F408656

General Info

Members Datasets Scaffolds Average Seq Length
327 240 319 119

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10515941|Ga0070709_105159412
Length 138
Sequence MPRVKRGTKRRARRKKLLKHAKGFFLTKGKLFRSAKEAVNRSLRYSYRDRRTRKRDYRTLWIQRIGAAARNNGITYSQLIHGLKASGIELDRKILADMAVRDAAGFTSLVESAKQHIAKAPAAAKAPKPEHPRHHDEG

Samples

Sample ID Description Type Environment
1 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
2 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
3 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
4 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
5 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
6 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
7 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
130 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
131 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
132 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
134 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
135 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
136 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
137 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
138 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
139 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
140 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
141 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
142 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
143 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
144 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
147 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
148 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
153 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
154 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
155 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
159 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
166 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
167 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
172 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
173 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
174 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
175 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
176 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
177 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
178 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
179 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
180 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
181 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
182 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
183 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
184 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
185 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
186 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
187 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
188 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
190 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
191 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
192 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
195 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
201 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
202 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
217 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
218 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
219 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
220 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
223 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
229 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
230 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
231 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
232 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
233 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
234 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
238 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
239 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
240 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.69
Metatranscriptomes 8.56
Isolates 2.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.14
Nodule 0.31
Rhizoplane 3.06
Rhizosphere 85.32
Stem 0
Stem Tuber 0
Unclassified 9.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10075538 3300003316 Bacteria 2397
2 rootH2_10026815 3300003320 Bacteria 11027
3 rootL2_10000797 3300003322 Bacteria 14731
4 rootL2_10010600 3300003322 Bacteria 6202
5 rootL2_10069194 3300003322 Bacteria 3752
6 rootL2_10230396 3300003322 Bacteria 7137
7 rootH1_10015133 3300003323 Bacteria 15106
8 rootH1_10098320 3300003316 Archaea 2923
9 rootH1_10098320 3300003323 Bacteria 6346
10 JGI26129J50193_1012138 3300003349 Bacteria 631
11 Ga0055531_10000223 3300003794 Bacteria 62728
12 Ga0058860_10009999 3300004801 Bacteria 2572
13 Ga0070658_10139946 3300005327 Bacteria 2021
14 Ga0070658_10529419 3300005327 Bacteria 1019
15 Ga0070683_100510510 3300005329 Bacteria 1149
16 Ga0070690_101632962 3300005330 Bacteria 523
