 3300025932 Bacteria 1236
125 Ga0207706_10030364 3300025933 Bacteria 4821
126 Ga0207709_10311070 3300025935 Bacteria 1175
127 Ga0207661_10000177 3300025944 Bacteria 41089
128 Ga0207679_10055630 3300025945 Bacteria 2918
129 Ga0207667_10152549 3300025949 Bacteria 2378
130 Ga0207712_10129893 3300025961 Bacteria 1918
131 Ga0207678_10023718 3300026067 Bacteria 5366
132 Ga0207702_10043097 3300026078 Bacteria 3788
133 Ga0207674_10040678 3300026116 Bacteria 4814
134 Ga0207683_10303009 3300026121 Bacteria 1462
135 Ga0207428_10133019 3300027907 Bacteria 1902
136 Ga0268265_10503757 3300028380 Bacteria 1141
137 Ga0307515_10000291 3300028794 Bacteria 123206
138 Ga0307515_10215205 3300028794 Bacteria 1754
139 Ga0265328_10000986 3300031239 Bacteria 13075
140 Ga0265325_10045164 3300031241 Bacteria 2290
141 Ga0265325_10052799 3300031241 Bacteria 2086
142 Ga0265340_10016673 3300031247 Bacteria 3802
143 Ga0265340_10031039 3300031247 Bacteria 2674
144 Ga0265339_10009983 3300031249 Bacteria 5924
145 Ga0265339_10024316 3300031249 Bacteria 3492
146 Ga0265316_10232559 3300031344 Bacteria 1357
147 Ga0307408_100664339 3300031548 Bacteria 933
148 Ga0265313_10010025 3300031595 Bacteria 6064
149 Ga0265313_10039445 3300031595 Bacteria 2342
150 Ga0265313_10047456 3300031595 Bacteria 2078
151 Ga0265313_10158294 3300031595 Bacteria 963
152 Ga0265314_10054403 3300031711 Bacteria 2770
153 Ga0265342_10015210 3300031712 Bacteria 5072
154 Ga0265342_10067980 3300031712 Bacteria 2083
155 Ga0265342_10091579 3300031712 Bacteria 1742
156 Ga0265342_10222980 3300031712 Bacteria 1015
157 Ga0316583_10181979 3300032133 Bacteria 731
158 Ga0373926_0147937 3300035083 Bacteria 894
159 Ga0373934_0228826 3300035086 Bacteria 767
160 Ga0373936_0116242 3300035113 Bacteria 1139
161 Ga0373945_0062564 3300035116 Bacteria 1392
162 Ga0373957_0009174 3300035120 Bacteria 3230
163 Ga0373924_0067534 3300035410 Bacteria 1504
164 Ga0373931_0350261 3300035691 Bacteria 924
165 Ga0373931_0437627 3300035691 Bacteria 834
166 Ga0373935_0010830 3300035692 Bacteria 5478
167 Ga0373935_0246917 3300035692 Bacteria 1248
168 Ga0373927_0284529 3300035695 Bacteria 1088
169 Ga0373933_0116302 3300035724 Bacteria 1672
170 Ga0373947_0043394 3300035725 Bacteria 2686
171 Ga0373947_0146513 3300035725 Bacteria 1518
172 Ga0373937_0016847 3300036401 Bacteria 6497
173 Ga0373937_0022898 3300036401 Bacteria 5618
174 Ga0373937_0083135 3300036401 Bacteria 2962
175 Ga0373925_0013070 3300037068 Bacteria 6010
176 Ga0373925_0167077 3300037068 Bacteria 1735
177 Ga0373925_0294457 3300037068 Bacteria 1309
178 Ga0395900_0120747 3300037418 Bacteria 2689
179 Ga0395898_0195966 3300037466 Bacteria 1929
180 Ga0436364_1270533 3300037853 Bacteria 1347
181 Ga0436364_1420335 3300037853 Bacteria 2115
182 Ga0436364_1537052 3300037853 Bacteria 1016
183 Ga0436365_0605320 3300039437 Bacteria 5697
184 Ga0436365_1147128 3300039437 Bacteria 1505
185 Ga0436365_1524489 3300039437 Bacteria 2448
186 Ga0436363_0522951 3300039450 Bacteria 2066
187 Ga0436362_0502477 3300039453 Bacteria 1101
188 Ga0439465_0002658 3300041413 Bacteria 5837
189 Ga0451853_1152098 3300041512 Bacteria 5309
190 Ga0439431_0000244 3300041997 Bacteria 11026
191 Ga0439433_0005976 3300041999 Bacteria 2617
192 Ga0439442_002325 3300042002 Bacteria 3734
193 Ga0439445_0001130 3300042004 Bacteria 5710
194 Ga0439432_000895 3300042006 Bacteria 11191
195 Ga0439449_0000162 3300042007 Bacteria 22807
