F408644

General Info

Members Datasets Scaffolds Average Seq Length
327 197 654 150

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100688388|Ga0068868_1006883882
Length 138
Sequence MKYWLMKSEPDECSIDDVLAAPGRITPWSGVRNYQARNFMRDEMKVGDKVLFYASNADPSGVTGVAEVVREGYPEKEEPWVMVDLKFVEKFARLVPLDELKTTKGLENMVVTKKGSRLSVQPVTKSEFDVVVKLGRKK

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
98 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
99 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
100 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
101 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
109 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
110 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
111 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
112 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
113 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
115 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
118 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
119 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
120 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
121 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
122 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
123 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
124 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
125 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
126 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
127 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
128 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
129 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
130 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
131 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
132 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
136 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
140 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
141 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
144 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
145 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
146 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
149 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
150 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
165 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
166 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
169 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
170 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
171 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
172 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
173 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
174 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
175 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
176 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
180 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
184 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.61
Nodule 0
Rhizoplane 0.92
Rhizosphere 97.86
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100688388 3300005338 Bacteria 914
2 JGI25406J46586_10036607 3300003203 Bacteria 1778
3 Ga0065707_10283720 3300005295 Bacteria 1033
4 Ga0070676_10060961 3300005328 Bacteria 2241
5 Ga0068869_100086122 3300005334 Bacteria 2355
6 Ga0070680_100075463 3300005336 Bacteria 2775
7 Ga0070680_100225604 3300005336 Bacteria 1582
8 Ga0070687_100039321 3300005343 Bacteria 2376
9 Ga0070687_100829007 3300005343 Bacteria 658