17 Ga0070670_100051089 3300005331 Bacteria 3551
18 Ga0070680_100775900 3300005336 Bacteria 826
19 Ga0070682_101683731 3300005337 Bacteria 550
20 Ga0068868_102364547 3300005338 Unclassified 507
21 Ga0070660_100210067 3300005339 Bacteria 1580
22 Ga0070689_100876010 3300005340 Bacteria 793
23 Ga0070661_100011265 3300005344 Bacteria 6229
24 Ga0070692_10076757 3300005345 Bacteria 1791
25 Ga0070674_100723008 3300005356 Unclassified 853
26 Ga0070709_10515941 3300005434 Bacteria 910
27 Ga0070700_100439240 3300005441 Bacteria 990
28 Ga0070694_101348831 3300005444 Bacteria 601
29 Ga0070708_100859970 3300005445 Bacteria 852
30 Ga0070663_101822697 3300005455 Bacteria 546
31 Ga0070681_10472537 3300005458 Bacteria 1166
32 Ga0068867_101258209 3300005459 Unclassified 682
33 Ga0070706_100324035 3300005467 Bacteria 1437
34 Ga0070707_100126160 3300005468 Bacteria 2487
35 Ga0070698_100675072 3300005471 Bacteria 975
36 Ga0070698_101884987 3300005471 Bacteria 551
37 Ga0070699_100272526 3300005518 Bacteria 1515
38 Ga0070699_100289823 3300005518 Bacteria 1468
39 Ga0070679_100297964 3300005530 Bacteria 1563
40 Ga0070697_100186514 3300005536 Bacteria 1759
41 Ga0068853_100004773 3300005539 Bacteria 10536
42 Ga0070695_100033563 3300005545 Unclassified 3212
43 Ga0070695_100485189 3300005545 Bacteria 953
44 Ga0070695_101141423 3300005545 Bacteria 639
45 Ga0070693_100648546 3300005547 Bacteria 767
46 Ga0070665_100329574 3300005548 Bacteria 1531
47 Ga0070704_100986695 3300005549 Bacteria 761
48 Ga0068855_100127001 3300005563 Bacteria 2915
49 Ga0068855_101448036 3300005563 Bacteria 707
50 Ga0070664_100983356 3300005564 Bacteria 793
51 Ga0068857_100182758 3300005577 Bacteria 1908
52 Ga0068857_101252294 3300005577 Bacteria 719
53 Ga0068854_100023482 3300005578 Bacteria 4213
54 Ga0068854_101320965 3300005578 Bacteria 650
55 Ga0068854_101631956 3300005578 Bacteria 588
56 Ga0068856_100041566 3300005614 Bacteria 4519
57 Ga0068852_100023279 3300005616 Bacteria 4983
58 Ga0068859_100601915 3300005617 Unclassified 1192
59 Ga0068859_101359303 3300005617 Bacteria 783
60 Ga0068864_100389197 3300005618 Bacteria 1323
61 Ga0068864_100621887 3300005618 Bacteria 1050
62 Ga0068864_100635565 3300005618 Bacteria 1038
63 Ga0068851_10003679 3300005834 Bacteria 6844
64 Ga0068863_100167224 3300005841 Bacteria 2109
65 Ga0068863_100173322 3300005841 Bacteria 2070
66 Ga0068860_100326211 3300005843 Bacteria 1507
67 Ga0068860_101016216 3300005843 Unclassified 847
68 Ga0068862_100720217 3300005844 Bacteria 968
69 Ga0068862_101412302 3300005844 Bacteria 700
70 Ga0081538_10024293 3300005981 Bacteria 4321
71 Ga0070717_10914747 3300006028 Bacteria 799
72 Ga0070716_101429653 3300006173 Unclassified 563
73 Ga0097621_100047293 3300006237 Bacteria 3486
74 Ga0068871_102228990 3300006358 Unclassified 522
75 Ga0075431_101692202 3300006847 Bacteria 590
76 Ga0075433_10341749 3300006852 Bacteria 1323
77 Ga0075434_100328787 3300006871 Bacteria 1549
78 Ga0075434_100543881 3300006871 Bacteria 1181
79 Ga0075429_100613232 3300006880 Unclassified 953
80 Ga0075436_100547993 3300006914 Bacteria 849
81 Ga0097620_100601830 3300006931 Unclassified 1192
82 Ga0097620_101359311 3300006931 Bacteria 783
83 Ga0075435_101955670 3300007076 Bacteria 515
84 Ga0105240_10184739 3300009093 Bacteria 2457
85 Ga0105240_10653467 3300009093 Bacteria 1152
86 Ga0111539_10006568 3300009094 Bacteria 14987
87 Ga0111539_12827574 3300009094 Bacteria 562
88 Ga0105245_12699101 3300009098 Bacteria 550
89 Ga0105243_10191060 3300009148 Bacteria 1789
90 Ga0105248_10200098 3300009177 Bacteria 2251
91 Ga0105249_10682756 3300009553 Bacteria 1086
92 Ga0105239_10932868 3300010375 Bacteria 997
93 Ga0105239_11593522 3300010375 Bacteria 755
94 Ga0157370_10000615 3300013104 Bacteria 44268
95 Ga0157370_10231814 3300013104 Bacteria 1709
96 Ga0157370_11873674 3300013104 Unclassified 538
97 Ga0157378_10762053 3300013297 Bacteria 991
98 Ga0163162_10123790 3300013306 Bacteria 2691
99 Ga0163162_12690008 3300013306 Bacteria 573
100 Ga0157372_11235011 3300013307 Bacteria 863
101 Ga0157375_10389497 3300013308 Bacteria 1560
102 Ga0157380_10003590 3300014326 Bacteria 10674
103 Ga0157380_10106527 3300014326 Bacteria 2346
104 Ga0157380_10577734 3300014326 Bacteria 1108
105 Ga0182008_10244133 3300014497 Bacteria 925
106 Ga0157379_10804965 3300014968 Bacteria 887
107 Ga0157379_12340814 3300014968 Bacteria 532
108 Ga0163161_10102522 3300017792 Bacteria 2131
109 Ga0163161_10748081 3300017792 Bacteria 818
110 Ga0206356_10764017 3300020070 Bacteria 633
111 Ga0206353_10192625 3300020082 Bacteria 1118
112 Ga0224712_10133994 3300022467 Bacteria 1084
113 Ga0209257_1000005 3300025304 Bacteria 1592528
114 Ga0207656_10095241 3300025321 Bacteria 1357
115 Ga0207692_10363160 3300025898 Unclassified 895
116 Ga0207680_11034815 3300025903 Bacteria 588
117 Ga0207705_10251634 3300025909 Bacteria 1348
118 Ga0207705_11384794 3300025909 Bacteria 535
119 Ga0207684_10170846 3300025910 Bacteria 1874
120 Ga0207654_10114897 3300025911 Bacteria 1681
121 Ga0207707_10251942 3300025912 Bacteria 1534
122 Ga0207695_10124075 3300025913 Bacteria 2547
123 Ga0207695_10278316 3300025913 Bacteria 1567
124 Ga0207663_10895035 3300025916 Bacteria 709
