F408754

General Info

Members Datasets Scaffolds Average Seq Length
327 219 654 235

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10406392|Ga0111539_104063922
Length 274
Sequence VGAPLMTERPTAVGPELEVLELEVLPAWAQPRDHGRPRSPADRLSVRALDVRYGRRMAVLDVDLRVGPGEVVALIGHNGCGKTSTLRAIFGLHPTDRGEVLVNGVETAGDGRAVGRPGMAMVLASRTVFAELTVRENLGLGARHELEAVVAERLAGVLSLFPGLEASLERRAGDVSGGEQRMVGVGIALMSEPSVLLLDEPTRFLAPAAARQVLDTVRRLADERGTGVLLADVNVAAALSIADRVYVMANGRIRSQHDPAELRAAGPTTWWHLF

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
75 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
76 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
82 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
120 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
123 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
126 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
127 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
136 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
137 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
138 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
139 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
140 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
141 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
142 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
143 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
144 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
145 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
146 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
147 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
148 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
149 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
150 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
151 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
152 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
153 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
154 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
155 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
156 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
157 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
172 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
178 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
181 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
182 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
183 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
184 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
185 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
186 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
187 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
188 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
191 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
192 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
193 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
194 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
195 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
196 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
197 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
198 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
199 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
200 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
201 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
202 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
203 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
204 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
205 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