10 Ga0070692_10295638 3300005345 Bacteria 987
11 Ga0070668_100088364 3300005347 Bacteria 2440
12 Ga0070669_100004741 3300005353 Bacteria 9805
13 Ga0070671_102040412 3300005355 Bacteria 511
14 Ga0070673_100293206 3300005364 Bacteria 1430
15 Ga0070701_10168484 3300005438 Bacteria 1274
16 Ga0070701_10210718 3300005438 Bacteria 1154
17 Ga0070711_100391669 3300005439 Bacteria 1126
18 Ga0070705_100055666 3300005440 Bacteria 2325
19 Ga0070700_100248169 3300005441 Bacteria 1275
20 Ga0070700_100524169 3300005441 Bacteria 916
21 Ga0070700_100651556 3300005441 Bacteria 832
22 Ga0070694_100024945 3300005444 Bacteria 3863
23 Ga0070694_100787807 3300005444 Bacteria 779
24 Ga0070662_100401066 3300005457 Bacteria 1132
25 Ga0070681_10074644 3300005458 Bacteria 3352
26 Ga0070681_10700199 3300005458 Bacteria 929
27 Ga0068867_100027694 3300005459 Bacteria 4076
28 Ga0070707_100589760 3300005468 Bacteria 1074
29 Ga0070698_100719771 3300005471 Bacteria 941
30 Ga0070679_100084556 3300005530 Bacteria 3161
31 Ga0070697_100914408 3300005536 Bacteria 779
32 Ga0070696_101144596 3300005546 Bacteria 656
33 Ga0070704_100011622 3300005549 Bacteria 5404
34 Ga0070704_100107812 3300005549 Bacteria 2113
35 Ga0070704_100122295 3300005549 Bacteria 2002
36 Ga0070704_100236238 3300005549 Bacteria 1494
37 Ga0068855_100044693 3300005563 Bacteria 5241
38 Ga0068857_100105060 3300005577 Bacteria 2536
39 Ga0070702_100004344 3300005615 Bacteria 6463
40 Ga0068861_100001814 3300005719 Bacteria 13756
41 Ga0068862_100017351 3300005844 Bacteria 5994
42 Ga0081538_10063565 3300005981 Bacteria 2094
43 Ga0081539_10000917 3300005985 Bacteria 55614
44 Ga0075366_10152730 3300006195 Bacteria 1399
45 Ga0075428_100074081 3300006844 Bacteria 3719
46 Ga0075428_100084797 3300006844 Bacteria 3456
47 Ga0075428_101344887 3300006844 Bacteria 750
48 Ga0075430_100467816 3300006846 Bacteria 1040
49 Ga0075430_100848839 3300006846 Bacteria 752
50 Ga0075431_100080038 3300006847 Bacteria 3373
51 Ga0075431_100118490 3300006847 Bacteria 2732
52 Ga0075431_100222447 3300006847 Bacteria 1925
53 Ga0075433_10068100 3300006852 Bacteria 3124
54 Ga0075434_100000003 3300006871 Bacteria 134839
55 Ga0075434_100028704 3300006871 Bacteria 5469
56 Ga0075434_100128450 3300006871 Bacteria 2552
57 Ga0075429_100075438 3300006880 Bacteria 2937
58 Ga0075429_100554103 3300006880 Bacteria 1007
59 Ga0068865_100118776 3300006881 Bacteria 1962
60 Ga0075436_100003580 3300006914 Bacteria 10643
61 Ga0075436_100021713 3300006914 Bacteria 4405
62 Ga0075436_100149021 3300006914 Bacteria 1645
63 Ga0075436_100240767 3300006914 Bacteria 1287
64 Ga0075435_100028857 3300007076 Bacteria 4353
65 Ga0075435_100051570 3300007076 Bacteria 3315
66 Ga0105240_10021587 3300009093 Bacteria 8563
67 Ga0111539_10092769 3300009094 Bacteria 3548
68 Ga0111539_10195440 3300009094 Bacteria 2360
69 Ga0111539_10266496 3300009094 Bacteria 1994
70 Ga0111539_10928362 3300009094 Bacteria 1012
71 Ga0111539_12431939 3300009094 Bacteria 608
72 Ga0105245_10001524 3300009098 Bacteria 20973
73 Ga0114129_10110347 3300009147 Bacteria 3797
74 Ga0114129_11137497 3300009147 Bacteria 975
75 Ga0114129_11683626 3300009147 Bacteria 774
76 Ga0105243_10008706 3300009148 Bacteria 7781
77 Ga0105248_10505943 3300009177 Bacteria 1362
78 Ga0105238_10066124 3300009551 Bacteria 3617
79 Ga0105249_10007877 3300009553 Bacteria 9281
80 Ga0163162_10215290 3300013306 Bacteria 2051
81 Ga0157372_10244358 3300013307 Bacteria 2083
82 Ga0157375_10435369 3300013308 Bacteria 1477