125 Ga0207660_10305737 3300025917 Bacteria 1267
126 Ga0207660_11027982 3300025917 Bacteria 672
127 Ga0207657_10179667 3300025919 Bacteria 1711
128 Ga0207649_10002345 3300025920 Bacteria 10610
129 Ga0207652_10395204 3300025921 Bacteria 1248
130 Ga0207646_10980188 3300025922 Bacteria 747
131 Ga0207646_11173870 3300025922 Bacteria 674
132 Ga0207694_10038228 3300025924 Bacteria 3690
133 Ga0207650_10068254 3300025925 Bacteria 2669
134 Ga0207670_10599313 3300025936 Bacteria 904
135 Ga0207670_10641862 3300025936 Bacteria 875
136 Ga0207669_10852644 3300025937 Bacteria 758
137 Ga0207665_11222936 3300025939 Unclassified 599
138 Ga0207711_10475509 3300025941 Bacteria 1164
139 Ga0207661_11163283 3300025944 Bacteria 710
140 Ga0207667_10303439 3300025949 Bacteria 1631
141 Ga0207668_10290436 3300025972 Bacteria 1345
142 Ga0207640_10049881 3300025981 Bacteria 2712
143 Ga0207639_10018380 3300026041 Bacteria 4966
144 Ga0207678_11648850 3300026067 Bacteria 564
145 Ga0207708_10948467 3300026075 Bacteria 746
146 Ga0207708_11457338 3300026075 Bacteria 601
147 Ga0207702_10059336 3300026078 Bacteria 3259
148 Ga0207641_10020409 3300026088 Bacteria 5442
149 Ga0207641_10091432 3300026088 Unclassified 2663
150 Ga0207648_10043002 3300026089 Bacteria 3968
151 Ga0207648_10595000 3300026089 Bacteria 1019
152 Ga0207676_11924425 3300026095 Unclassified 590
153 Ga0207674_10046319 3300026116 Bacteria 4465
154 Ga0207674_10209820 3300026116 Bacteria 1897
155 Ga0207698_10019270 3300026142 Bacteria 4668
156 Ga0209995_1001962 3300027471 Bacteria 3221
157 Ga0209971_1013789 3300027682 Bacteria 1915
158 Ga0209998_10009045 3300027717 Bacteria 2063
159 Ga0209974_10027521 3300027876 Bacteria 1881
160 Ga0207428_10005431 3300027907 Bacteria 11887
161 Ga0207428_10024271 3300027907 Bacteria 5094
162 Ga0207428_10229095 3300027907 Bacteria 1391
163 Ga0268266_10610670 3300028379 Bacteria 1048
164 Ga0268264_10317974 3300028381 Bacteria 1471
165 Ga0307515_10156052 3300028794 Bacteria 2355
166 Ga0316181_1124607 3300030744 Bacteria 745
167 Ga0316182_1344331 3300030745 Bacteria 630
168 Ga0265760_10265274 3300031090 Bacteria 599
169 Ga0265320_10111178 3300031240 Bacteria 1255
170 Ga0265320_10139598 3300031240 Unclassified 1098
171 Ga0265325_10032158 3300031241 Bacteria 2803
172 Ga0265325_10062753 3300031241 Bacteria 1882
173 Ga0265329_10050788 3300031242 Unclassified 1321
174 Ga0265340_10074363 3300031247 Bacteria 1607
175 Ga0265339_10207672 3300031249 Bacteria 963
176 Ga0265331_10066732 3300031250 Bacteria 1689
177 Ga0265327_10214336 3300031251 Unclassified 868
178 Ga0265316_10052063 3300031344 Bacteria 3213
179 Ga0265316_10325717 3300031344 Unclassified 1115
180 Ga0307509_10224740 3300031507 Bacteria 1686
181 Ga0265313_10097292 3300031595 Unclassified 1311
182 Ga0316575_10004995 3300031665 Bacteria 4693
183 Ga0316579_10224606 3300031691 Bacteria 908
184 Ga0265314_10330408 3300031711 Unclassified 845
185 Ga0265342_10433724 3300031712 Bacteria 676
186 Ga0316578_10626240 3300031728 Bacteria 629
187 Ga0316577_10047310 3300031733 Bacteria 2402
188 Ga0316577_10129366 3300031733 Bacteria 1421
189 Ga0307413_10981853 3300031824 Bacteria 723
190 Ga0307416_100260697 3300032002 Bacteria 1694
191 Ga0307414_10003742 3300032004 Bacteria 8166
192 Ga0307414_10026130 3300032004 Bacteria 3753
193 Ga0307414_10735217 3300032004 Bacteria 896
194 Ga0316583_10006368 3300032133 Bacteria 4236
195 Ga0316585_10014228 3300032137 Bacteria 2376
196 Ga0316580_10124203 3300032139 Bacteria 790
197 Ga0316593_10065844 3300032168 Bacteria 1246
198 Ga0316593_10240568 3300032168 Bacteria 675
199 Ga0316593_10254411 3300032168 Bacteria 658
200 Ga0316593_10258605 3300032168 Bacteria 653
201 Ga0316593_10287767 3300032168 Bacteria 620
202 Ga0316592_1175793 3300033524 Bacteria 511
203 Ga0316588_1001144 3300033528 Bacteria 4208
204 Ga0373930_0113889 3300034816 Bacteria 653
205 Ga0373939_0146722 3300035114 Bacteria 855
206 Ga0373955_0648644 3300035172 Bacteria 647
207 Ga0373931_0133088 3300035691 Bacteria 1433
208 Ga0373931_0136360 3300035691 Bacteria 1417
209 Ga0373927_0013464 3300035695 Bacteria 5435
210 Ga0373933_0117219 3300035724 Bacteria 1665
211 Ga0373937_0221467 3300036401 Bacteria 1781
212 Ga0373937_0726992 3300036401 Bacteria 940
213 Ga0316582_0073212 3300036647 Bacteria 2223
214 Ga0316582_0263103 3300036647 Bacteria 1183
215 Ga0316584_0027603 3300036712 Bacteria 4179
216 Ga0316584_0052916 3300036712 Bacteria 3037
217 Ga0436364_1029426 3300037853 Bacteria 2926
218 Ga0395901_0051647 3300038443 Bacteria 4275
219 Ga0400483_005301 3300039062 Bacteria 3021
220 Ga0400483_091982 3300039062 Bacteria 1350
221 Ga0400483_149744 3300039062 Bacteria 1283
222 Ga0400483_192549 3300039062 Bacteria 3163
223 Ga0400483_209438 3300039062 Bacteria 2129
224 Ga0436365_1735207 3300039437 Unclassified 693
225 Ga0436360_0989193 3300039438 Bacteria 727
226 Ga0436361_0430208 3300039447 Bacteria 970
227 Ga0436363_0270127 3300039450 Bacteria 583
228 Ga0451789_0682187 3300041443 Unclassified 1219
229 Ga0451790_07132 3300041444 Bacteria 649
230 Ga0451798_0227980 3300041458 Unclassified 939
231 Ga0451805_006867 3300041461 Bacteria 585