196 Ga0439452_001519 3300042010 Bacteria 9348
197 Ga0439462_0003521 3300042015 Bacteria 3761
198 Ga0439434_0004193 3300042435 Bacteria 4209
199 Ga0451577_0164023 3300042876 Bacteria 2002
200 Ga0453683_0221784 3300044673 Bacteria 1202
201 Ga0466966_0227713 3300044684 Bacteria 1125
202 Ga0466961_0106467 3300044693 Bacteria 1765
203 Ga0466963_0228257 3300044694 Bacteria 1304
204 Ga0466963_0300055 3300044694 Bacteria 1130
205 Ga0466971_0011780 3300044719 Bacteria 3831
206 Ga0466970_0286897 3300044765 Bacteria 926
207 Ga0466957_0143727 3300044842 Bacteria 1539
208 Ga0466957_0810968 3300044842 Bacteria 665
209 Ga0466959_0053628 3300045049 Bacteria 2947
210 Ga0451576_0893213 3300045051 Bacteria 932
211 Ga0466958_0046372 3300045836 Bacteria 2623
212 Ga0466967_0044754 3300045976 Bacteria 3842
213 Ga0466967_0126553 3300045976 Bacteria 2367
214 Ga0466967_0686751 3300045976 Bacteria 1013
215 Ga0495592_0041802 3300046454 Bacteria 3434
216 Ga0495629_0091006 3300046459 Bacteria 2129
217 Ga0495638_0045888 3300046460 Bacteria 2747
218 Ga0495651_0047311 3300046462 Bacteria 3326
219 Ga0495582_0050281 3300046473 Bacteria 2297
220 Ga0495662_0007417 3300046476 Bacteria 5421
221 Ga0495584_0028056 3300046491 Bacteria 2851
222 Ga0495584_0050245 3300046491 Bacteria 2100
223 Ga0495618_0204362 3300046514 Bacteria 1250
224 Ga0495628_0066760 3300046516 Bacteria 2811
225 Ga0495637_0041715 3300046520 Bacteria 1967
226 Ga0495642_0079178 3300046528 Bacteria 1382
227 Ga0495640_0011046 3300046533 Bacteria 6953
228 Ga0495640_0198273 3300046533 Bacteria 1273
229 Ga0495645_0087256 3300046543 Bacteria 2232
230 Ga0495622_0280262 3300046557 Bacteria 729
231 Ga0495634_0128684 3300046642 Bacteria 1616
232 Ga0495657_0238619 3300046675 Bacteria 1098
233 Ga0495599_0115237 3300046678 Bacteria 1672
234 Ga0495623_0016779 3300046679 Bacteria 4732
235 Ga0495646_0028099 3300046680 Bacteria 3524
236 Ga0495613_0387472 3300046689 Bacteria 955
237 Ga0495624_0180477 3300046690 Bacteria 1287
238 Ga0495600_0066789 3300046809 Bacteria 2351
239 Ga0495600_0202023 3300046809 Bacteria 1276
240 Ga0495604_0315279 3300047317 Bacteria 1046
241 Ga0495674_0092416 3300047319 Bacteria 2583
242 Ga0495680_0267247 3300047322 Bacteria 1208
243 Ga0495675_0048710 3300047444 Bacteria 2695
244 Ga0495686_0021343 3300047472 Bacteria 4303
245 Ga0496100_0288082 3300048903 Bacteria 1226
246 Ga0496103_0062306 3300048906 Bacteria 2321
247 Ga0496104_0124981 3300048907 Bacteria 2470
248 Ga0496104_0786859 3300048907 Bacteria 858
249 Ga0496105_0087983 3300048908 Bacteria 2566
250 Ga0496107_0381731 3300048910 Bacteria 1048
251 Ga0496108_0036378 3300048911 Bacteria 4096
252 Ga0496108_0332444 3300048911 Bacteria 1325
253 Ga0496109_0137408 3300048912 Bacteria 2284
254 Ga0496111_0239636 3300048914 Bacteria 1347
255 Ga0496112_0084073 3300048915 Bacteria 3148
256 Ga0496114_0556956 3300048917 Bacteria 1013
257 Ga0496115_0430918 3300048918 Bacteria 1067
258 Ga0496115_0554840 3300048918 Unclassified 918
259 Ga0501033_0139170 3300049570 Bacteria 1755
260 Ga0501034_0000621 3300049571 Bacteria 55508
261 Ga0501036_0111288 3300049572 Bacteria 2314
262 Ga0501036_0379891 3300049572 Bacteria 1179
263 Ga0501036_0549059 3300049572 Bacteria 960
264 Ga0501037_0095236 3300049573 Bacteria 2152
265 Ga0501038_0223595 3300049574 Bacteria 1501
266 Ga0501038_0356431 3300049574 Bacteria 1138