83 Ga0157380_10008961 3300014326 Bacteria 7149
84 Ga0157380_10106481 3300014326 Bacteria 2347
85 Ga0157380_11016962 3300014326 Bacteria 863
86 Ga0157377_10035231 3300014745 Bacteria 2744
87 Ga0163161_10254893 3300017792 Bacteria 1368
88 Ga0207642_10006081 3300025899 Bacteria 3990
89 Ga0207688_10076589 3300025901 Bacteria 1905
90 Ga0207643_10014974 3300025908 Bacteria 4219
91 Ga0207707_10057732 3300025912 Bacteria 3378
92 Ga0207695_10173665 3300025913 Bacteria 2079
93 Ga0207660_11159309 3300025917 Bacteria 629
94 Ga0207662_10091424 3300025918 Bacteria 1872
95 Ga0207662_10209590 3300025918 Bacteria 1265
96 Ga0207662_10593524 3300025918 Bacteria 770
97 Ga0207652_10042830 3300025921 Bacteria 3855
98 Ga0207681_10012703 3300025923 Bacteria 5200
99 Ga0207664_11447835 3300025929 Bacteria 608
100 Ga0207706_10099442 3300025933 Bacteria 2559
101 Ga0207709_10014394 3300025935 Bacteria 4367
102 Ga0207704_10039085 3300025938 Bacteria 2759
103 Ga0207665_10086019 3300025939 Bacteria 2171
104 Ga0207691_10105967 3300025940 Bacteria 2504
105 Ga0207667_11332680 3300025949 Bacteria 693
106 Ga0207651_10245444 3300025960 Bacteria 1462
107 Ga0207712_10006132 3300025961 Bacteria 7579
108 Ga0207658_11185901 3300025986 Bacteria 698
109 Ga0207703_11796679 3300026035 Bacteria 589
110 Ga0207708_10000868 3300026075 Bacteria 22759
111 Ga0207708_10347168 3300026075 Bacteria 1217
112 Ga0207708_10852614 3300026075 Bacteria 787
113 Ga0207648_10001025 3300026089 Bacteria 31445
114 Ga0207676_10395175 3300026095 Bacteria 1291
115 Ga0207676_10435435 3300026095 Bacteria 1233
116 Ga0207674_10082323 3300026116 Bacteria 3220
117 Ga0207675_100001738 3300026118 Bacteria 21809
118 Ga0207675_101445873 3300026118 Bacteria 708
119 Ga0209969_1005350 3300027360 Bacteria 1798
120 Ga0209967_1037191 3300027364 Bacteria 736
121 Ga0209981_1006086 3300027378 Bacteria 1612
122 Ga0209996_1005086 3300027395 Bacteria 1681
123 Ga0209984_1001715 3300027424 Bacteria 2396
124 Ga0210000_1003669 3300027462 Bacteria 2217
125 Ga0210000_1003690 3300027462 Bacteria 2209
126 Ga0210000_1006257 3300027462 Bacteria 1733
127 Ga0210000_1022232 3300027462 Bacteria 973
128 Ga0209968_1002870 3300027526 Bacteria 2586
129 Ga0209968_1003692 3300027526 Bacteria 2296
130 Ga0209999_1005745 3300027543 Bacteria 2233
131 Ga0209999_1013793 3300027543 Bacteria 1466
132 Ga0209971_1017161 3300027682 Bacteria 1717
133 Ga0209966_1001133 3300027695 Bacteria 4773
134 Ga0209998_10002553 3300027717 Bacteria 4137
135 Ga0209974_10037375 3300027876 Bacteria 1612
136 Ga0207428_10127231 3300027907 Bacteria 1951
137 Ga0268265_10020931 3300028380 Bacteria 4572
138 Ga0307408_100104357 3300031548 Bacteria 2166
139 Ga0307408_100385414 3300031548 Bacteria 1199
140 Ga0316575_10021863 3300031665 Bacteria 2465
141 Ga0316579_10003965 3300031691 Bacteria 5838
142 Ga0316578_10003841 3300031728 Bacteria 6969
143 Ga0307516_10022489 3300031730 Bacteria 6473
144 Ga0307407_10634113 3300031903 Bacteria 799
145 Ga0307412_12233273 3300031911 Bacteria 510
146 Ga0307409_101406239 3300031995 Bacteria 724
147 Ga0307416_100037072 3300032002 Bacteria 3748
148 Ga0307416_100107750 3300032002 Bacteria 2446
149 Ga0307416_100114345 3300032002 Bacteria 2387
150 Ga0307416_100143976 3300032002 Bacteria 2172
151 Ga0307416_100426158 3300032002 Bacteria 1372
152 Ga0307416_100877728 3300032002 Bacteria 996
153 Ga0307416_102974250 3300032002 Bacteria 567
154 Ga0307411_10206066 3300032005 Bacteria 1514
155 Ga0307411_10296779 3300032005 Bacteria 1294