232 Ga0451807_2105430 3300041486 Bacteria 1072
233 Ga0451837_0132719 3300041494 Bacteria 527
234 Ga0451837_1755060 3300041494 Bacteria 1644
235 Ga0451849_1500547 3300041505 Bacteria 949
236 Ga0451850_25346 3300041506 Bacteria 538
237 Ga0451843_0026409 3300041509 Bacteria 674
238 Ga0451854_08974 3300041510 Bacteria 526
239 Ga0452271_29157 3300041916 Bacteria 962
240 Ga0451577_0000064 3300042876 Bacteria 262482
241 Ga0451577_0998616 3300042876 Bacteria 751
242 Ga0453683_0001605 3300044673 Bacteria 19094
243 Ga0453683_0003649 3300044673 Bacteria 11286
244 Ga0453683_0020824 3300044673 Bacteria 4189
245 Ga0466964_0036075 3300044706 Bacteria 1981
246 Ga0453684_0000061 3300044712 Bacteria 489946
247 Ga0453684_0000954 3300044712 Bacteria 95326
248 Ga0453684_0031217 3300044712 Bacteria 7495
249 Ga0453684_0053491 3300044712 Bacteria 5269
250 Ga0453684_0058526 3300044712 Bacteria 4977
251 Ga0453684_0315858 3300044712 Bacteria 1771
252 Ga0451576_0000343 3300045051 Bacteria 112185
253 Ga0451576_0001271 3300045051 Bacteria 44253
254 Ga0451576_0003332 3300045051 Bacteria 22247
255 Ga0451576_0109133 3300045051 Unclassified 2879
256 Ga0451576_0210248 3300045051 Bacteria 2032
257 Ga0451576_0739293 3300045051 Bacteria 1033
258 Ga0451576_1349530 3300045051 Bacteria 743
259 Ga0495594_0441712 3300046499 Bacteria 740
260 Ga0495606_0019797 3300046507 Bacteria 4986
261 Ga0495608_0425800 3300046511 Unclassified 810
262 Ga0495630_0890032 3300046517 Bacteria 678
263 Ga0495587_0321130 3300046536 Unclassified 865
264 Ga0495581_0807763 3300047315 Bacteria 538
265 Ga0496111_0202150 3300048914 Bacteria 1477
266 Ga0496112_0613445 3300048915 Bacteria 1019
267 Ga0496114_1524531 3300048917 Bacteria 556
268 Ga0496115_0135415 3300048918 Bacteria 2031
269 Ga0496115_0161220 3300048918 Bacteria 1853
270 Ga0496125_0000031 3300048928 Bacteria 365156
271 Ga0496126_0402358 3300048929 Bacteria 1110
272 Ga0501306_035009 3300049127 Bacteria 760
273 Ga0501305_054661 3300049161 Bacteria 677
274 Ga0501313_018411 3300049529 Bacteria 848
275 Ga0501319_013732 3300049535 Bacteria 675
276 Ga0501320_060203 3300049536 Bacteria 533
277 Ga0501324_022864 3300049540 Bacteria 648
278 Ga0501335_023312 3300049551 Bacteria 671
279 Ga0501336_012611 3300049552 Bacteria 699
280 Ga0501034_0000161 3300049571 Bacteria 126011
281 Ga0501034_0690158 3300049571 Bacteria 920
282 Ga0501034_0788892 3300049571 Unclassified 843
283 Ga0501039_0605258 3300049575 Unclassified 859
284 Ga0501040_0065504 3300049576 Bacteria 2502
285 Ga0501043_0682502 3300049579 Bacteria 752
286 Ga0501047_0223228 3300049581 Bacteria 1740
287 Ga0501048_0526230 3300049582 Unclassified 848
288 Ga0501068_0500687 3300049584 Unclassified 788
289 Ga0501069_0255714 3300049585 Bacteria 1022
290 Ga0501071_0898720 3300049587 Unclassified 683
291 Ga0501074_1097597 3300049590 Bacteria 559
292 Ga0501074_1215714 3300049590 Unclassified 528
293 Ga0501077_0635124 3300049593 Unclassified 686
294 Ga0501080_0031691 3300049742 Bacteria 4926
295 Ga0501080_0420262 3300049742 Bacteria 1201
296 Ga0501280_100196 3300049776 Bacteria 556
297 Ga0501045_0458016 3300049824 Unclassified 948
298 nmdc:mga06r32_970897_c1 3300050510 Bacteria 803
299 nmdc:mga08y16_1042479_c1 3300050511 Unclassified 796
300 nmdc:mga08y16_1584_c1 3300050511 Bacteria 22956
301 nmdc:mga08y16_326884_c1 3300050511 Bacteria 1578
302 nmdc:mga08y16_34092_c1 3300050511 Bacteria 5347
303 nmdc:mga08y16_64708_c1 3300050511 Bacteria 3818
304 nmdc:mga0n895_807904_c1 3300050512 Bacteria 928
305 nmdc:mga08x19_460206_c1 3300050514 Bacteria 896
306 nmdc:mga08x19_753191_c1 3300050514 Bacteria 691
307 Ga0500578_0331327 3300053086 Bacteria 895
308 Ga0500641_0000352 3300053096 Bacteria 17154
309 Ga0500618_005061 3300053125 Bacteria 4067
310 Ga0500588_0060276 3300053146 Unclassified 1214
311 Ga0500636_0002049 3300053177 Bacteria 11109
312 Ga0501084_0514253 3300054114 Bacteria 1012
313 Ga0587085_139189 3300059506 Bacteria 550
314 Ga0587095_017030 3300059514 Bacteria 671
315 Ga0587108_014148 3300059653 Bacteria 707
316 Ga0501082_0323740 3300060353 Bacteria 1343
317 Ga0530510_0793784 3300061734 Bacteria 722
318 Ga0530510_1116067 3300061734 Unclassified 604
319 Ga0530510_1466940 3300061734 Unclassified 524

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039450 Ga0436363_0270127 Ga0436363_0270127_26_403 102
2 3300005549 Ga0070704_100986695 Ga0070704_1009866952 103
3 iso_pu_bacteria 2713897090 2715499037 110
4 iso_pu_bacteria 2834578030 2834579893 110
5 iso_pu_bacteria 2840878972 2840882704 110
6 iso_pu_bacteria 2854681122 2854685368 110
7 iso_pu_bacteria 2899275550 2899276561 110
8 iso_pu_bacteria 3000017691 3000019900 110
9 iso_pu_bacteria 3000405567 3000406764 110
10 iso_pu_bacteria 8036736890 8036737959 110
11 iso_pu_bacteria 8057132660 8057133953 110
12 3300039447 Ga0436361_0430208 Ga0436361_0430208_242_577 111
13 3300005340 Ga0070689_100876010 Ga0070689_1008760102 113
14 3300005441 Ga0070700_100439240 Ga0070700_1004392402 113
15 3300005445 Ga0070708_100859970 Ga0070708_1008599703 113
16 3300005467 Ga0070706_100324035 Ga0070706_1003240353 113
17 3300005468 Ga0070707_100126160 Ga0070707_1001261604 113