206 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
207 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
208 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
210 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
211 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
212 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
213 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
214 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
215 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
216 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
217 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
218 2738543013 Variovorax sp. BT01 Isolate Unclassified
219 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.25
Metatranscriptomes 0
Isolates 2.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.51
Nodule 0.31
Rhizoplane 0.92
Rhizosphere 75.84
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10406392 3300009094 Bacteria 1586
2 JGI25152J39213_1002162 3300002773 Bacteria 7704
3 JGI25150J39212_1003203 3300002774 Bacteria 3877
4 JGI25151J46595_10050629 3300003187 Bacteria 1413
5 JGI25153J46596_10001286 3300003215 Bacteria 15041
6 JGI25153J46596_10003485 3300003215 Bacteria 8798
7 Ga0055526_1001550 3300003771 Bacteria 16263
8 Ga0055530_10008972 3300003791 Bacteria 3913
9 Ga0065165_1000832 3300005262 Bacteria 40569
10 Ga0065715_10143528 3300005293 Bacteria 1819
11 Ga0070658_10139982 3300005327 Bacteria 2021
12 Ga0070676_10002086 3300005328 Bacteria 10168
13 Ga0070690_100026013 3300005330 Bacteria 3607
14 Ga0070690_100069062 3300005330 Bacteria 2293
15 Ga0070690_100127647 3300005330 Bacteria 1714
16 Ga0070670_100028336 3300005331 Bacteria 4820
17 Ga0070670_100113044 3300005331 Bacteria 2340
18 Ga0070677_10047208 3300005333 Bacteria 1725
19 Ga0068869_100034581 3300005334 Bacteria 3576
20 Ga0070666_10001955 3300005335 Bacteria 12545
21 Ga0068868_100003101 3300005338 Bacteria 11564
22 Ga0070689_100132339 3300005340 Bacteria 2000
23 Ga0070687_100105292 3300005343 Bacteria 1587
24 Ga0070687_100184503 3300005343 Bacteria 1252
25 Ga0070661_100502639 3300005344 Bacteria 970
26 Ga0070668_100001274 3300005347 Bacteria 18003
27 Ga0070668_100365753 3300005347 Bacteria 1224
28 Ga0070669_100000411 3300005353 Bacteria 32862
29 Ga0070675_100006740 3300005354 Bacteria 8833
30 Ga0070671_100103255 3300005355 Bacteria 2391
31 Ga0070674_100004011 3300005356 Bacteria 8342
32 Ga0070674_100031197 3300005356 Bacteria 3529
33 Ga0070673_100001471 3300005364 Bacteria 13789
34 Ga0070688_100095553 3300005365 Bacteria 1951
35 Ga0070667_100002084 3300005367 Bacteria 17667
36 Ga0070667_100086380 3300005367 Bacteria 2691
37 Ga0070700_100012347 3300005441 Bacteria 4763
38 Ga0070678_100000948 3300005456 Bacteria 14931
39 Ga0070678_100159257 3300005456 Bacteria 1827
40 Ga0070662_100433613 3300005457 Bacteria 1089
41 Ga0068867_100002629 3300005459 Bacteria 12667
42 Ga0068867_100007510 3300005459 Bacteria 7708
43 Ga0070685_10145490 3300005466 Bacteria 1497
44 Ga0070672_100013826 3300005543 Bacteria 5707
45 Ga0070672_100037180 3300005543 Bacteria 3713
46 Ga0070686_100529202 3300005544 Bacteria 919
47 Ga0070665_100223542 3300005548 Bacteria 1883
48 Ga0068859_100035816 3300005617 Bacteria 4980
49 Ga0068859_100053433 3300005617 Bacteria 4063
50 Ga0068864_100029185 3300005618 Bacteria 4668
51 Ga0068864_100035078 3300005618 Bacteria 4269
52 Ga0068861_100161386 3300005719 Bacteria 1849
53 Ga0068851_10091277 3300005834 Bacteria 1603
54 Ga0068870_10006343 3300005840 Bacteria 5207
55 Ga0068863_100027975 3300005841 Bacteria 5381
56 Ga0068863_100095896 3300005841 Bacteria 2816