156 Ga0307415_100239464 3300032126 Bacteria 1467
157 Ga0316583_10022218 3300032133 Bacteria 2272
158 Ga0316583_10076958 3300032133 Bacteria 1166
159 Ga0373954_0000028 3300035118 Bacteria 56501
160 Ga0373956_0075034 3300035119 Bacteria 1546
161 Ga0373957_0039903 3300035120 Bacteria 1763
162 Ga0373955_0014957 3300035172 Bacteria 3789
163 Ga0373924_0023196 3300035410 Bacteria 2432
164 Ga0373933_0024564 3300035724 Bacteria 3450
165 Ga0373933_0213840 3300035724 Bacteria 1236
166 Ga0373947_0476576 3300035725 Bacteria 847
167 Ga0373937_0006366 3300036401 Bacteria 10183
168 Ga0373937_0299338 3300036401 Bacteria 1520
169 Ga0316582_0042086 3300036647 Bacteria 2859
170 Ga0316581_0002665 3300037588 Bacteria 4310
171 Ga0439453_0015866 3300041408 Bacteria 1307
172 Ga0439461_0000891 3300041410 Bacteria 4433
173 Ga0451798_0765797 3300041458 Bacteria 939
174 Ga0451804_1109166 3300041463 Bacteria 923
175 Ga0451807_1729802 3300041486 Bacteria 1548
176 Ga0451853_2190132 3300041512 Bacteria 1068
177 Ga0439441_001184 3300042001 Bacteria 3307
178 Ga0439441_062186 3300042001 Bacteria 787
179 Ga0439456_007398 3300042013 Bacteria 2253
180 Ga0439446_0016032 3300042156 Bacteria 2084
181 Ga0439446_0065389 3300042156 Bacteria 1105
182 Ga0439434_0000670 3300042435 Bacteria 9880
183 Ga0439435_0000123 3300042436 Bacteria 10165
184 Ga0439435_0006762 3300042436 Bacteria 2590
185 Ga0439444_0001456 3300042437 Bacteria 3078
186 Ga0439460_0015159 3300042461 Bacteria 2036
187 Ga0453683_0626110 3300044673 Bacteria 703
188 Ga0451576_0135111 3300045051 Bacteria 2572
189 Ga0451576_0415777 3300045051 Bacteria 1411
190 Ga0495582_0305002 3300046473 Bacteria 915
191 Ga0495662_0033120 3300046476 Bacteria 2497
192 Ga0495608_0542006 3300046511 Bacteria 702
193 Ga0495608_0829692 3300046511 Bacteria 544
194 Ga0495628_0524172 3300046516 Bacteria 853
195 Ga0495652_0294348 3300046529 Bacteria 1183
196 Ga0495586_0486852 3300046535 Bacteria 712
197 Ga0495598_0109157 3300046537 Bacteria 925
198 Ga0495598_0315392 3300046537 Bacteria 594
199 Ga0495621_0060393 3300046539 Bacteria 1374
200 Ga0495635_0125576 3300046663 Bacteria 1750
201 Ga0495659_0127872 3300046664 Bacteria 1006
202 Ga0495669_0047641 3300046684 Bacteria 1915
203 Ga0495669_0097159 3300046684 Bacteria 1365
204 Ga0495581_0380598 3300047315 Bacteria 823
205 Ga0495636_0004703 3300047318 Bacteria 5355
206 Ga0495674_0059415 3300047319 Bacteria 3339
207 Ga0495602_0119458 3300048088 Bacteria 2124
208 Ga0501291_062416 3300049514 Bacteria 705
209 Ga0501031_0026699 3300049568 Bacteria 3764
210 Ga0501031_0488952 3300049568 Bacteria 794
211 Ga0501031_0634834 3300049568 Bacteria 687
212 Ga0501032_0523949 3300049569 Bacteria 756
213 Ga0501033_0003304 3300049570 Bacteria 13330
214 Ga0501033_0365656 3300049570 Bacteria 1009
215 Ga0501033_0369569 3300049570 Bacteria 1003
216 Ga0501034_0032902 3300049571 Bacteria 5265
217 Ga0501036_0012925 3300049572 Bacteria 6933
218 Ga0501036_0231931 3300049572 Bacteria 1549
219 Ga0501037_0219575 3300049573 Bacteria 1338
220 Ga0501037_0275028 3300049573 Bacteria 1174
221 Ga0501037_0482804 3300049573 Bacteria 842
222 Ga0501037_0604306 3300049573 Bacteria 736
223 Ga0501038_0001086 3300049574 Bacteria 24601
224 Ga0501038_0081765 3300049574 Bacteria 2721
225 Ga0501039_0012074 3300049575 Bacteria 6586
226 Ga0501039_0067639 3300049575 Bacteria 2774
227 Ga0501039_0106721 3300049575 Bacteria 2187
228 Ga0501039_0127306 3300049575 Bacteria 1998
229 Ga0501039_0266008 3300049575 Bacteria 1348