267 Ga0501039_0225174 3300049575 Bacteria 1474
268 Ga0501040_0032935 3300049576 Bacteria 3508
269 Ga0501042_0419440 3300049578 Bacteria 970
270 Ga0501043_0233243 3300049579 Bacteria 1421
271 Ga0501046_0219410 3300049580 Bacteria 1409
272 Ga0501047_0670544 3300049581 Bacteria 855
273 Ga0501048_0244360 3300049582 Bacteria 1274
274 Ga0501067_0095827 3300049583 Bacteria 1648
275 Ga0501068_0009667 3300049584 Bacteria 5399
276 Ga0501068_0106589 3300049584 Bacteria 1740
277 Ga0501069_0046905 3300049585 Bacteria 2398
278 Ga0501069_0324047 3300049585 Bacteria 906
279 Ga0501070_0138920 3300049586 Bacteria 2006
280 Ga0501075_0117704 3300049591 Bacteria 2020
281 Ga0501075_0268740 3300049591 Bacteria 1300
282 Ga0501077_0282097 3300049593 Bacteria 1057
283 Ga0501079_0294289 3300049741 Bacteria 1270
284 Ga0501080_0177834 3300049742 Bacteria 1960
285 Ga0501081_0148887 3300049743 Bacteria 1681
286 Ga0501035_0264764 3300049822 Bacteria 1456
287 Ga0501035_0816229 3300049822 Bacteria 744
288 Ga0501044_0017277 3300049823 Bacteria 7738
289 Ga0501044_0020472 3300049823 Bacteria 7064
290 Ga0501044_0053217 3300049823 Bacteria 4166
291 Ga0501044_0398091 3300049823 Bacteria 1290
292 nmdc:mga0yw44_292837_c1 3300050492 Bacteria 1090
293 nmdc:mga0k408_11282_c1 3300050493 Bacteria 4860
294 nmdc:mga0k408_39302_c1 3300050493 Bacteria 2717
295 nmdc:mga0k408_88940_c1 3300050493 Bacteria 1813
296 nmdc:mga06z11_245606_c1 3300050494 Bacteria 1052
297 nmdc:mga07m45_468321_c1 3300050496 Bacteria 730
298 nmdc:mga08y16_40606_c1 3300050511 Bacteria 4875
299 nmdc:mga08y16_77844_c1 3300050511 Bacteria 3457
300 nmdc:mga0n895_179119_c1 3300050512 Bacteria 2151
301 nmdc:mga0n895_434955_c1 3300050512 Bacteria 1325
302 nmdc:mga0n895_99800_c1 3300050512 Bacteria 2912
303 nmdc:mga0a205_13177_c1 3300050515 Bacteria 6670
304 nmdc:mga0a205_332744_c1 3300050515 Bacteria 1388
305 Ga0495601_0050137 3300053077 Bacteria 2632
306 Ga0495595_0115474 3300053084 Bacteria 1304
307 Ga0500577_0000103 3300053142 Bacteria 20439
308 Ga0500625_160333 3300053729 Bacteria 828
309 Ga0466962_0279731 3300061719 Bacteria 823
310 2509151711 2508501128 Bacteria 8613869
311 2510133874 2510065019 Bacteria 6903379
312 2513573651 2513237084 Bacteria 7231967
313 2513629479 2513237093 Bacteria 7545552
314 2513692210 2513237101 Bacteria 7952346
315 2517095753 2517093000 Bacteria 7412387
316 2517407318 2517287029 Bacteria 6905599
317 2725952641 2724679232 Bacteria 7646494
318 2856360460 2856356410 Bacteria 6297484
319 2881866829 2881861095 Bacteria 7128710
320 2885192555 2885192300 Bacteria 5882526
321 2924789208 2924784321 Bacteria 7416538
322 2936372125 2936367885 Bacteria 7324495
323 2936381071 2936375103 Bacteria 6652732
324 8005380845 8005376324 Bacteria 6590079
325 8005567908 8005563573 Bacteria 7153261
326 8024482949 8024479707 Bacteria 6954785
327 nmdc:mga08y16_108551_c1
328 JGI25150J39212_1026819
329 JGI25153J46596_10012635
330 rootH2_10146089
331 Ga0070683_100001608
332 Ga0070683_100015944
333 Ga0070680_100056092
334 Ga0070680_100069534
335 Ga0070680_100134866
336 Ga0070680_101041030
337 Ga0070682_100102011
338 Ga0070660_100040560
339 Ga0070668_100377450
340 Ga0070668_100911472
341 Ga0070659_100146871
342 Ga0070709_10015246
343 Ga0070714_100060015
344 Ga0070714_100502743
345 Ga0070714_100936044
346 Ga0070713_100022472
347 Ga0070713_100063046
348 Ga0070710_10019648
349 Ga0070708_100013114
350 Ga0070708_100354510
