F408564

General Info

Members Datasets Scaffolds Average Seq Length
326 202 652 242

Family's Representative Sequence

Representative Sequence 3300053148|Ga0500590_099383|Ga0500590_099383_439_1266
Length 275
Sequence VRVRLIEQTVRSLRKTTFAIGCGDLACYGSAVLRSVRFAKRAIDVAGAALGLALTAPLVPVIAAAIYLDSPGPVFYRQRRAGSLKSIKTENGKKQFQFDEFEMHKFRTMVQNAEAKTGVVVAGANDARITRVGKFLRKSRLDELPQFWDVLRGKMSLVGPRPERPELLQDLSYAIPLFEERMRDVKPGITGLAQISLGYTGSIPEGSEIAKLASTLQNPWQLDETKGSLADDMRIKLLYDLAYTASLERFDTFLRTELGIIFKTPLVMLRMTQGR

Samples

Sample ID Description Type Environment
1 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
74 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
75 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
76 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
79 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
80 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
81 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
82 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
83 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
84 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
85 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
86 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
87 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
88 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
91 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
92 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
98 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
99 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
100 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
101 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
102 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
103 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
106 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
110 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
113 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
121 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
122 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
123 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
124 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
128 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
129 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
132 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
133 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
134 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
135 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
136 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
139 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
147 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
158 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
159 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
166 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
167 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
168 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
169 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
170 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
184 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
185 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
186 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
187 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
188 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
189 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
190 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
191 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
192 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