230 Ga0501040_0000076 3300049576 Bacteria 47632
231 Ga0501040_0074783 3300049576 Bacteria 2341
232 Ga0501040_0410440 3300049576 Bacteria 973
233 Ga0501040_0833418 3300049576 Bacteria 668
234 Ga0501041_0008928 3300049577 Bacteria 5898
235 Ga0501041_0095694 3300049577 Bacteria 1835
236 Ga0501041_0378424 3300049577 Bacteria 896
237 Ga0501042_0000322 3300049578 Bacteria 23943
238 Ga0501042_0182424 3300049578 Bacteria 1514
239 Ga0501042_0208906 3300049578 Bacteria 1408
240 Ga0501043_0108988 3300049579 Bacteria 2175
241 Ga0501043_0502555 3300049579 Bacteria 906
242 Ga0501046_0006479 3300049580 Bacteria 10355
243 Ga0501046_0041720 3300049580 Bacteria 3661
244 Ga0501046_0206175 3300049580 Bacteria 1461
245 Ga0501046_0500258 3300049580 Bacteria 870
246 Ga0501048_0010430 3300049582 Bacteria 6939
247 Ga0501048_0045992 3300049582 Bacteria 3116
248 Ga0501048_0070873 3300049582 Bacteria 2461
249 Ga0501048_0238122 3300049582 Bacteria 1291
250 Ga0501048_0725357 3300049582 Bacteria 714
251 Ga0501068_0043508 3300049584 Bacteria 2702
252 Ga0501069_0475201 3300049585 Bacteria 744
253 Ga0501071_0000352 3300049587 Bacteria 22476
254 Ga0501071_0001653 3300049587 Bacteria 13067
255 Ga0501071_0114562 3300049587 Bacteria 1994
256 Ga0501071_0136294 3300049587 Bacteria 1827
257 Ga0501071_0798468 3300049587 Bacteria 728
258 Ga0501072_0000846 3300049588 Bacteria 22486
259 Ga0501072_0020327 3300049588 Bacteria 5143
260 Ga0501072_0036132 3300049588 Bacteria 3872
261 Ga0501072_0093324 3300049588 Bacteria 2391
262 Ga0501072_0238122 3300049588 Bacteria 1449
263 Ga0501072_1213263 3300049588 Bacteria 586
264 Ga0501073_0107209 3300049589 Bacteria 1938
265 Ga0501073_0159664 3300049589 Bacteria 1562
266 Ga0501073_0727365 3300049589 Bacteria 685
267 Ga0501074_0000950 3300049590 Bacteria 18709
268 Ga0501074_0138737 3300049590 Bacteria 1739
269 Ga0501074_0804241 3300049590 Bacteria 662
270 Ga0501075_0012841 3300049591 Bacteria 5963
271 Ga0501075_0020842 3300049591 Bacteria 4772
272 Ga0501076_0006604 3300049592 Bacteria 8412
273 Ga0501076_0125905 3300049592 Bacteria 2076
274 Ga0501077_0000792 3300049593 Bacteria 19126
275 Ga0501077_0046385 3300049593 Bacteria 2761
276 Ga0501236_034330 3300049670 Bacteria 816
277 Ga0501243_051415 3300049675 Bacteria 745
278 Ga0501249_173790 3300049679 Bacteria 553
279 Ga0501229_014964 3300049706 Bacteria 1003
280 Ga0501079_0059513 3300049741 Bacteria 2946
281 Ga0501080_0000599 3300049742 Bacteria 28495
282 Ga0501080_0050929 3300049742 Bacteria 3853
283 Ga0501080_1320045 3300049742 Bacteria 617
284 Ga0501081_0000032 3300049743 Bacteria 52062
285 Ga0501081_0147707 3300049743 Bacteria 1687
286 Ga0501081_0512490 3300049743 Bacteria 894
287 Ga0501271_052577 3300049768 Bacteria 556
288 Ga0501035_0224999 3300049822 Bacteria 1601
289 Ga0501035_0473660 3300049822 Bacteria 1034
290 Ga0501035_0802896 3300049822 Bacteria 751
291 Ga0501044_0129935 3300049823 Bacteria 2514
292 Ga0501044_1545566 3300049823 Bacteria 528
293 Ga0501045_0000771 3300049824 Bacteria 20557
294 Ga0501045_0012957 3300049824 Bacteria 5878
295 Ga0501045_0688510 3300049824 Bacteria 755
296 Ga0501045_1077867 3300049824 Bacteria 588
297 nmdc:mga0k408_391501_c1 3300050493 Bacteria 827
298 nmdc:mga05p37_1052758_c1 3300050507 Bacteria 858
299 nmdc:mga05p37_343641_c1 3300050507 Bacteria 1759
300 nmdc:mga0qj67_11599_c1 3300050509 Bacteria 6610
301 nmdc:mga0qj67_137586_c1 3300050509 Bacteria 1979
302 nmdc:mga0qj67_518361_c1 3300050509 Bacteria 958
303 nmdc:mga06r32_126043_c1 3300050510 Bacteria 2529