351 Ga0070662_100028313
352 Ga0070681_10017891
353 Ga0070681_10053558
354 Ga0070681_10225318
355 Ga0070681_10283441
356 Ga0070698_100952125
357 Ga0070699_100093645
358 Ga0070699_100219116
359 Ga0070679_100011783
360 Ga0070679_100221158
361 Ga0070679_100670366
362 Ga0070684_100007537
363 Ga0068853_100281599
364 Ga0070696_100066189
365 Ga0070696_100262068
366 Ga0070704_100203707
367 Ga0068855_100180461
368 Ga0068855_101084421
369 Ga0068855_101102423
370 Ga0070664_100041947
371 Ga0068857_100216143
372 Ga0068856_100032045
373 Ga0068862_100446355
374 Ga0081538_10005426
375 Ga0070717_10819573
376 Ga0075365_10013262
377 Ga0075363_100012491
378 Ga0070716_100035211
379 Ga0075362_10027315
380 Ga0075367_10232684
381 Ga0075366_10012090
382 Ga0075366_10043820
383 Ga0075366_10082806
384 Ga0075366_10127064
385 Ga0075428_100456882
386 Ga0075433_10061418
387 Ga0075433_10629685
388 Ga0075434_100008357
389 Ga0075434_100068375
390 Ga0075434_100095903
391 Ga0075435_100118501
392 Ga0075435_100284802
393 Ga0099794_10140065
394 Ga0099794_10169612
395 Ga0105240_10638871
396 Ga0111539_10012470
397 Ga0111539_10043093
398 Ga0111539_10138316
399 Ga0105241_10270998
400 Ga0105242_10250740
401 Ga0105248_10248101
402 Ga0105248_10879327
403 Ga0105238_10367370
404 Ga0105238_10484839
405 Ga0105249_10160733
406 Ga0123341_1000032
407 Ga0105239_10181054
408 Ga0157371_10256091
409 Ga0157370_10201241
410 Ga0157369_10010521
411 Ga0157369_10017675
412 Ga0163162_10639574
413 Ga0157372_10522658
414 Ga0157375_10292035
415 Ga0157375_10420863
416 Ga0182008_10008948
417 Ga0157379_10025417
418 Ga0182007_10015781
419 Ga0183362_10001
420 Ga0206356_10188264
421 Ga0206354_10605015
422 Ga0206353_10571089
423 Ga0213876_10062569
424 Ga0213876_10134337
425 Ga0224712_10032637
426 Ga0224712_10073835
427 Ga0207692_10010022
428 Ga0207692_10198697
429 Ga0207699_10167177
430 Ga0207645_10231622
431 Ga0207684_10016995
432 Ga0207684_10644960
433 Ga0207707_10000413
434 Ga0207695_10345096
435 Ga0207660_10046798
436 Ga0207660_10147019
437 Ga0207662_10514564
438 Ga0207657_10122597
439 Ga0207652_10011754
440 Ga0207652_10148643
441 Ga0207646_10292998
442 Ga0207694_10343681
443 Ga0207694_10489469
444 Ga0207700_10015504
445 Ga0207700_10043098
446 Ga0207700_10049400
447 Ga0207664_10002993
448 Ga0207664_10093993
449 Ga0207664_10404872
450 Ga0207690_10310574
451 Ga0207706_10030364
452 Ga0207709_10311070
453 Ga0207661_10000177
454 Ga0207679_10055630
455 Ga0207667_10152549
456 Ga0207712_10129893
457 Ga0207678_10023718
458 Ga0207702_10043097
459 Ga0207674_10040678
460 Ga0207683_10303009
461 Ga0207428_10133019
462 Ga0268265_10503757
463 Ga0307515_10000291
464 Ga0307515_10215205
465 Ga0265328_10000986
466 Ga0265325_10045164
467 Ga0265325_10052799
468 Ga0265340_10016673
469 Ga0265340_10031039
470 Ga0265339_10009983
471 Ga0265339_10024316
472 Ga0265316_10232559
473 Ga0307408_100664339
474 Ga0265313_10010025
475 Ga0265313_10039445
476 Ga0265313_10047456
477 Ga0265313_10158294
478 Ga0265314_10054403
479 Ga0265342_10015210
480 Ga0265342_10067980
481 Ga0265342_10091579
482 Ga0265342_10222980
483 Ga0316583_10181979
484 Ga0373926_0147937
485 Ga0373934_0228826
486 Ga0373936_0116242
487 Ga0373945_0062564
488 Ga0373957_0009174
489 Ga0373924_0067534
490 Ga0373931_0350261
491 Ga0373931_0437627
492 Ga0373935_0010830
493 Ga0373935_0246917
494 Ga0373927_0284529
495 Ga0373933_0116302
496 Ga0373947_0043394