18 3300005518 Ga0070699_100272526 Ga0070699_1002725264 113
19 3300005518 Ga0070699_100289823 Ga0070699_1002898233 113
20 3300005548 Ga0070665_100329574 Ga0070665_1003295743 113
21 3300005577 Ga0068857_101252294 Ga0068857_1012522942 113
22 3300005618 Ga0068864_100389197 Ga0068864_1003891972 113
23 3300005843 Ga0068860_100326211 Ga0068860_1003262113 113
24 3300006852 Ga0075433_10341749 Ga0075433_103417493 113
25 3300006871 Ga0075434_100543881 Ga0075434_1005438812 113
26 3300006914 Ga0075436_100547993 Ga0075436_1005479932 113
27 3300009148 Ga0105243_10191060 Ga0105243_101910603 113
28 3300009177 Ga0105248_10200098 Ga0105248_102000983 113
29 3300013297 Ga0157378_10762053 Ga0157378_107620532 113
30 3300014968 Ga0157379_10804965 Ga0157379_108049651 113
31 3300025903 Ga0207680_11034815 Ga0207680_110348152 113
32 3300025910 Ga0207684_10170846 Ga0207684_101708463 113
33 3300025917 Ga0207660_11027982 Ga0207660_110279821 113
34 3300025922 Ga0207646_10980188 Ga0207646_109801882 113
35 3300025936 Ga0207670_10599313 Ga0207670_105993132 113
36 3300025941 Ga0207711_10475509 Ga0207711_104755092 113
37 3300025972 Ga0207668_10290436 Ga0207668_102904362 113
38 3300026075 Ga0207708_10948467 Ga0207708_109484672 113
39 3300026089 Ga0207648_10043002 Ga0207648_100430024 113
40 3300026089 Ga0207648_10595000 Ga0207648_105950002 113
41 3300028379 Ga0268266_10610670 Ga0268266_106106702 113
42 3300028381 Ga0268264_10317974 Ga0268264_103179743 113
43 3300030745 Ga0316182_1344331 Ga0316182_13443312 113
44 3300035691 Ga0373931_0133088 Ga0373931_0133088_34_390 113
45 3300039062 Ga0400483_149744 Ga0400483_149744_640_999 113
46 3300042876 Ga0451577_0998616 Ga0451577_0998616_370_720 113
47 3300044712 Ga0453684_0315858 Ga0453684_0315858_1106_1456 113
48 3300050514 nmdc:mga08x19_460206_c1 nmdc:mga08x19_460206_c1_306_662 113
49 3300061734 Ga0530510_0793784 Ga0530510_0793784_19_375 113
50 3300003316 rootH1_10075538 rootH1_100755384 114
51 3300003320 rootH2_10026815 rootH2_100268154 114
52 3300003322 rootL2_10000797 rootL2_100007975 114
53 3300003322 rootL2_10010600 rootL2_100106008 114
54 3300003322 rootL2_10069194 rootL2_100691943 114
55 3300003322 rootL2_10230396 rootL2_102303967 114
56 3300003323 rootH1_10015133 rootH1_100151335 114
57 3300003323 rootH1_10098320 rootH1_100983204 114
58 3300003349 JGI26129J50193_1012138 JGI26129J50193_10121381 114
59 3300003794 Ga0055531_10000223 Ga0055531_1000022323 114
60 3300004801 Ga0058860_10009999 Ga0058860_100099992 114
61 3300005327 Ga0070658_10139946 Ga0070658_101399463 114
62 3300005327 Ga0070658_10529419 Ga0070658_105294193 114
63 3300005329 Ga0070683_100510510 Ga0070683_1005105101 114
64 3300005330 Ga0070690_101632962 Ga0070690_1016329621 114
65 3300005331 Ga0070670_100051089 Ga0070670_1000510894 114
66 3300005336 Ga0070680_100775900 Ga0070680_1007759002 114
67 3300005337 Ga0070682_101683731 Ga0070682_1016837311 114
68 3300005338 Ga0068868_102364547 Ga0068868_1023645471 114
69 3300005339 Ga0070660_100210067 Ga0070660_1002100672 114
70 3300005344 Ga0070661_100011265 Ga0070661_1000112655 114
71 3300005345 Ga0070692_10076757 Ga0070692_100767572 114
72 3300005356 Ga0070674_100723008 Ga0070674_1007230081 114
73 3300005434 Ga0070709_10515941 Ga0070709_105159412 114
74 3300005444 Ga0070694_101348831 Ga0070694_1013488312 114
75 3300005455 Ga0070663_101822697 Ga0070663_1018226971 114
76 3300005458 Ga0070681_10472537 Ga0070681_104725371 114
77 3300005459 Ga0068867_101258209 Ga0068867_1012582092 114
78 3300005471 Ga0070698_100675072 Ga0070698_1006750722 114
79 3300005471 Ga0070698_101884987 Ga0070698_1018849871 114
80 3300005530 Ga0070679_100297964 Ga0070679_1002979642 114
81 3300005536 Ga0070697_100186514 Ga0070697_1001865142 114
82 3300005539 Ga0068853_100004773 Ga0068853_1000047737 114
83 3300005545 Ga0070695_100033563 Ga0070695_1000335634 114
84 3300005545 Ga0070695_100485189 Ga0070695_1004851893 114
85 3300005545 Ga0070695_101141423 Ga0070695_1011414231 114
86 3300005547 Ga0070693_100648546 Ga0070693_1006485462 114
87 3300005563 Ga0068855_100127001 Ga0068855_1001270012 114
88 3300005563 Ga0068855_101448036 Ga0068855_1014480362 114
89 3300005564 Ga0070664_100983356 Ga0070664_1009833561 114
90 3300005577 Ga0068857_100182758 Ga0068857_1001827582 114
91 3300005578 Ga0068854_100023482 Ga0068854_1000234824 114
92 3300005578 Ga0068854_101320965 Ga0068854_1013209651 114
93 3300005578 Ga0068854_101631956 Ga0068854_1016319562 114
94 3300005614 Ga0068856_100041566 Ga0068856_1000415664 114
95 3300005616 Ga0068852_100023279 Ga0068852_1000232795 114
96 3300005617 Ga0068859_100601915 Ga0068859_1006019153 114
97 3300005617 Ga0068859_101359303 Ga0068859_1013593031 114
98 3300005618 Ga0068864_100621887 Ga0068864_1006218873 114
99 3300005618 Ga0068864_100635565 Ga0068864_1006355651 114
100 3300005834 Ga0068851_10003679 Ga0068851_100036798 114
101 3300005841 Ga0068863_100167224 Ga0068863_1001672242 114
102 3300005841 Ga0068863_100173322 Ga0068863_1001733223 114
103 3300005843 Ga0068860_101016216 Ga0068860_1010162161 114
104 3300005844 Ga0068862_100720217 Ga0068862_1007202173 114
105 3300005844 Ga0068862_101412302 Ga0068862_1014123022 114
106 3300005981 Ga0081538_10024293 Ga0081538_100242932 114