304 nmdc:mga08y16_1455701_c1 3300050511 Bacteria 647
305 nmdc:mga08y16_154273_c1 3300050511 Bacteria 2387
306 nmdc:mga08y16_316325_c1 3300050511 Bacteria 1608
307 nmdc:mga0n895_15473_c1 3300050512 Bacteria 6958
308 nmdc:mga0n895_341_c1 3300050512 Bacteria 31194
309 nmdc:mga0n895_34989_c1 3300050512 Bacteria 4839
310 nmdc:mga0rr50_39156_c1 3300050513 Bacteria 3437
311 nmdc:mga08x19_30294_c1 3300050514 Bacteria 3399
312 nmdc:mga08x19_4093_c1 3300050514 Bacteria 8652
313 nmdc:mga08x19_59567_c1 3300050514 Bacteria 2472
314 nmdc:mga08x19_840816_c1 3300050514 Bacteria 652
315 nmdc:mga08x19_92509_c1 3300050514 Bacteria 1998
316 nmdc:mga0a205_16920_c1 3300050515 Bacteria 6827
317 Ga0495601_0149007 3300053077 Bacteria 1527
318 Ga0501084_0006513 3300054114 Bacteria 9595
319 Ga0501084_0075272 3300054114 Bacteria 2828
320 Ga0501084_0262163 3300054114 Bacteria 1459
321 Ga0590071_120609 3300059421 Bacteria 669
322 Ga0501082_0000415 3300060353 Bacteria 37720
323 Ga0501082_0022382 3300060353 Bacteria 5444
324 Ga0501082_0075630 3300060353 Bacteria 2901
325 Ga0501082_0118572 3300060353 Bacteria 2293
326 Ga0530510_0001142 3300061734 Bacteria 17647
327 Ga0530510_0009220 3300061734 Bacteria 6917
328 Ga0068868_100688388
329 JGI25406J46586_10036607
330 Ga0065707_10283720
331 Ga0070676_10060961
332 Ga0068869_100086122
333 Ga0070680_100075463
334 Ga0070680_100225604
335 Ga0070687_100039321
336 Ga0070687_100829007
337 Ga0070692_10295638
338 Ga0070668_100088364
339 Ga0070669_100004741
340 Ga0070671_102040412
341 Ga0070673_100293206
342 Ga0070701_10168484
343 Ga0070701_10210718
344 Ga0070711_100391669
345 Ga0070705_100055666
346 Ga0070700_100248169
347 Ga0070700_100524169
348 Ga0070700_100651556
349 Ga0070694_100024945
350 Ga0070694_100787807
351 Ga0070662_100401066
352 Ga0070681_10074644
353 Ga0070681_10700199
354 Ga0068867_100027694
355 Ga0070707_100589760
356 Ga0070698_100719771
357 Ga0070679_100084556
358 Ga0070697_100914408
359 Ga0070696_101144596
360 Ga0070704_100011622
361 Ga0070704_100107812
362 Ga0070704_100122295
363 Ga0070704_100236238
364 Ga0068855_100044693
365 Ga0068857_100105060
366 Ga0070702_100004344
367 Ga0068861_100001814
368 Ga0068862_100017351
369 Ga0081538_10063565
370 Ga0081539_10000917
371 Ga0075366_10152730
372 Ga0075428_100074081
373 Ga0075428_100084797
374 Ga0075428_101344887
375 Ga0075430_100467816
376 Ga0075430_100848839
377 Ga0075431_100080038
378 Ga0075431_100118490
379 Ga0075431_100222447
380 Ga0075433_10068100
381 Ga0075434_100000003
382 Ga0075434_100028704
383 Ga0075434_100128450
384 Ga0075429_100075438
385 Ga0075429_100554103
386 Ga0068865_100118776
387 Ga0075436_100003580
388 Ga0075436_100021713
389 Ga0075436_100149021
390 Ga0075436_100240767
391 Ga0075435_100028857
392 Ga0075435_100051570
393 Ga0105240_10021587
394 Ga0111539_10092769
395 Ga0111539_10195440
396 Ga0111539_10266496
397 Ga0111539_10928362
398 Ga0111539_12431939
399 Ga0105245_10001524
400 Ga0114129_10110347
401 Ga0114129_11137497
402 Ga0114129_11683626
403 Ga0105243_10008706
404 Ga0105248_10505943
405 Ga0105238_10066124
406 Ga0105249_10007877
407 Ga0163162_10215290
408 Ga0157372_10244358
409 Ga0157375_10435369
410 Ga0157380_10008961
411 Ga0157380_10106481
412 Ga0157380_11016962
413 Ga0157377_10035231
414 Ga0163161_10254893
415 Ga0207642_10006081
416 Ga0207688_10076589
417 Ga0207643_10014974
418 Ga0207707_10057732
419 Ga0207695_10173665
420 Ga0207660_11159309
421 Ga0207662_10091424
422 Ga0207662_10209590
423 Ga0207662_10593524
424 Ga0207652_10042830