193 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
194 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
195 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
196 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
197 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
198 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
199 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
200 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
201 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.67
Nodule 0
Rhizoplane 2.15
Rhizosphere 86.2
Stem 0
Stem Tuber 0
Unclassified 0.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500590_099383 3300053148 Bacteria 1400
2 Ga0070658_10052190 3300005327 Bacteria 3315
3 Ga0070683_100113290 3300005329 Bacteria 2560
4 Ga0070683_100384165 3300005329 Bacteria 1338
5 Ga0070690_100002668 3300005330 Bacteria 9619
6 Ga0070670_100024072 3300005331 Bacteria 5238
7 Ga0070680_100019359 3300005336 Bacteria 5393
8 Ga0070682_100042425 3300005337 Bacteria 2808
9 Ga0070682_100212380 3300005337 Bacteria 1372
10 Ga0068868_100202629 3300005338 Bacteria 1655
11 Ga0070689_100010737 3300005340 Bacteria 6539
12 Ga0070687_100177861 3300005343 Bacteria 1272
13 Ga0070675_100073898 3300005354 Bacteria 2831
14 Ga0070673_100028337 3300005364 Bacteria 4164
15 Ga0070673_100237549 3300005364 Bacteria 1583
16 Ga0070667_100054714 3300005367 Bacteria 3370
17 Ga0070713_100981228 3300005436 Bacteria 815
18 Ga0070694_100109381 3300005444 Bacteria 1967
19 Ga0070708_100376814 3300005445 Bacteria 1338
20 Ga0070681_10023767 3300005458 Bacteria 6170
21 Ga0070681_10028246 3300005458 Bacteria 5639
22 Ga0070706_100054060 3300005467 Bacteria 3707
23 Ga0070706_100191650 3300005467 Bacteria 1910
24 Ga0070707_100014594 3300005468 Bacteria 7367
25 Ga0070698_100001757 3300005471 Bacteria 24186
26 Ga0070698_100084419 3300005471 Bacteria 3164
27 Ga0070679_100000889 3300005530 Bacteria 25938
28 Ga0070679_100021648 3300005530 Bacteria 6277
29 Ga0070679_100026290 3300005530 Bacteria 5716
30 Ga0070679_100067941 3300005530 Bacteria 3555
31 Ga0070695_100291557 3300005545 Bacteria 1203
32 Ga0070665_100095269 3300005548 Bacteria 2981
33 Ga0070665_100226915 3300005548 Bacteria 1868
34 Ga0070665_100325072 3300005548 Bacteria 1542
35 Ga0070704_100077735 3300005549 Bacteria 2432
36 Ga0068855_100002037 3300005563 Bacteria 25057
37 Ga0068855_100171783 3300005563 Bacteria 2454
38 Ga0068856_100049678 3300005614 Bacteria 4134
39 Ga0068856_100207324 3300005614 Bacteria 1975
40 Ga0068856_100354529 3300005614 Bacteria 1486
41 Ga0070702_100103835 3300005615 Bacteria 1749
42 Ga0068852_100071439 3300005616 Bacteria 3048
43 Ga0068859_100012364 3300005617 Bacteria 8585
44 Ga0068859_101133694 3300005617 Bacteria 861
45 Ga0068861_100065345 3300005719 Bacteria 2802
46 Ga0068863_100049950 3300005841 Bacteria 3966
47 Ga0068863_100318665 3300005841 Bacteria 1510
48 Ga0068862_100379077 3300005844 Bacteria 1319
49 Ga0081455_10202705 3300005937 Bacteria 1484
50 Ga0070717_10021980 3300006028 Bacteria 5034
51 Ga0070717_10056055 3300006028 Bacteria 3254
52 Ga0070717_10600268 3300006028 Bacteria 998
53 Ga0075366_10027411 3300006195 Bacteria 3342
54 Ga0075366_10213971 3300006195 Bacteria 1173
55 Ga0068871_100795435 3300006358 Bacteria 871
56 Ga0075430_100160684 3300006846 Bacteria 1870
57 Ga0075430_100627104 3300006846 Bacteria 887
58 Ga0075431_100190253 3300006847 Bacteria 2103
59 Ga0075429_100006613 3300006880 Bacteria 10042
60 Ga0075429_100052240 3300006880 Bacteria 3556
61 Ga0075429_100055199 3300006880 Bacteria 3457
62 Ga0097620_100012364 3300006931 Bacteria 8585