57 Ga0068858_100051530 3300005842 Bacteria 3808
58 Ga0068858_100187211 3300005842 Bacteria 1955
59 Ga0068858_100257762 3300005842 Bacteria 1657
60 Ga0068860_100001387 3300005843 Bacteria 26293
61 Ga0068860_100004646 3300005843 Bacteria 14021
62 Ga0068860_100005311 3300005843 Bacteria 13077
63 Ga0068860_100220712 3300005843 Bacteria 1841
64 Ga0068862_100009604 3300005844 Bacteria 7996
65 Ga0068862_100010800 3300005844 Bacteria 7541
66 Ga0068862_100041663 3300005844 Bacteria 3908
67 Ga0075365_10053623 3300006038 Bacteria 2671
68 Ga0075363_100185327 3300006048 Bacteria 1185
69 Ga0075362_10063872 3300006177 Bacteria 1670
70 Ga0075367_10120068 3300006178 Bacteria 1619
71 Ga0075366_10014892 3300006195 Bacteria 4446
72 Ga0075366_10169583 3300006195 Bacteria 1324
73 Ga0097621_100007774 3300006237 Bacteria 7691
74 Ga0075370_10000825 3300006353 Bacteria 12482
75 Ga0075370_10060778 3300006353 Bacteria 2152
76 Ga0068871_100002112 3300006358 Bacteria 13451
77 Ga0068871_100317619 3300006358 Bacteria 1371
78 Ga0075430_100042207 3300006846 Bacteria 3857
79 Ga0075430_100317552 3300006846 Bacteria 1288
80 Ga0075431_100019506 3300006847 Bacteria 6914
81 Ga0075431_100510606 3300006847 Bacteria 1192
82 Ga0075429_100399575 3300006880 Bacteria 1203
83 Ga0068865_100000371 3300006881 Bacteria 24845
84 Ga0068865_100028857 3300006881 Bacteria 3676
85 Ga0097620_100035816 3300006931 Bacteria 4980
86 Ga0097620_100053433 3300006931 Bacteria 4063
87 Ga0097620_100162601 3300006931 Bacteria 2312
88 Ga0105245_10123142 3300009098 Bacteria 2424
89 Ga0105243_10056478 3300009148 Bacteria 3122
90 Ga0105242_10489382 3300009176 Bacteria 1167
91 Ga0105248_10002843 3300009177 Bacteria 19207
92 Ga0105248_10483919 3300009177 Bacteria 1395
93 Ga0105238_10687771 3300009551 Bacteria 1034
94 Ga0105249_10052708 3300009553 Bacteria 3716
95 Ga0105249_10142374 3300009553 Bacteria 2301
96 Ga0157373_10391680 3300013100 Bacteria 995
97 Ga0157374_10014408 3300013296 Bacteria 6920
98 Ga0157378_10010272 3300013297 Bacteria 8174
99 Ga0157378_10153520 3300013297 Bacteria 2147
100 Ga0163162_10004491 3300013306 Bacteria 13443
101 Ga0163162_10012168 3300013306 Bacteria 8399
102 Ga0157375_10011190 3300013308 Bacteria 7915
103 Ga0157380_10212790 3300014326 Bacteria 1724
104 Ga0157379_10010421 3300014968 Bacteria 8100
105 Ga0157376_10003285 3300014969 Bacteria 11132
106 Ga0163161_10022474 3300017792 Bacteria 4442
107 Ga0207425_1000737 3300025245 Bacteria 17182
108 Ga0209129_1000075 3300025258 Bacteria 201273
109 Ga0209130_1003748 3300025284 Bacteria 6208
110 Ga0209675_1001283 3300025291 Bacteria 14924
111 Ga0209676_1030119 3300025292 Bacteria 1664
112 Ga0209025_1000700 3300025294 Bacteria 57239
113 Ga0209564_1000046 3300025295 Bacteria 373787
114 Ga0209758_1000045 3300025297 Bacteria 369174
115 Ga0209758_1000052 3300025297 Bacteria 338962
116 Ga0209050_1000257 3300025298 Bacteria 114186
117 Ga0209257_1024493 3300025304 Bacteria 2088
118 Ga0207697_10040562 3300025315 Bacteria 1912
119 Ga0207656_10064122 3300025321 Bacteria 1619
120 Ga0207682_10021873 3300025893 Bacteria 2517
121 Ga0207682_10093992 3300025893 Bacteria 1304
122 Ga0207680_10132328 3300025903 Bacteria 1645
123 Ga0207645_10000039 3300025907 Bacteria 88205
124 Ga0207705_10192517 3300025909 Bacteria 1543
125 Ga0207649_10319384 3300025920 Bacteria 1140
126 Ga0207681_10061136 3300025923 Bacteria 2588
127 Ga0207681_10218155 3300025923 Bacteria 1474
128 Ga0207659_10023693 3300025926 Bacteria 4101
129 Ga0207644_10152297 3300025931 Bacteria 1790
130 Ga0207709_10044197 3300025935 Bacteria 2690
131 Ga0207669_10008907 3300025937 Bacteria 4742