425 Ga0207681_10012703
426 Ga0207664_11447835
427 Ga0207706_10099442
428 Ga0207709_10014394
429 Ga0207704_10039085
430 Ga0207665_10086019
431 Ga0207691_10105967
432 Ga0207667_11332680
433 Ga0207651_10245444
434 Ga0207712_10006132
435 Ga0207658_11185901
436 Ga0207703_11796679
437 Ga0207708_10000868
438 Ga0207708_10347168
439 Ga0207708_10852614
440 Ga0207648_10001025
441 Ga0207676_10395175
442 Ga0207676_10435435
443 Ga0207674_10082323
444 Ga0207675_100001738
445 Ga0207675_101445873
446 Ga0209969_1005350
447 Ga0209967_1037191
448 Ga0209981_1006086
449 Ga0209996_1005086
450 Ga0209984_1001715
451 Ga0210000_1003669
452 Ga0210000_1003690
453 Ga0210000_1006257
454 Ga0210000_1022232
455 Ga0209968_1002870
456 Ga0209968_1003692
457 Ga0209999_1005745
458 Ga0209999_1013793
459 Ga0209971_1017161
460 Ga0209966_1001133
461 Ga0209998_10002553
462 Ga0209974_10037375
463 Ga0207428_10127231
464 Ga0268265_10020931
465 Ga0307408_100104357
466 Ga0307408_100385414
467 Ga0316575_10021863
468 Ga0316579_10003965
469 Ga0316578_10003841
470 Ga0307516_10022489
471 Ga0307407_10634113
472 Ga0307412_12233273
473 Ga0307409_101406239
474 Ga0307416_100037072
475 Ga0307416_100107750
476 Ga0307416_100114345
477 Ga0307416_100143976
478 Ga0307416_100426158
479 Ga0307416_100877728
480 Ga0307416_102974250
481 Ga0307411_10206066
482 Ga0307411_10296779
483 Ga0307415_100239464
484 Ga0316583_10022218
485 Ga0316583_10076958
486 Ga0373954_0000028
487 Ga0373956_0075034
488 Ga0373957_0039903
489 Ga0373955_0014957
490 Ga0373924_0023196
491 Ga0373933_0024564
492 Ga0373933_0213840
493 Ga0373947_0476576
494 Ga0373937_0006366
495 Ga0373937_0299338
496 Ga0316582_0042086
497 Ga0316581_0002665
498 Ga0439453_0015866
499 Ga0439461_0000891
500 Ga0451798_0765797
501 Ga0451804_1109166
502 Ga0451807_1729802
503 Ga0451853_2190132
504 Ga0439441_001184
505 Ga0439441_062186
506 Ga0439456_007398
507 Ga0439446_0016032
508 Ga0439446_0065389
509 Ga0439434_0000670
510 Ga0439435_0000123
511 Ga0439435_0006762
512 Ga0439444_0001456
513 Ga0439460_0015159
514 Ga0453683_0626110
515 Ga0451576_0135111
516 Ga0451576_0415777
517 Ga0495582_0305002
518 Ga0495662_0033120
519 Ga0495608_0542006
520 Ga0495608_0829692
521 Ga0495628_0524172
522 Ga0495652_0294348
523 Ga0495586_0486852
524 Ga0495598_0109157
525 Ga0495598_0315392
526 Ga0495621_0060393
527 Ga0495635_0125576
528 Ga0495659_0127872
529 Ga0495669_0047641
530 Ga0495669_0097159
531 Ga0495581_0380598
532 Ga0495636_0004703
533 Ga0495674_0059415
534 Ga0495602_0119458
535 Ga0501291_062416
536 Ga0501031_0026699
537 Ga0501031_0488952
538 Ga0501031_0634834
539 Ga0501032_0523949
540 Ga0501033_0003304
541 Ga0501033_0365656
542 Ga0501033_0369569
543 Ga0501034_0032902
544 Ga0501036_0012925
545 Ga0501036_0231931
546 Ga0501037_0219575
547 Ga0501037_0275028
548 Ga0501037_0482804
549 Ga0501037_0604306
550 Ga0501038_0001086
551 Ga0501038_0081765
552 Ga0501039_0012074
553 Ga0501039_0067639
554 Ga0501039_0106721
555 Ga0501039_0127306
556 Ga0501039_0266008
557 Ga0501040_0000076
558 Ga0501040_0074783
559 Ga0501040_0410440
560 Ga0501040_0833418
561 Ga0501041_0008928
562 Ga0501041_0095694
563 Ga0501041_0378424
564 Ga0501042_0000322
565 Ga0501042_0182424
566 Ga0501042_0208906
567 Ga0501043_0108988
568 Ga0501043_0502555
569 Ga0501046_0006479
570 Ga0501046_0041720
571 Ga0501046_0206175
572 Ga0501046_0500258
573 Ga0501048_0010430
574 Ga0501048_0045992
575 Ga0501048_0070873
576 Ga0501048_0238122
577 Ga0501048_0725357
578 Ga0501068_0043508
579 Ga0501069_0475201
580 Ga0501071_0000352