63 Ga0097620_101133772 3300006931 Bacteria 861
64 Ga0075435_100365643 3300007076 Bacteria 1238
65 Ga0105240_10112396 3300009093 Bacteria 3293
66 Ga0105240_10578494 3300009093 Bacteria 1239
67 Ga0111539_10001893 3300009094 Bacteria 27846
68 Ga0111539_10005895 3300009094 Bacteria 15831
69 Ga0111539_10047018 3300009094 Bacteria 5159
70 Ga0111539_10420595 3300009094 Bacteria 1556
71 Ga0105245_10000065 3300009098 Bacteria 109701
72 Ga0114129_10810181 3300009147 Bacteria 1194
73 Ga0114129_10846344 3300009147 Bacteria 1163
74 Ga0105242_10698078 3300009176 Bacteria 992
75 Ga0105248_10361744 3300009177 Bacteria 1634
76 Ga0105248_10537596 3300009177 Bacteria 1318
77 Ga0105237_10222462 3300009545 Bacteria 1888
78 Ga0105237_10362548 3300009545 Bacteria 1454
79 Ga0105249_10043198 3300009553 Bacteria 4100
80 Ga0157374_10154464 3300013296 Bacteria 2233
81 Ga0157374_10166742 3300013296 Bacteria 2147
82 Ga0157374_10369019 3300013296 Bacteria 1428
83 Ga0163163_10482901 3300014325 Bacteria 1300
84 Ga0207684_10092628 3300025910 Bacteria 2576
85 Ga0207684_10150551 3300025910 Bacteria 2002
86 Ga0207684_10308792 3300025910 Bacteria 1363
87 Ga0207707_10008037 3300025912 Bacteria 9162
88 Ga0207695_10124267 3300025913 Bacteria 2544
89 Ga0207671_10290155 3300025914 Bacteria 1291
90 Ga0207693_10140365 3300025915 Bacteria 1900
91 Ga0207662_10038851 3300025918 Bacteria 2790
92 Ga0207652_10035961 3300025921 Bacteria 4184
93 Ga0207646_10023976 3300025922 Bacteria 5596
94 Ga0207687_10000296 3300025927 Bacteria 34119
95 Ga0207700_10397081 3300025928 Bacteria 1208
96 Ga0207689_10026107 3300025942 Bacteria 4891
97 Ga0207667_10058164 3300025949 Bacteria 4056
98 Ga0207667_10504643 3300025949 Bacteria 1227
99 Ga0207667_10509211 3300025949 Bacteria 1220
100 Ga0207651_10230289 3300025960 Bacteria 1504
101 Ga0207702_10060121 3300026078 Bacteria 3239
102 Ga0207702_10170475 3300026078 Bacteria 1995
103 Ga0207702_10182850 3300026078 Bacteria 1932
104 Ga0207702_10729816 3300026078 Bacteria 977
105 Ga0207641_10042214 3300026088 Bacteria 3825
106 Ga0207676_10407411 3300026095 Bacteria 1272
107 Ga0207675_100039956 3300026118 Bacteria 4378
108 Ga0207428_10004017 3300027907 Bacteria 14117
109 Ga0268266_10003375 3300028379 Bacteria 15987
110 Ga0268266_10202238 3300028379 Bacteria 1818
111 Ga0268265_10192985 3300028380 Bacteria 1761
112 Ga0268264_10388443 3300028381 Bacteria 1338
113 Ga0265337_1030141 3300028556 Bacteria 1617
114 Ga0265334_10017173 3300028573 Bacteria 2993
115 Ga0265323_10001758 3300028653 Bacteria 10290
116 Ga0265323_10062556 3300028653 Bacteria 1291
117 Ga0307515_10009675 3300028794 Bacteria 18595
118 Ga0265338_10001915 3300028800 Bacteria 32492
119 Ga0265338_10074152 3300028800 Bacteria 2896
120 Ga0265330_10003037 3300031235 Bacteria 8904
121 Ga0265330_10007441 3300031235 Bacteria 5335
122 Ga0265332_10077829 3300031238 Bacteria 1408
123 Ga0265328_10000838 3300031239 Bacteria 14258
124 Ga0265320_10000286 3300031240 Bacteria 40906
125 Ga0265320_10015491 3300031240 Bacteria 4308
126 Ga0265320_10115152 3300031240 Bacteria 1229
127 Ga0265329_10027709 3300031242 Unclassified 1861
128 Ga0265339_10009354 3300031249 Bacteria 6166
129 Ga0265339_10010664 3300031249 Bacteria 5694
130 Ga0265339_10011810 3300031249 Bacteria 5358
131 Ga0265339_10059945 3300031249 Bacteria 2052
132 Ga0265331_10168694 3300031250 Bacteria 991
133 Ga0265316_10000272 3300031344 Bacteria 58100
134 Ga0265316_10008289 3300031344 Bacteria 9655
135 Ga0265316_10288270 3300031344 Bacteria 1198
136 Ga0307513_10004123 3300031456 Bacteria 19480
137 Ga0307513_10116436 3300031456 Bacteria 2652
138 Ga0307513_10362787 3300031456 Bacteria 1193
139 Ga0307509_10001691 3300031507 Bacteria 36868