107 3300006028 Ga0070717_10914747 Ga0070717_109147472 114
108 3300006173 Ga0070716_101429653 Ga0070716_1014296532 114
109 3300006237 Ga0097621_100047293 Ga0097621_1000472932 114
110 3300006358 Ga0068871_102228990 Ga0068871_1022289901 114
111 3300006847 Ga0075431_101692202 Ga0075431_1016922022 114
112 3300006871 Ga0075434_100328787 Ga0075434_1003287872 114
113 3300006880 Ga0075429_100613232 Ga0075429_1006132321 114
114 3300006931 Ga0097620_100601830 Ga0097620_1006018303 114
115 3300006931 Ga0097620_101359311 Ga0097620_1013593111 114
116 3300007076 Ga0075435_101955670 Ga0075435_1019556702 114
117 3300009093 Ga0105240_10184739 Ga0105240_101847394 114
118 3300009093 Ga0105240_10653467 Ga0105240_106534672 114
119 3300009094 Ga0111539_10006568 Ga0111539_1000656811 114
120 3300009094 Ga0111539_12827574 Ga0111539_128275741 114
121 3300009098 Ga0105245_12699101 Ga0105245_126991012 114
122 3300009553 Ga0105249_10682756 Ga0105249_106827563 114
123 3300010375 Ga0105239_10932868 Ga0105239_109328682 114
124 3300010375 Ga0105239_11593522 Ga0105239_115935222 114
125 3300013104 Ga0157370_10000615 Ga0157370_1000061546 114
126 3300013104 Ga0157370_10231814 Ga0157370_102318143 114
127 3300013104 Ga0157370_11873674 Ga0157370_118736741 114
128 3300013306 Ga0163162_10123790 Ga0163162_101237901 114
129 3300013306 Ga0163162_12690008 Ga0163162_126900082 114
130 3300013307 Ga0157372_11235011 Ga0157372_112350111 114
131 3300013308 Ga0157375_10389497 Ga0157375_103894972 114
132 3300014326 Ga0157380_10003590 Ga0157380_100035905 114
133 3300014326 Ga0157380_10106527 Ga0157380_101065271 114
134 3300014326 Ga0157380_10577734 Ga0157380_105777342 114
135 3300014497 Ga0182008_10244133 Ga0182008_102441332 114
136 3300014968 Ga0157379_12340814 Ga0157379_123408141 114
137 3300017792 Ga0163161_10102522 Ga0163161_101025221 114
138 3300017792 Ga0163161_10748081 Ga0163161_107480812 114
139 3300020070 Ga0206356_10764017 Ga0206356_107640171 114
140 3300020082 Ga0206353_10192625 Ga0206353_101926252 114
141 3300022467 Ga0224712_10133994 Ga0224712_101339942 114
142 3300025304 Ga0209257_1000005 Ga0209257_10000051295 114
143 3300025321 Ga0207656_10095241 Ga0207656_100952412 114
144 3300025898 Ga0207692_10363160 Ga0207692_103631602 114
145 3300025909 Ga0207705_10251634 Ga0207705_102516342 114
146 3300025909 Ga0207705_11384794 Ga0207705_113847942 114
147 3300025911 Ga0207654_10114897 Ga0207654_101148971 114
148 3300025912 Ga0207707_10251942 Ga0207707_102519421 114
149 3300025913 Ga0207695_10124075 Ga0207695_101240753 114
150 3300025913 Ga0207695_10278316 Ga0207695_102783161 114
151 3300025916 Ga0207663_10895035 Ga0207663_108950351 114
152 3300025917 Ga0207660_10305737 Ga0207660_103057373 114
153 3300025919 Ga0207657_10179667 Ga0207657_101796672 114
154 3300025920 Ga0207649_10002345 Ga0207649_100023453 114
155 3300025921 Ga0207652_10395204 Ga0207652_103952042 114
156 3300025922 Ga0207646_11173870 Ga0207646_111738702 114
157 3300025924 Ga0207694_10038228 Ga0207694_100382282 114
158 3300025925 Ga0207650_10068254 Ga0207650_100682543 114
159 3300025936 Ga0207670_10641862 Ga0207670_106418621 114
160 3300025937 Ga0207669_10852644 Ga0207669_108526441 114
161 3300025939 Ga0207665_11222936 Ga0207665_112229361 114
162 3300025944 Ga0207661_11163283 Ga0207661_111632832 114
163 3300025949 Ga0207667_10303439 Ga0207667_103034392 114
164 3300025981 Ga0207640_10049881 Ga0207640_100498813 114
165 3300026041 Ga0207639_10018380 Ga0207639_100183805 114
166 3300026067 Ga0207678_11648850 Ga0207678_116488501 114
167 3300026075 Ga0207708_11457338 Ga0207708_114573381 114
168 3300026078 Ga0207702_10059336 Ga0207702_100593364 114
169 3300026088 Ga0207641_10020409 Ga0207641_100204094 114
170 3300026088 Ga0207641_10091432 Ga0207641_100914322 114
171 3300026095 Ga0207676_11924425 Ga0207676_119244251 114
172 3300026116 Ga0207674_10046319 Ga0207674_100463194 114
173 3300026116 Ga0207674_10209820 Ga0207674_102098203 114
174 3300026142 Ga0207698_10019270 Ga0207698_100192702 114
175 3300027471 Ga0209995_1001962 Ga0209995_10019624 114
176 3300027682 Ga0209971_1013789 Ga0209971_10137892 114
177 3300027717 Ga0209998_10009045 Ga0209998_100090454 114
178 3300027876 Ga0209974_10027521 Ga0209974_100275213 114
179 3300027907 Ga0207428_10005431 Ga0207428_100054315 114
180 3300027907 Ga0207428_10024271 Ga0207428_100242713 114
181 3300027907 Ga0207428_10229095 Ga0207428_102290953 114
182 3300028794 Ga0307515_10156052 Ga0307515_101560523 114
183 3300030744 Ga0316181_1124607 Ga0316181_11246072 114
184 3300031090 Ga0265760_10265274 Ga0265760_102652741 114
185 3300031240 Ga0265320_10111178 Ga0265320_101111783 114
186 3300031240 Ga0265320_10139598 Ga0265320_101395981 114
187 3300031241 Ga0265325_10032158 Ga0265325_100321583 114
188 3300031241 Ga0265325_10062753 Ga0265325_100627531 114
189 3300031242 Ga0265329_10050788 Ga0265329_100507882 114
190 3300031247 Ga0265340_10074363 Ga0265340_100743633 114
191 3300031249 Ga0265339_10207672 Ga0265339_102076722 114
192 3300031250 Ga0265331_10066732 Ga0265331_100667321 114
193 3300031251 Ga0265327_10214336 Ga0265327_102143362 114
194 3300031344 Ga0265316_10052063 Ga0265316_100520634 114