497 Ga0373947_0146513
498 Ga0373937_0016847
499 Ga0373937_0022898
500 Ga0373937_0083135
501 Ga0373925_0013070
502 Ga0373925_0167077
503 Ga0373925_0294457
504 Ga0395900_0120747
505 Ga0395898_0195966
506 Ga0436364_1270533
507 Ga0436364_1420335
508 Ga0436364_1537052
509 Ga0436365_0605320
510 Ga0436365_1147128
511 Ga0436365_1524489
512 Ga0436363_0522951
513 Ga0436362_0502477
514 Ga0439465_0002658
515 Ga0451853_1152098
516 Ga0439431_0000244
517 Ga0439433_0005976
518 Ga0439442_002325
519 Ga0439445_0001130
520 Ga0439432_000895
521 Ga0439449_0000162
522 Ga0439452_001519
523 Ga0439462_0003521
524 Ga0439434_0004193
525 Ga0451577_0164023
526 Ga0453683_0221784
527 Ga0466966_0227713
528 Ga0466961_0106467
529 Ga0466963_0228257
530 Ga0466963_0300055
531 Ga0466971_0011780
532 Ga0466970_0286897
533 Ga0466957_0143727
534 Ga0466957_0810968
535 Ga0466959_0053628
536 Ga0451576_0893213
537 Ga0466958_0046372
538 Ga0466967_0044754
539 Ga0466967_0126553
540 Ga0466967_0686751
541 Ga0495592_0041802
542 Ga0495629_0091006
543 Ga0495638_0045888
544 Ga0495651_0047311
545 Ga0495582_0050281
546 Ga0495662_0007417
547 Ga0495584_0028056
548 Ga0495584_0050245
549 Ga0495618_0204362
550 Ga0495628_0066760
551 Ga0495637_0041715
552 Ga0495642_0079178
553 Ga0495640_0011046
554 Ga0495640_0198273
555 Ga0495645_0087256
556 Ga0495622_0280262
557 Ga0495634_0128684
558 Ga0495657_0238619
559 Ga0495599_0115237
560 Ga0495623_0016779
561 Ga0495646_0028099
562 Ga0495613_0387472
563 Ga0495624_0180477
564 Ga0495600_0066789
565 Ga0495600_0202023
566 Ga0495604_0315279
567 Ga0495674_0092416
568 Ga0495680_0267247
569 Ga0495675_0048710
570 Ga0495686_0021343
571 Ga0496100_0288082
572 Ga0496103_0062306
573 Ga0496104_0124981
574 Ga0496104_0786859
575 Ga0496105_0087983
576 Ga0496107_0381731
577 Ga0496108_0036378
578 Ga0496108_0332444
579 Ga0496109_0137408
580 Ga0496111_0239636
581 Ga0496112_0084073
582 Ga0496114_0556956
583 Ga0496115_0430918
584 Ga0496115_0554840
585 Ga0501033_0139170
586 Ga0501034_0000621
587 Ga0501036_0111288
588 Ga0501036_0379891
589 Ga0501036_0549059
590 Ga0501037_0095236
591 Ga0501038_0223595
592 Ga0501038_0356431
593 Ga0501039_0225174
594 Ga0501040_0032935
595 Ga0501042_0419440
596 Ga0501043_0233243
597 Ga0501046_0219410
598 Ga0501047_0670544
599 Ga0501048_0244360
600 Ga0501067_0095827
601 Ga0501068_0009667
602 Ga0501068_0106589
603 Ga0501069_0046905
604 Ga0501069_0324047
605 Ga0501070_0138920
606 Ga0501075_0117704
607 Ga0501075_0268740
608 Ga0501077_0282097
609 Ga0501079_0294289
610 Ga0501080_0177834
611 Ga0501081_0148887
612 Ga0501035_0264764
613 Ga0501035_0816229
614 Ga0501044_0017277
615 Ga0501044_0020472
616 Ga0501044_0053217
617 Ga0501044_0398091
618 nmdc:mga0yw44_292837_c1
619 nmdc:mga0k408_11282_c1
620 nmdc:mga0k408_39302_c1
621 nmdc:mga0k408_88940_c1
622 nmdc:mga06z11_245606_c1
623 nmdc:mga07m45_468321_c1
624 nmdc:mga08y16_40606_c1
625 nmdc:mga08y16_77844_c1
626 nmdc:mga0n895_179119_c1
627 nmdc:mga0n895_434955_c1
628 nmdc:mga0n895_99800_c1
629 nmdc:mga0a205_13177_c1
630 nmdc:mga0a205_332744_c1
631 Ga0495601_0050137
632 Ga0495595_0115474
633 Ga0500577_0000103
634 Ga0500625_160333
635 Ga0466962_0279731
636 2509151711
637 2510133874
638 2513573651
639 2513629479
640 2513692210
641 2517095753
642 2517407318
643 2725952641
644 2856360460
645 2881866829
646 2885192555
647 2924789208
648 2936372125
649 2936381071
650 8005380845
651 8005567908
652 8024482949