140 Ga0307509_10003686 3300031507 Bacteria 22915
141 Ga0307509_10093909 3300031507 Bacteria 3060
142 Ga0307508_10119025 3300031616 Bacteria 2243
143 Ga0265314_10017755 3300031711 Bacteria 5574
144 Ga0265314_10027550 3300031711 Bacteria 4254
145 Ga0265314_10039597 3300031711 Bacteria 3392
146 Ga0265314_10111360 3300031711 Bacteria 1739
147 Ga0265342_10003445 3300031712 Bacteria 12982
148 Ga0265342_10005035 3300031712 Bacteria 10194
149 Ga0316576_10015758 3300031727 Bacteria 5081
150 Ga0307516_10043933 3300031730 Bacteria 4425
151 Ga0307405_10285167 3300031731 Bacteria 1245
152 Ga0316577_10001930 3300031733 Bacteria 10046
153 Ga0307406_10009138 3300031901 Bacteria 5550
154 Ga0307415_100008714 3300032126 Bacteria 5642
155 Ga0307415_100155653 3300032126 Bacteria 1764
156 Ga0373950_0000029 3300034818 Bacteria 165216
157 Ga0373950_0000093 3300034818 Bacteria 23645
158 Ga0373936_0000074 3300035113 Bacteria 39201
159 Ga0373945_0024049 3300035116 Bacteria 2108
160 Ga0373954_0003468 3300035118 Bacteria 6688
161 Ga0373954_0226141 3300035118 Bacteria 921
162 Ga0373956_0004068 3300035119 Bacteria 5866
163 Ga0373956_0049598 3300035119 Bacteria 1883
164 Ga0373956_0091783 3300035119 Bacteria 1402
165 Ga0373956_0291352 3300035119 Bacteria 777
166 Ga0373957_0023199 3300035120 Bacteria 2217
167 Ga0373957_0049573 3300035120 Bacteria 1603
168 Ga0373943_0003648 3300035170 Bacteria 6999
169 Ga0373955_0024635 3300035172 Bacteria 3079
170 Ga0373955_0099882 3300035172 Bacteria 1664
171 Ga0373961_0000002 3300035241 Bacteria 183638
172 Ga0373924_0013024 3300035410 Bacteria 3119
173 Ga0373931_0034997 3300035691 Bacteria 2609
174 Ga0373935_0094280 3300035692 Bacteria 1964
175 Ga0373927_0070393 3300035695 Bacteria 2264
176 Ga0373927_0142114 3300035695 Bacteria 1570
177 Ga0373933_0000307 3300035724 Bacteria 31632
178 Ga0373933_0029297 3300035724 Bacteria 3182
179 Ga0373933_0134457 3300035724 Bacteria 1557
180 Ga0373933_0254406 3300035724 Bacteria 1131
181 Ga0373937_0008754 3300036401 Bacteria 8782
182 Ga0373937_0027848 3300036401 Bacteria 5112
183 Ga0373937_0251762 3300036401 Bacteria 1665
184 Ga0316582_0166917 3300036647 Bacteria 1493
185 Ga0316584_0000575 3300036712 Bacteria 19836
186 Ga0373925_0013077 3300037068 Bacteria 6008
187 Ga0395899_0023053 3300037312 Bacteria 4717
188 Ga0395899_0138098 3300037312 Bacteria 1736
189 Ga0395900_0435001 3300037418 Bacteria 1270
190 Ga0395905_0236121 3300037471 Bacteria 1709
191 Ga0395901_0093021 3300038443 Bacteria 3156
192 Ga0395901_0146867 3300038443 Bacteria 2478
193 Ga0395901_0251309 3300038443 Bacteria 1842
194 Ga0436365_0648439 3300039437 Bacteria 1926
195 Ga0436365_1919931 3300039437 Bacteria 2027
196 Ga0436363_1055456 3300039450 Bacteria 917
197 Ga0436362_0400024 3300039453 Bacteria 894
198 Ga0451853_1704081 3300041512 Bacteria 2174
199 Ga0466972_0089444 3300044658 Bacteria 1461
200 Ga0466961_0292134 3300044693 Bacteria 997
201 Ga0453684_0040171 3300044712 Bacteria 6361
202 Ga0453684_0047670 3300044712 Bacteria 5678
203 Ga0453684_0202090 3300044712 Unclassified 2316
204 Ga0451576_0007471 3300045051 Bacteria 13044
205 Ga0466967_0550633 3300045976 Bacteria 1135
206 Ga0495650_0033019 3300046471 Bacteria 2308
207 Ga0495664_0027451 3300046477 Bacteria 3319
208 Ga0495618_0142768 3300046514 Bacteria 1531
209 Ga0495586_0027856 3300046535 Bacteria 3023
210 Ga0495634_0002324 3300046642 Bacteria 15911
211 Ga0495611_0134972 3300046648 Bacteria 1152
212 Ga0495657_0026055 3300046675 Bacteria 4146
213 Ga0495599_0165976 3300046678 Bacteria 1363
214 Ga0495649_0078702 3300046694 Bacteria 1764
215 Ga0495674_0007321 3300047319 Bacteria 10553
216 Ga0495672_0086688 3300047320 Bacteria 1731