195 3300031344 Ga0265316_10325717 Ga0265316_103257171 114
196 3300031507 Ga0307509_10224740 Ga0307509_102247402 114
197 3300031595 Ga0265313_10097292 Ga0265313_100972923 114
198 3300031665 Ga0316575_10004995 Ga0316575_100049953 114
199 3300031691 Ga0316579_10224606 Ga0316579_102246063 114
200 3300031711 Ga0265314_10330408 Ga0265314_103304082 114
201 3300031712 Ga0265342_10433724 Ga0265342_104337242 114
202 3300031728 Ga0316578_10626240 Ga0316578_106262401 114
203 3300031733 Ga0316577_10047310 Ga0316577_100473104 114
204 3300031733 Ga0316577_10129366 Ga0316577_101293663 114
205 3300031824 Ga0307413_10981853 Ga0307413_109818531 114
206 3300032002 Ga0307416_100260697 Ga0307416_1002606972 114
207 3300032004 Ga0307414_10003742 Ga0307414_100037424 114
208 3300032004 Ga0307414_10026130 Ga0307414_100261303 114
209 3300032004 Ga0307414_10735217 Ga0307414_107352172 114
210 3300032133 Ga0316583_10006368 Ga0316583_100063683 114
211 3300032137 Ga0316585_10014228 Ga0316585_100142283 114
212 3300032139 Ga0316580_10124203 Ga0316580_101242031 114
213 3300032168 Ga0316593_10065844 Ga0316593_100658442 114
214 3300032168 Ga0316593_10240568 Ga0316593_102405682 114
215 3300032168 Ga0316593_10254411 Ga0316593_102544111 114
216 3300032168 Ga0316593_10258605 Ga0316593_102586051 114
217 3300032168 Ga0316593_10287767 Ga0316593_102877671 114
218 3300033524 Ga0316592_1175793 Ga0316592_11757932 114
219 3300033528 Ga0316588_1001144 Ga0316588_10011445 114
220 3300034816 Ga0373930_0113889 Ga0373930_0113889_194_547 114
221 3300035114 Ga0373939_0146722 Ga0373939_0146722_122_478 114
222 3300035172 Ga0373955_0648644 Ga0373955_0648644_54_398 114
223 3300035691 Ga0373931_0136360 Ga0373931_0136360_375_728 114
224 3300035695 Ga0373927_0013464 Ga0373927_0013464_180_524 114
225 3300035724 Ga0373933_0117219 Ga0373933_0117219_580_939 114
226 3300036401 Ga0373937_0221467 Ga0373937_0221467_744_1103 114
227 3300036401 Ga0373937_0726992 Ga0373937_0726992_369_713 114
228 3300036647 Ga0316582_0073212 Ga0316582_0073212_1108_1455 114
229 3300036647 Ga0316582_0263103 Ga0316582_0263103_194_547 114
230 3300036712 Ga0316584_0027603 Ga0316584_0027603_714_1067 114
231 3300036712 Ga0316584_0052916 Ga0316584_0052916_1850_2197 114
232 3300037853 Ga0436364_1029426 Ga0436364_1029426_1816_2178 114
233 3300038443 Ga0395901_0051647 Ga0395901_0051647_2054_2398 114
234 3300039062 Ga0400483_005301 Ga0400483_005301_1349_1714 114
235 3300039062 Ga0400483_091982 Ga0400483_091982_586_948 114
236 3300039062 Ga0400483_192549 Ga0400483_192549_2585_2944 114
237 3300039062 Ga0400483_209438 Ga0400483_209438_1603_1968 114
238 3300039437 Ga0436365_1735207 Ga0436365_1735207_295_675 114
239 3300039438 Ga0436360_0989193 Ga0436360_0989193_211_582 114
240 3300041443 Ga0451789_0682187 Ga0451789_0682187_222_566 114
241 3300041444 Ga0451790_07132 Ga0451790_07132_278_622 114
242 3300041458 Ga0451798_0227980 Ga0451798_0227980_413_760 114
243 3300041461 Ga0451805_006867 Ga0451805_006867_29_373 114
244 3300041486 Ga0451807_2105430 Ga0451807_2105430_261_605 114
245 3300041494 Ga0451837_0132719 Ga0451837_0132719_147_491 114
246 3300041494 Ga0451837_1755060 Ga0451837_1755060_721_1065 114
247 3300041505 Ga0451849_1500547 Ga0451849_1500547_503_847 114
248 3300041506 Ga0451850_25346 Ga0451850_25346_172_516 114
249 3300041509 Ga0451843_0026409 Ga0451843_0026409_49_411 114
250 3300041510 Ga0451854_08974 Ga0451854_08974_153_497 114
251 3300041916 Ga0452271_29157 Ga0452271_29157_328_672 114
252 3300042876 Ga0451577_0000064 Ga0451577_0000064_23728_24075 114
253 3300044673 Ga0453683_0001605 Ga0453683_0001605_6021_6368 114
254 3300044673 Ga0453683_0003649 Ga0453683_0003649_6522_6932 114
255 3300044673 Ga0453683_0020824 Ga0453683_0020824_1751_2095 114
256 3300044706 Ga0466964_0036075 Ga0466964_0036075_1320_1664 114
257 3300044712 Ga0453684_0000061 Ga0453684_0000061_23685_24032 114
258 3300044712 Ga0453684_0000954 Ga0453684_0000954_94941_95288 114
259 3300044712 Ga0453684_0031217 Ga0453684_0031217_2914_3270 114
260 3300044712 Ga0453684_0053491 Ga0453684_0053491_862_1209 114
261 3300044712 Ga0453684_0058526 Ga0453684_0058526_4404_4751 114
262 3300045051 Ga0451576_0000343 Ga0451576_0000343_106820_107230 114
263 3300045051 Ga0451576_0001271 Ga0451576_0001271_20179_20526 114
264 3300045051 Ga0451576_0003332 Ga0451576_0003332_21132_21494 114
265 3300045051 Ga0451576_0109133 Ga0451576_0109133_237_581 114
266 3300045051 Ga0451576_0210248 Ga0451576_0210248_1417_1773 114
267 3300045051 Ga0451576_0739293 Ga0451576_0739293_457_801 114
268 3300045051 Ga0451576_1349530 Ga0451576_1349530_95_439 114
269 3300046499 Ga0495594_0441712 Ga0495594_0441712_368_724 114
270 3300046507 Ga0495606_0019797 Ga0495606_0019797_3003_3347 114
271 3300046511 Ga0495608_0425800 Ga0495608_0425800_15_359 114
272 3300046517 Ga0495630_0890032 Ga0495630_0890032_107_463 114
273 3300046536 Ga0495587_0321130 Ga0495587_0321130_482_826 114
274 3300047315 Ga0495581_0807763 Ga0495581_0807763_65_421 114
275 3300048914 Ga0496111_0202150 Ga0496111_0202150_459_812 114
276 3300048915 Ga0496112_0613445 Ga0496112_0613445_407_760 114
277 3300048917 Ga0496114_1524531 Ga0496114_1524531_58_420 114