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02211

NHase_beta_C

Nitrile hydratase beta subunit, C-terminal

136

233

0.97

PF21006

NHase_beta_N

Nitrile hydratase beta subunit, N-terminal

17

130

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qxe-assembly3.cif.gz_F crystal structure of co-type nitrile hydratase from pseudomonas putida. 0.9114 1 219
3qyg-assembly4.cif.gz_H crystal structure of co-type nitrile hydratase beta-e56q from pseudomonas putida. 0.9108 1 219
3qyh-assembly2.cif.gz_D crystal structure of co-type nitrile hydratase beta-h71l from pseudomonas putida. 0.9048 1 219
3qz9-assembly4.cif.gz_H crystal structure of co-type nitrile hydratase beta-y215f from pseudomonas putida. 0.9037 1 219
1v29-assembly1.cif.gz_B-2 crystal structure of nitrile hydratase from a thermophile bacillus smithii 0.8605 1 219
ID Description Score Start End Superfamily
4ob3B02 Mainly Beta;Roll;SH3 type barrels.; 0.9429 123 218 2.30.30.50
3hhtB02 Mainly Beta;Roll;SH3 type barrels.; 0.9406 124 219 2.30.30.50
3qxeB02 Mainly Beta;Roll;SH3 type barrels.; 0.9325 124 219 2.30.30.50
3hhtB02 Mainly Beta;Roll;SH3 type barrels.; 0.9219 124 219 2.30.30.50
3qxeB02 Mainly Beta;Roll;SH3 type barrels.; 0.9057 124 219 2.30.30.50
ID Description Score Start End GO Terms
AF-A0A7W0JMP0-F1-model_v4 Nitrile hydratase subunit beta 0.9544 20 93
AF-A0A527ZDG4-F1-model_v4 Nitrile hydratase subunit beta 0.9501 153 219
AF-A0A1Q7BLX7-F1-model_v4 Nitrile hydratase subunit beta (NHase) (EC 4.2.1.84) 0.9447 1 219 GO:0046914
GO:0080109
AF-A0A7Y0KKE5-F1-model_v4 Nitrile hydratase subunit beta 0.9409 132 219
AF-A0A1Q7BLX7-F1-model_v4 Nitrile hydratase subunit beta (NHase) (EC 4.2.1.84) 0.9406 1 219 GO:0046914
GO:0080109

Map