217 Ga0495672_0220380 3300047320 Bacteria 937
218 Ga0495680_0027429 3300047322 Bacteria 4680
219 Ga0495686_0002836 3300047472 Bacteria 15658
220 Ga0495686_0172467 3300047472 Bacteria 1257
221 Ga0495602_0280870 3300048088 Bacteria 1227
222 Ga0496104_0002766 3300048907 Bacteria 15102
223 Ga0496104_0417538 3300048907 Bacteria 1254
224 Ga0496112_0372413 3300048915 Bacteria 1370
225 Ga0496114_0012211 3300048917 Bacteria 6873
226 Ga0496114_0062268 3300048917 Bacteria 3122
227 Ga0496114_0452434 3300048917 Bacteria 1137
228 Ga0496115_0020260 3300048918 Bacteria 5129
229 Ga0501292_000855 3300049515 Bacteria 3693
230 Ga0501315_002244 3300049531 Bacteria 1788
231 Ga0501032_0140753 3300049569 Bacteria 1589
232 Ga0501034_0000402 3300049571 Bacteria 73031
233 Ga0501034_0124873 3300049571 Bacteria 2559
234 Ga0501036_0035580 3300049572 Bacteria 4213
235 Ga0501036_0131226 3300049572 Bacteria 2115
236 Ga0501036_0341800 3300049572 Bacteria 1250
237 Ga0501037_0415660 3300049573 Bacteria 921
238 Ga0501042_0166374 3300049578 Bacteria 1591
239 Ga0501043_0001494 3300049579 Bacteria 20479
240 Ga0501043_0077878 3300049579 Bacteria 2605
241 Ga0501046_0003172 3300049580 Bacteria 15180
242 Ga0501047_0000002 3300049581 Bacteria 553775
243 Ga0501047_0003448 3300049581 Bacteria 14953
244 Ga0501047_0069558 3300049581 Bacteria 3389
245 Ga0501048_0038073 3300049582 Bacteria 3452
246 Ga0501067_0000061 3300049583 Bacteria 63208
247 Ga0501067_0234704 3300049583 Bacteria 1021
248 Ga0501068_0003263 3300049584 Bacteria 8692
249 Ga0501068_0058419 3300049584 Bacteria 2340
250 Ga0501069_0021578 3300049585 Bacteria 3497
251 Ga0501070_0000038 3300049586 Bacteria 121562
252 Ga0501070_0039527 3300049586 Bacteria 3935
253 Ga0501070_0050416 3300049586 Bacteria 3456
254 Ga0501070_0383975 3300049586 Bacteria 1137
255 Ga0501071_0018232 3300049587 Bacteria 4856
256 Ga0501072_0000054 3300049588 Bacteria 84065
257 Ga0501072_0380573 3300049588 Bacteria 1120
258 Ga0501073_0000316 3300049589 Bacteria 32120
259 Ga0501073_0001136 3300049589 Bacteria 19353
260 Ga0501073_0011380 3300049589 Bacteria 6509
261 Ga0501073_0048003 3300049589 Bacteria 2998
262 Ga0501073_0321862 3300049589 Bacteria 1067
263 Ga0501074_0000107 3300049590 Bacteria 40896
264 Ga0501074_0049767 3300049590 Bacteria 3025
265 Ga0501074_0065661 3300049590 Bacteria 2611
266 Ga0501074_0387513 3300049590 Bacteria 991
267 Ga0501077_0201690 3300049593 Bacteria 1264
268 Ga0501209_013889 3300049656 Bacteria 1755
269 Ga0501216_004493 3300049660 Bacteria 2073
270 Ga0501261_008413 3300049690 Bacteria 1332
271 Ga0501225_0013749 3300049705 Bacteria 2263
272 Ga0501079_0000223 3300049741 Bacteria 33810
273 Ga0501079_0452987 3300049741 Bacteria 1008
274 Ga0501080_0007614 3300049742 Bacteria 9790
275 Ga0501080_0028050 3300049742 Bacteria 5235
276 Ga0501080_0103064 3300049742 Bacteria 2646
277 Ga0501080_0220491 3300049742 Bacteria 1736
278 Ga0501080_0467554 3300049742 Bacteria 1129
279 Ga0501081_0107871 3300049743 Bacteria 1975
280 Ga0501081_0369301 3300049743 Bacteria 1059
281 Ga0501083_0001348 3300049744 Bacteria 16661
282 Ga0501083_0009526 3300049744 Bacteria 6861
283 Ga0501083_0032514 3300049744 Bacteria 3577
284 Ga0501267_005772 3300049764 Bacteria 1177
285 Ga0501044_0006939 3300049823 Bacteria 12465
286 Ga0501044_0436515 3300049823 Bacteria 1218
287 Ga0501044_0578375 3300049823 Bacteria 1018
288 nmdc:mga0k408_154080_c1 3300050493 Bacteria 1369
289 nmdc:mga0k408_220703_c1 3300050493 Bacteria 1132
290 nmdc:mga09592_148566_c1 3300050508 Bacteria 2021
291 nmdc:mga09592_1896_c1 3300050508 Bacteria 16823
292 nmdc:mga09592_76059_c1 3300050508 Bacteria 2855