278 3300048918 Ga0496115_0135415 Ga0496115_0135415_1490_1852 114
279 3300048918 Ga0496115_0161220 Ga0496115_0161220_1349_1693 114
280 3300048928 Ga0496125_0000031 Ga0496125_0000031_354830_355174 114
281 3300048929 Ga0496126_0402358 Ga0496126_0402358_360_704 114
282 3300049127 Ga0501306_035009 Ga0501306_035009_11_376 114
283 3300049161 Ga0501305_054661 Ga0501305_054661_250_618 114
284 3300049529 Ga0501313_018411 Ga0501313_018411_227_589 114
285 3300049535 Ga0501319_013732 Ga0501319_013732_257_625 114
286 3300049536 Ga0501320_060203 Ga0501320_060203_123_515 114
287 3300049540 Ga0501324_022864 Ga0501324_022864_15_383 114
288 3300049551 Ga0501335_023312 Ga0501335_023312_26_370 114
289 3300049552 Ga0501336_012611 Ga0501336_012611_46_390 114
290 3300049571 Ga0501034_0000161 Ga0501034_0000161_26293_26655 114
291 3300049571 Ga0501034_0690158 Ga0501034_0690158_127_471 114
292 3300049571 Ga0501034_0788892 Ga0501034_0788892_80_424 114
293 3300049575 Ga0501039_0605258 Ga0501039_0605258_187_549 114
294 3300049576 Ga0501040_0065504 Ga0501040_0065504_826_1170 114
295 3300049579 Ga0501043_0682502 Ga0501043_0682502_324_692 114
296 3300049581 Ga0501047_0223228 Ga0501047_0223228_565_933 114
297 3300049582 Ga0501048_0526230 Ga0501048_0526230_387_749 114
298 3300049584 Ga0501068_0500687 Ga0501068_0500687_34_396 114
299 3300049585 Ga0501069_0255714 Ga0501069_0255714_521_865 114
300 3300049587 Ga0501071_0898720 Ga0501071_0898720_84_446 114
301 3300049590 Ga0501074_1097597 Ga0501074_1097597_161_529 114
302 3300049590 Ga0501074_1215714 Ga0501074_1215714_129_491 114
303 3300049593 Ga0501077_0635124 Ga0501077_0635124_138_500 114
304 3300049742 Ga0501080_0031691 Ga0501080_0031691_364_741 114
305 3300049742 Ga0501080_0420262 Ga0501080_0420262_639_995 114
306 3300049776 Ga0501280_100196 Ga0501280_100196_87_449 114
307 3300049824 Ga0501045_0458016 Ga0501045_0458016_334_696 114
308 3300050510 nmdc:mga06r32_970897_c1 nmdc:mga06r32_970897_c1_52_411 114
309 3300050511 nmdc:mga08y16_1042479_c1 nmdc:mga08y16_1042479_c1_400_744 114
310 3300050511 nmdc:mga08y16_1584_c1 nmdc:mga08y16_1584_c1_10473_10841 114
311 3300050511 nmdc:mga08y16_326884_c1 nmdc:mga08y16_326884_c1_295_651 114
312 3300050511 nmdc:mga08y16_34092_c1 nmdc:mga08y16_34092_c1_2316_2660 114
313 3300050511 nmdc:mga08y16_64708_c1 nmdc:mga08y16_64708_c1_1321_1677 114
314 3300050512 nmdc:mga0n895_807904_c1 nmdc:mga0n895_807904_c1_326_679 114
315 3300050514 nmdc:mga08x19_753191_c1 nmdc:mga08x19_753191_c1_70_453 114
316 3300053086 Ga0500578_0331327 Ga0500578_0331327_514_858 114
317 3300053096 Ga0500641_0000352 Ga0500641_0000352_11307_11651 114
318 3300053125 Ga0500618_005061 Ga0500618_005061_3071_3436 114
319 3300053146 Ga0500588_0060276 Ga0500588_0060276_584_943 114
320 3300053177 Ga0500636_0002049 Ga0500636_0002049_6589_6954 114
321 3300054114 Ga0501084_0514253 Ga0501084_0514253_595_957 114
322 3300059506 Ga0587085_139189 Ga0587085_139189_185_529 114
323 3300059514 Ga0587095_017030 Ga0587095_017030_17_415 114
324 3300059653 Ga0587108_014148 Ga0587108_014148_48_392 114
325 3300060353 Ga0501082_0323740 Ga0501082_0323740_821_1183 114
326 3300061734 Ga0530510_1116067 Ga0530510_1116067_98_460 114
327 3300061734 Ga0530510_1466940 Ga0530510_1466940_129_491 114

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00453

Ribosomal_L20

Ribosomal protein L20

3

109

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gyz-assembly1.cif.gz_A bacterial ribosomal protein l20 from aquifex aeolicus 0.8854 61 114
4v48-assembly1.cif.gz_AO real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.8585 51 113
2ghj-assembly1.cif.gz_A crystal structure of folded and partially unfolded forms of aquifex aeolicus ribosomal protein l20 0.8155 21 113
6z1p-assembly1.cif.gz_Au structure of the mitochondrial ribosome from tetrahymena thermophila 0.8018 14 113
8apo-assembly1.cif.gz_Ao structure of the mitochondrial ribosome from polytomella magna with trnas bound to the a and p sites 0.7989 14 114
ID Description Score Start End Superfamily
2ghjD02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.9633 53 113 1.10.1900.20
2ghjB02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.9147 58 113 1.10.1900.20
1gyzA00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.8854 61 114 1.10.1900.20
2ghjD02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.8417 53 113 1.10.1900.20
1gyzA00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.7944 61 114 1.10.1900.20
ID Description Score Start End GO Terms
AF-A0A7Y3CE09-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 1 45 114 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A0L8V9X0-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 0.9936 44 114 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A519RZ15-F1-model_v4 50S ribosomal protein L20 0.9853 42 114 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A0F6SFS5-F1-model_v4 50S ribosomal protein L20 0.9851 43 114 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7Y3CE09-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 0.9722 45 114 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
89.48 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map