132 Ga0207669_10008950 3300025937 Bacteria 4733
133 Ga0207704_10008131 3300025938 Bacteria 4995
134 Ga0207704_10088140 3300025938 Bacteria 2029
135 Ga0207704_10108172 3300025938 Bacteria 1872
136 Ga0207691_10000027 3300025940 Bacteria 126502
137 Ga0207691_10118875 3300025940 Bacteria 2344
138 Ga0207711_10016406 3300025941 Bacteria 6157
139 Ga0207711_10523490 3300025941 Bacteria 1106
140 Ga0207689_10020095 3300025942 Bacteria 5623
141 Ga0207651_10102631 3300025960 Bacteria 2126
142 Ga0207712_10057128 3300025961 Bacteria 2752
143 Ga0207668_10010752 3300025972 Bacteria 5540
144 Ga0207668_10096067 3300025972 Bacteria 2189
145 Ga0207658_10000682 3300025986 Bacteria 29584
146 Ga0207658_10128182 3300025986 Bacteria 2034
147 Ga0207677_10252780 3300026023 Bacteria 1432
148 Ga0207703_10029920 3300026035 Bacteria 4300
149 Ga0207703_10098736 3300026035 Bacteria 2470
150 Ga0207708_10018904 3300026075 Bacteria 5189
151 Ga0207641_10004919 3300026088 Bacteria 11477
152 Ga0207641_10052083 3300026088 Bacteria 3466
153 Ga0207648_10000149 3300026089 Bacteria 70199
154 Ga0207648_10011696 3300026089 Bacteria 8258
155 Ga0207676_10019761 3300026095 Bacteria 4919
156 Ga0207676_10337016 3300026095 Bacteria 1390
157 Ga0207675_100009000 3300026118 Bacteria 9369
158 Ga0207675_100109305 3300026118 Bacteria 2608
159 Ga0207683_10000061 3300026121 Bacteria 81399
160 Ga0207683_10164449 3300026121 Bacteria 2007
161 Ga0209969_1003248 3300027360 Bacteria 2244
162 Ga0209967_1006794 3300027364 Bacteria 1558
163 Ga0209968_1006512 3300027526 Bacteria 1759
164 Ga0209999_1003433 3300027543 Bacteria 2833
165 Ga0268266_10009493 3300028379 Bacteria 8559
166 Ga0268265_10027297 3300028380 Bacteria 4073
167 Ga0268264_10011913 3300028381 Bacteria 7163
168 Ga0268264_10021917 3300028381 Bacteria 5214
169 Ga0268264_10288894 3300028381 Bacteria 1539
170 Ga0268264_10292180 3300028381 Bacteria 1531
171 Ga0307517_10091137 3300028786 Bacteria 2493
172 Ga0307517_10093398 3300028786 Bacteria 2439
173 Ga0307515_10003694 3300028794 Bacteria 32127
174 Ga0307515_10062265 3300028794 Bacteria 5273
175 Ga0307515_10226263 3300028794 Bacteria 1675
176 Ga0265327_10000194 3300031251 Bacteria 129264
177 Ga0307513_10016206 3300031456 Bacteria 9001
178 Ga0307513_10083657 3300031456 Bacteria 3281
179 Ga0307513_10175729 3300031456 Bacteria 2012
180 Ga0307513_10283373 3300031456 Bacteria 1433
181 Ga0307509_10394941 3300031507 Bacteria 1092
182 Ga0307408_100031806 3300031548 Bacteria 3676
183 Ga0307408_100201582 3300031548 Bacteria 1611
184 Ga0307408_100346951 3300031548 Bacteria 1258
185 Ga0316576_10134505 3300031727 Bacteria 1861
186 Ga0316578_10219203 3300031728 Bacteria 1144
187 Ga0307516_10002426 3300031730 Bacteria 24923
188 Ga0307516_10004231 3300031730 Bacteria 17873
189 Ga0307516_10005929 3300031730 Bacteria 14458
190 Ga0307516_10027890 3300031730 Bacteria 5720
191 Ga0307405_10129545 3300031731 Bacteria 1741
192 Ga0307413_10115249 3300031824 Bacteria 1808
193 Ga0307413_10260318 3300031824 Bacteria 1293
194 Ga0307410_10365533 3300031852 Bacteria 1157
195 Ga0307412_10494070 3300031911 Bacteria 1017
196 Ga0307416_100115378 3300032002 Bacteria 2378
197 Ga0307416_100517026 3300032002 Bacteria 1261
198 Ga0316574_0072702 3300035398 Bacteria 2174
199 Ga0395905_0155559 3300037471 Bacteria 2150
200 Ga0451789_0450837 3300041443 Bacteria 876
201 Ga0451795_1053407 3300041456 Bacteria 1805
202 Ga0451833_0575700 3300041491 Bacteria 913
203 Ga0451839_1091095 3300041496 Bacteria 1374
204 Ga0451853_3584764 3300041512 Bacteria 1638
205 Ga0439441_002101 3300042001 Bacteria 2748
206 Ga0439443_001990 3300042003 Bacteria 2379
207 Ga0439445_0009037 3300042004 Bacteria 2342