581 Ga0501071_0001653
582 Ga0501071_0114562
583 Ga0501071_0136294
584 Ga0501071_0798468
585 Ga0501072_0000846
586 Ga0501072_0020327
587 Ga0501072_0036132
588 Ga0501072_0093324
589 Ga0501072_0238122
590 Ga0501072_1213263
591 Ga0501073_0107209
592 Ga0501073_0159664
593 Ga0501073_0727365
594 Ga0501074_0000950
595 Ga0501074_0138737
596 Ga0501074_0804241
597 Ga0501075_0012841
598 Ga0501075_0020842
599 Ga0501076_0006604
600 Ga0501076_0125905
601 Ga0501077_0000792
602 Ga0501077_0046385
603 Ga0501236_034330
604 Ga0501243_051415
605 Ga0501249_173790
606 Ga0501229_014964
607 Ga0501079_0059513
608 Ga0501080_0000599
609 Ga0501080_0050929
610 Ga0501080_1320045
611 Ga0501081_0000032
612 Ga0501081_0147707
613 Ga0501081_0512490
614 Ga0501271_052577
615 Ga0501035_0224999
616 Ga0501035_0473660
617 Ga0501035_0802896
618 Ga0501044_0129935
619 Ga0501044_1545566
620 Ga0501045_0000771
621 Ga0501045_0012957
622 Ga0501045_0688510
623 Ga0501045_1077867
624 nmdc:mga0k408_391501_c1
625 nmdc:mga05p37_1052758_c1
626 nmdc:mga05p37_343641_c1
627 nmdc:mga0qj67_11599_c1
628 nmdc:mga0qj67_137586_c1
629 nmdc:mga0qj67_518361_c1
630 nmdc:mga06r32_126043_c1
631 nmdc:mga08y16_1455701_c1
632 nmdc:mga08y16_154273_c1
633 nmdc:mga08y16_316325_c1
634 nmdc:mga0n895_15473_c1
635 nmdc:mga0n895_341_c1
636 nmdc:mga0n895_34989_c1
637 nmdc:mga0rr50_39156_c1
638 nmdc:mga08x19_30294_c1
639 nmdc:mga08x19_4093_c1
640 nmdc:mga08x19_59567_c1
641 nmdc:mga08x19_840816_c1
642 nmdc:mga08x19_92509_c1
643 nmdc:mga0a205_16920_c1
644 Ga0495601_0149007
645 Ga0501084_0006513
646 Ga0501084_0075272
647 Ga0501084_0262163
648 Ga0590071_120609
649 Ga0501082_0000415
650 Ga0501082_0022382
651 Ga0501082_0075630
652 Ga0501082_0118572
653 Ga0530510_0001142
654 Ga0530510_0009220

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01878

EVE

EVE domain

2

134

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g2x-assembly3.cif.gz_C x-ray crystal structure protein q88ch6 from pseudomonas putida. northeast structural genomics consortium target ppr72. 0.9251 3 149
2eve-assembly1.cif.gz_A x-ray crystal structure of protein pspto5229 from pseudomonas syringae. northeast structural genomics consortium target psr62 0.9154 3 149
2ar1-assembly1.cif.gz_A structure of hypothetical protein from leishmania major 0.9054 1 149
1zce-assembly1.cif.gz_A x-ray crystal structure of protein atu2648 from agrobacterium tumefaciens. northeast structural genomics consortium target atr33. 0.9039 1 147
2gbs-assembly1.cif.gz_A nmr structure of rpa0253 from rhodopseudomonas palustris. northeast structural genomics consortium target rpr3 0.8991 1 149
ID Description Score Start End Superfamily
af_A4ICC8_1_164_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9206 1 149 3.10.590.10
2eveA00 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.911 3 149 3.10.590.10
af_O94645_8_177_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9077 1 149 3.10.590.10
1zceA00 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.8892 1 149 3.10.590.10
af_O94645_8_177_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.8853 1 149 3.10.590.10
ID Description Score Start End GO Terms
AF-A0A661CTS2-F1-model_v4 EVE domain-containing protein 0.9831 37 149
AF-A0A139BQB5-F1-model_v4 EVE domain-containing protein 0.9779 56 152
AF-A0A3D2R2D4-F1-model_v4 EVE domain-containing protein 0.9759 70 148
AF-A0A3N5NA97-F1-model_v4 EVE domain-containing protein 0.9727 59 149
AF-A0A536YT56-F1-model_v4 EVE domain-containing protein 0.9724 33 151

Map