293 nmdc:mga0qj67_50297_c1 3300050509 Bacteria 3295
294 nmdc:mga06r32_287117_c1 3300050510 Bacteria 1632
295 nmdc:mga08y16_159903_c1 3300050511 Bacteria 2340
296 nmdc:mga08y16_3572_c1 3300050511 Bacteria 16150
297 nmdc:mga08y16_6940_c1 3300050511 Bacteria 11870
298 nmdc:mga0n895_281464_c1 3300050512 Bacteria 1686
299 nmdc:mga0rr50_318969_c1 3300050513 Bacteria 1302
300 Ga0500635_0059094 3300053080 Bacteria 1333
301 Ga0495595_0040057 3300053084 Bacteria 2140
302 Ga0500578_0070212 3300053086 Bacteria 2233
303 Ga0500647_0006236 3300053091 Bacteria 5025
304 Ga0500583_0098161 3300053092 Bacteria 1432
305 Ga0500566_0006522 3300053094 Bacteria 6915
306 Ga0500566_0021170 3300053094 Bacteria 3825
307 Ga0500640_004698 3300053095 Bacteria 4993
308 Ga0500554_000290 3300053102 Bacteria 10872
309 Ga0500554_005843 3300053102 Bacteria 2719
310 Ga0500572_006897 3300053111 Bacteria 2614
311 Ga0500595_001692 3300053119 Bacteria 11571
312 Ga0500597_000370 3300053120 Bacteria 9346
313 Ga0500614_001827 3300053123 Bacteria 4923
314 Ga0500614_019822 3300053123 Bacteria 1545
315 Ga0500617_082291 3300053124 Bacteria 1392
316 Ga0500621_116328 3300053126 Bacteria 1040
317 Ga0500642_0045849 3300053130 Bacteria 1909
318 Ga0500564_161810 3300053138 Bacteria 947
319 Ga0500622_0079162 3300053156 Bacteria 1648
320 Ga0500630_034162 3300053159 Bacteria 2494
321 Ga0501084_0000076 3300054114 Bacteria 71887
322 Ga0501084_0085263 3300054114 Bacteria 2652
323 Ga0501082_0004428 3300060353 Bacteria 12264
324 Ga0501082_0005198 3300060353 Bacteria 11315
325 Ga0501082_0071699 3300060353 Bacteria 2983
326 Ga0501082_0160978 3300060353 Bacteria 1950
327 Ga0500590_099383
328 Ga0070658_10052190
329 Ga0070683_100113290
330 Ga0070683_100384165
331 Ga0070690_100002668
332 Ga0070670_100024072
333 Ga0070680_100019359
334 Ga0070682_100042425
335 Ga0070682_100212380
336 Ga0068868_100202629
337 Ga0070689_100010737
338 Ga0070687_100177861
339 Ga0070675_100073898
340 Ga0070673_100028337
341 Ga0070673_100237549
342 Ga0070667_100054714
343 Ga0070713_100981228
344 Ga0070694_100109381
345 Ga0070708_100376814
346 Ga0070681_10023767
347 Ga0070681_10028246
348 Ga0070706_100054060
349 Ga0070706_100191650
350 Ga0070707_100014594
351 Ga0070698_100001757
352 Ga0070698_100084419
353 Ga0070679_100000889
354 Ga0070679_100021648
355 Ga0070679_100026290
356 Ga0070679_100067941
357 Ga0070695_100291557
358 Ga0070665_100095269
359 Ga0070665_100226915
360 Ga0070665_100325072
361 Ga0070704_100077735
362 Ga0068855_100002037
363 Ga0068855_100171783
364 Ga0068856_100049678
365 Ga0068856_100207324
366 Ga0068856_100354529
367 Ga0070702_100103835
368 Ga0068852_100071439
369 Ga0068859_100012364
370 Ga0068859_101133694
371 Ga0068861_100065345
372 Ga0068863_100049950
373 Ga0068863_100318665
374 Ga0068862_100379077
375 Ga0081455_10202705
376 Ga0070717_10021980
377 Ga0070717_10056055
378 Ga0070717_10600268
379 Ga0075366_10027411
380 Ga0075366_10213971
381 Ga0068871_100795435
382 Ga0075430_100160684
383 Ga0075430_100627104
384 Ga0075431_100190253
385 Ga0075429_100006613
386 Ga0075429_100052240
387 Ga0075429_100055199
388 Ga0097620_100012364
389 Ga0097620_101133772
390 Ga0075435_100365643
391 Ga0105240_10112396
392 Ga0105240_10578494
393 Ga0111539_10001893
394 Ga0111539_10005895
395 Ga0111539_10047018
396 Ga0111539_10420595
397 Ga0105245_10000065
398 Ga0114129_10810181
399 Ga0114129_10846344
400 Ga0105242_10698078
401 Ga0105248_10361744
402 Ga0105248_10537596
403 Ga0105237_10222462
404 Ga0105237_10362548
405 Ga0105249_10043198
406 Ga0157374_10154464
407 Ga0157374_10166742
408 Ga0157374_10369019
409 Ga0163163_10482901
410 Ga0207684_10092628
411 Ga0207684_10150551
412 Ga0207684_10308792