208 Ga0450888_005948 3300042126 Bacteria 1314
209 Ga0450897_010430 3300042128 Bacteria 892
210 Ga0439434_0072308 3300042435 Bacteria 1087
211 Ga0439435_0001172 3300042436 Bacteria 4712
212 Ga0439444_0005291 3300042437 Bacteria 1909
213 Ga0439460_0002976 3300042461 Bacteria 4086
214 Ga0439460_0047157 3300042461 Bacteria 1282
215 Ga0495650_0004691 3300046471 Bacteria 9226
216 Ga0495610_0044523 3300046512 Bacteria 2203
217 Ga0495610_0066833 3300046512 Bacteria 1692
218 Ga0495632_0002042 3300046519 Bacteria 15864
219 Ga0495632_0070884 3300046519 Bacteria 1675
220 Ga0495643_0105313 3300046522 Bacteria 1440
221 Ga0495642_0154037 3300046528 Bacteria 995
222 Ga0495597_0095760 3300046542 Bacteria 1256
223 Ga0495656_0000171 3300046615 Bacteria 22920
224 Ga0495625_0044662 3300046660 Bacteria 3206
225 Ga0495677_0089672 3300047445 Bacteria 1158
226 Ga0495686_0164458 3300047472 Bacteria 1294
227 Ga0496110_0104435 3300048913 Bacteria 2542
228 Ga0501031_0027550 3300049568 Bacteria 3705
229 Ga0501031_0336710 3300049568 Bacteria 977
230 Ga0501033_0103716 3300049570 Bacteria 2074
231 Ga0501039_0027324 3300049575 Bacteria 4388
232 Ga0501039_0092213 3300049575 Bacteria 2361
233 Ga0501039_0361584 3300049575 Bacteria 1140
234 Ga0501040_0042712 3300049576 Bacteria 3089
235 Ga0501040_0322458 3300049576 Bacteria 1105
236 Ga0501041_0075208 3300049577 Bacteria 2076
237 Ga0501041_0202785 3300049577 Bacteria 1244
238 Ga0501042_0039807 3300049578 Bacteria 3342
239 Ga0501042_0247888 3300049578 Bacteria 1285
240 Ga0501042_0391806 3300049578 Bacteria 1006
241 Ga0501043_0125227 3300049579 Bacteria 2015
242 Ga0501046_0124744 3300049580 Bacteria 1957
243 Ga0501046_0337732 3300049580 Bacteria 1095
244 Ga0501046_0408962 3300049580 Bacteria 979
245 Ga0501048_0034017 3300049582 Bacteria 3679
246 Ga0501071_0000191 3300049587 Bacteria 27590
247 Ga0501071_0083938 3300049587 Bacteria 2334
248 Ga0501072_0033091 3300049588 Bacteria 4050
249 Ga0501072_0078898 3300049588 Bacteria 2607
250 Ga0501074_0087082 3300049590 Bacteria 2237
251 Ga0501074_0136749 3300049590 Bacteria 1753
252 Ga0501074_0578509 3300049590 Bacteria 795
253 Ga0501075_0022290 3300049591 Bacteria 4625
254 Ga0501075_0025919 3300049591 Bacteria 4310
255 Ga0501075_0035016 3300049591 Bacteria 3743
256 Ga0501076_0051183 3300049592 Bacteria 3269
257 Ga0501076_0206925 3300049592 Bacteria 1603
258 Ga0501077_0030202 3300049593 Bacteria 3448
259 Ga0501077_0040388 3300049593 Bacteria 2973
260 Ga0501077_0069784 3300049593 Bacteria 2227
261 Ga0501077_0183054 3300049593 Bacteria 1331
262 Ga0501079_0007640 3300049741 Bacteria 8189
263 Ga0501079_0043496 3300049741 Bacteria 3467
264 Ga0501080_0001849 3300049742 Bacteria 18173
265 Ga0501080_0091750 3300049742 Bacteria 2821
266 Ga0501080_0101148 3300049742 Bacteria 2674
267 Ga0501080_0124175 3300049742 Bacteria 2391
268 Ga0501080_0577267 3300049742 Bacteria 1000
269 Ga0501081_0052880 3300049743 Bacteria 2803
270 Ga0501081_0101118 3300049743 Bacteria 2038
271 Ga0501081_0129697 3300049743 Bacteria 1801
272 Ga0501283_009799 3300049779 Bacteria 1402
273 Ga0501035_0383036 3300049822 Bacteria 1173
274 Ga0501045_0033502 3300049824 Bacteria 3725
275 Ga0501045_0098423 3300049824 Bacteria 2164
276 nmdc:mga03683_27046_c2 3300050489 Bacteria 955
277 nmdc:mga03683_43808_c1 3300050489 Bacteria 1848
278 nmdc:mga03n38_180274_c1 3300050490 Bacteria 1082
279 nmdc:mga00v17_3538_c1 3300050491 Bacteria 8070
280 nmdc:mga0yw44_53927_c1 3300050492 Bacteria 2443
281 nmdc:mga0k408_2052_c1 3300050493 Bacteria 10769
282 nmdc:mga0k408_216765_c1 3300050493 Bacteria 1143
283 nmdc:mga0k408_63366_c1 3300050493 Bacteria 2151