413 Ga0207707_10008037
414 Ga0207695_10124267
415 Ga0207671_10290155
416 Ga0207693_10140365
417 Ga0207662_10038851
418 Ga0207652_10035961
419 Ga0207646_10023976
420 Ga0207687_10000296
421 Ga0207700_10397081
422 Ga0207689_10026107
423 Ga0207667_10058164
424 Ga0207667_10504643
425 Ga0207667_10509211
426 Ga0207651_10230289
427 Ga0207702_10060121
428 Ga0207702_10170475
429 Ga0207702_10182850
430 Ga0207702_10729816
431 Ga0207641_10042214
432 Ga0207676_10407411
433 Ga0207675_100039956
434 Ga0207428_10004017
435 Ga0268266_10003375
436 Ga0268266_10202238
437 Ga0268265_10192985
438 Ga0268264_10388443
439 Ga0265337_1030141
440 Ga0265334_10017173
441 Ga0265323_10001758
442 Ga0265323_10062556
443 Ga0307515_10009675
444 Ga0265338_10001915
445 Ga0265338_10074152
446 Ga0265330_10003037
447 Ga0265330_10007441
448 Ga0265332_10077829
449 Ga0265328_10000838
450 Ga0265320_10000286
451 Ga0265320_10015491
452 Ga0265320_10115152
453 Ga0265329_10027709
454 Ga0265339_10009354
455 Ga0265339_10010664
456 Ga0265339_10011810
457 Ga0265339_10059945
458 Ga0265331_10168694
459 Ga0265316_10000272
460 Ga0265316_10008289
461 Ga0265316_10288270
462 Ga0307513_10004123
463 Ga0307513_10116436
464 Ga0307513_10362787
465 Ga0307509_10001691
466 Ga0307509_10003686
467 Ga0307509_10093909
468 Ga0307508_10119025
469 Ga0265314_10017755
470 Ga0265314_10027550
471 Ga0265314_10039597
472 Ga0265314_10111360
473 Ga0265342_10003445
474 Ga0265342_10005035
475 Ga0316576_10015758
476 Ga0307516_10043933
477 Ga0307405_10285167
478 Ga0316577_10001930
479 Ga0307406_10009138
480 Ga0307415_100008714
481 Ga0307415_100155653
482 Ga0373950_0000029
483 Ga0373950_0000093
484 Ga0373936_0000074
485 Ga0373945_0024049
486 Ga0373954_0003468
487 Ga0373954_0226141
488 Ga0373956_0004068
489 Ga0373956_0049598
490 Ga0373956_0091783
491 Ga0373956_0291352
492 Ga0373957_0023199
493 Ga0373957_0049573
494 Ga0373943_0003648
495 Ga0373955_0024635
496 Ga0373955_0099882
497 Ga0373961_0000002
498 Ga0373924_0013024
499 Ga0373931_0034997
500 Ga0373935_0094280
501 Ga0373927_0070393
502 Ga0373927_0142114
503 Ga0373933_0000307
504 Ga0373933_0029297
505 Ga0373933_0134457
506 Ga0373933_0254406
507 Ga0373937_0008754
508 Ga0373937_0027848
509 Ga0373937_0251762
510 Ga0316582_0166917
511 Ga0316584_0000575
512 Ga0373925_0013077
513 Ga0395899_0023053
514 Ga0395899_0138098
515 Ga0395900_0435001
516 Ga0395905_0236121
517 Ga0395901_0093021
518 Ga0395901_0146867
519 Ga0395901_0251309
520 Ga0436365_0648439
521 Ga0436365_1919931
522 Ga0436363_1055456
523 Ga0436362_0400024
524 Ga0451853_1704081
525 Ga0466972_0089444
526 Ga0466961_0292134
527 Ga0453684_0040171
528 Ga0453684_0047670
529 Ga0453684_0202090
530 Ga0451576_0007471
531 Ga0466967_0550633
532 Ga0495650_0033019
533 Ga0495664_0027451
534 Ga0495618_0142768
535 Ga0495586_0027856
536 Ga0495634_0002324
537 Ga0495611_0134972
538 Ga0495657_0026055
539 Ga0495599_0165976
540 Ga0495649_0078702
541 Ga0495674_0007321
542 Ga0495672_0086688
543 Ga0495672_0220380
544 Ga0495680_0027429
545 Ga0495686_0002836
546 Ga0495686_0172467
547 Ga0495602_0280870
548 Ga0496104_0002766
549 Ga0496104_0417538
550 Ga0496112_0372413
551 Ga0496114_0012211
552 Ga0496114_0062268
553 Ga0496114_0452434
554 Ga0496115_0020260
555 Ga0501292_000855
556 Ga0501315_002244
557 Ga0501032_0140753
558 Ga0501034_0000402
559 Ga0501034_0124873
560 Ga0501036_0035580
561 Ga0501036_0131226
562 Ga0501036_0341800
563 Ga0501037_0415660
564 Ga0501042_0166374
565 Ga0501043_0001494
566 Ga0501043_0077878
567 Ga0501046_0003172
568 Ga0501047_0000002
569 Ga0501047_0003448
570 Ga0501047_0069558
571 Ga0501048_0038073
572 Ga0501067_0000061
573 Ga0501067_0234704
574 Ga0501068_0003263
575 Ga0501068_0058419
576 Ga0501069_0021578
577 Ga0501070_0000038
578 Ga0501070_0039527
579 Ga0501070_0050416
580 Ga0501070_0383975
581 Ga0501071_0018232
582 Ga0501072_0000054
583 Ga0501072_0380573
584 Ga0501073_0000316
585 Ga0501073_0001136
586 Ga0501073_0011380
587 Ga0501073_0048003
588 Ga0501073_0321862
589 Ga0501074_0000107
590 Ga0501074_0049767
591 Ga0501074_0065661
592 Ga0501074_0387513
593 Ga0501077_0201690
594 Ga0501209_013889
595 Ga0501216_004493
596 Ga0501261_008413
597 Ga0501225_0013749
598 Ga0501079_0000223
599 Ga0501079_0452987
600 Ga0501080_0007614
601 Ga0501080_0028050
602 Ga0501080_0103064
603 Ga0501080_0220491
604 Ga0501080_0467554
605 Ga0501081_0107871
606 Ga0501081_0369301
607 Ga0501083_0001348
608 Ga0501083_0009526
609 Ga0501083_0032514
610 Ga0501267_005772
611 Ga0501044_0006939
612 Ga0501044_0436515
613 Ga0501044_0578375
614 nmdc:mga0k408_154080_c1
615 nmdc:mga0k408_220703_c1
616 nmdc:mga09592_148566_c1
617 nmdc:mga09592_1896_c1
618 nmdc:mga09592_76059_c1
619 nmdc:mga0qj67_50297_c1
620 nmdc:mga06r32_287117_c1
621 nmdc:mga08y16_159903_c1
622 nmdc:mga08y16_3572_c1
623 nmdc:mga08y16_6940_c1
624 nmdc:mga0n895_281464_c1
625 nmdc:mga0rr50_318969_c1
626 Ga0500635_0059094
627 Ga0495595_0040057
628 Ga0500578_0070212
629 Ga0500647_0006236
630 Ga0500583_0098161
631 Ga0500566_0006522
632 Ga0500566_0021170
633 Ga0500640_004698
634 Ga0500554_000290
635 Ga0500554_005843
636 Ga0500572_006897
637 Ga0500595_001692
638 Ga0500597_000370
639 Ga0500614_001827
640 Ga0500614_019822
641 Ga0500617_082291
642 Ga0500621_116328
643 Ga0500642_0045849
644 Ga0500564_161810
645 Ga0500622_0079162
646 Ga0500630_034162
647 Ga0501084_0000076
648 Ga0501084_0085263
649 Ga0501082_0004428
650 Ga0501082_0005198
651 Ga0501082_0071699
652 Ga0501082_0160978

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02397

Bac_transf

Bacterial sugar transferase

40

270

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
8e37-assembly4.cif.gz_D structure of campylobacter concisus wild-type semet pglc 0.7903 9 236
8g1n-assembly1.cif.gz_A structure of campylobacter concisus pglc i57m/q175m variant with modeled c-terminus 0.7851 9 236
8g1n-assembly2.cif.gz_B structure of campylobacter concisus pglc i57m/q175m variant with modeled c-terminus 0.7773 9 236
8e37-assembly4.cif.gz_D structure of campylobacter concisus wild-type semet pglc 0.7521 9 236
8g1n-assembly1.cif.gz_A structure of campylobacter concisus pglc i57m/q175m variant with modeled c-terminus 0.7207 9 236
ID Description Score Start End Superfamily
af_C6TKA3_62_165_2.40.30.10 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.5742 45 71 2.40.30.10
af_Q42523_488_663_3.30.700.40 Alpha Beta;2-Layer Sandwich;Glycoprotein, Type 4 Pilin; 0.3808 2 72 3.30.700.40
af_Q4D9D2_5_143_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.3766 41 89 3.90.180.10
2np2B00 Few Secondary Structures;Irregular;HU Protein; Chain A;IHF-like DNA-binding proteins 0.3682 44 87 4.10.520.10
af_Q9Y118_3_129_3.90.1030.20 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;DNA polymerase delta, p66 (Cdc27) subunit, wHTH domain 0.3315 26 73 3.90.1030.20
ID Description Score Start End GO Terms
AF-A0A849Z476-F1-model_v4 Bacterial sugar transferase domain-containing protein 0.9633 1 149 GO:0009242
GO:0016020
GO:0089702
AF-A0A524MZV1-F1-model_v4 Exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase 0.9602 6 162 GO:0016020
GO:0016780
AF-A0A7Y6PJL1-F1-model_v4 Glycosyl transferase 0.9565 1 240 GO:0016020
GO:0016780
AF-A0A7Y6PJL1-F1-model_v4 Glycosyl transferase 0.9526 1 240 GO:0016020
GO:0016780
AF-A0A3M1ZY90-F1-model_v4 Sugar transferase 0.9498 1 154 GO:0016020
GO:0016780

Map