284 nmdc:mga0k408_64964_c1 3300050493 Bacteria 2124
285 nmdc:mga07m45_194_c1 3300050496 Bacteria 24053
286 nmdc:mga09592_255581_c1 3300050508 Bacteria 1519
287 nmdc:mga0qj67_20012_c1 3300050509 Bacteria 5121
288 nmdc:mga0qj67_416775_c1 3300050509 Bacteria 1083
289 nmdc:mga06r32_360533_c1 3300050510 Bacteria 1438
290 nmdc:mga06r32_53619_c1 3300050510 Bacteria 3863
291 nmdc:mga0sz30_193732_c1 3300050516 Bacteria 902
292 nmdc:mga0sz30_32502_c1 3300050516 Bacteria 2164
293 Ga0500635_0066765 3300053080 Bacteria 1268
294 Ga0500578_0001274 3300053086 Bacteria 26109
295 Ga0500644_0013050 3300053088 Bacteria 2312
296 Ga0500583_0001275 3300053092 Bacteria 7190
297 Ga0500641_0188462 3300053096 Bacteria 884
298 Ga0500562_001157 3300053108 Bacteria 6495
299 Ga0500562_022313 3300053108 Bacteria 1650
300 Ga0500593_006313 3300053117 Bacteria 4737
301 Ga0500642_0022160 3300053130 Bacteria 2529
302 Ga0500652_000948 3300053131 Bacteria 9611
303 Ga0500658_0030541 3300053134 Bacteria 2102
304 Ga0500559_0053455 3300053136 Bacteria 1788
305 Ga0500568_0023214 3300053139 Bacteria 2640
306 Ga0500622_0000164 3300053156 Bacteria 70630
307 Ga0500587_002291 3300053739 Bacteria 2725
308 Ga0501084_0023221 3300054114 Bacteria 5178
309 Ga0501084_0052006 3300054114 Bacteria 3428
310 Ga0590071_013364 3300059421 Bacteria 1922
311 Ga0590074_019942 3300059423 Bacteria 1152
312 Ga0590075_030387 3300059424 Bacteria 1368
313 Ga0501082_0011090 3300060353 Bacteria 7749
314 Ga0501082_0170801 3300060353 Bacteria 1890
315 Ga0530510_0131038 3300061734 Bacteria 1845
316 Ga0530510_0162384 3300061734 Bacteria 1653
317 Ga0530510_0165510 3300061734 Bacteria 1636
318 Ga0530510_0494238 3300061734 Bacteria 927
319 2587730000 2585428057 Bacteria 6737412
320 2587734874 2585428058 Bacteria 6853932
321 2587757927 2585428062 Bacteria 6842168
322 2588293175 2588253510 Bacteria 6901809
323 2643968405 2643221592 Bacteria 6608788
324 2644141803 2643221625 Bacteria 6512927
325 2644272527 2643221648 Bacteria 6521465
326 2739252128 2738543013 Bacteria 5618633
327 2935767069 2935760218 Bacteria 9817913
328 Ga0111539_10406392
329 JGI25152J39213_1002162
330 JGI25150J39212_1003203
331 JGI25151J46595_10050629
332 JGI25153J46596_10001286
333 JGI25153J46596_10003485
334 Ga0055526_1001550
335 Ga0055530_10008972
336 Ga0065165_1000832
337 Ga0065715_10143528
338 Ga0070658_10139982
339 Ga0070676_10002086
340 Ga0070690_100026013
341 Ga0070690_100069062
342 Ga0070690_100127647
343 Ga0070670_100028336
344 Ga0070670_100113044
345 Ga0070677_10047208
346 Ga0068869_100034581
347 Ga0070666_10001955
348 Ga0068868_100003101
349 Ga0070689_100132339
350 Ga0070687_100105292
351 Ga0070687_100184503
352 Ga0070661_100502639
353 Ga0070668_100001274
354 Ga0070668_100365753
355 Ga0070669_100000411
356 Ga0070675_100006740
357 Ga0070671_100103255
358 Ga0070674_100004011
359 Ga0070674_100031197
360 Ga0070673_100001471
361 Ga0070688_100095553
362 Ga0070667_100002084
363 Ga0070667_100086380
364 Ga0070700_100012347
365 Ga0070678_100000948
366 Ga0070678_100159257
367 Ga0070662_100433613
368 Ga0068867_100002629
369 Ga0068867_100007510
370 Ga0070685_10145490
371 Ga0070672_100013826
372 Ga0070672_100037180
373 Ga0070686_100529202
374 Ga0070665_100223542
375 Ga0068859_100035816
376 Ga0068859_100053433
377 Ga0068864_100029185
378 Ga0068864_100035078
379 Ga0068861_100161386
380 Ga0068851_10091277
381 Ga0068870_10006343
382 Ga0068863_100027975
383 Ga0068863_100095896
384 Ga0068858_100051530
385 Ga0068858_100187211
386 Ga0068858_100257762
387 Ga0068860_100001387
388 Ga0068860_100004646
389 Ga0068860_100005311
390 Ga0068860_100220712
391 Ga0068862_100009604
392 Ga0068862_100010800
393 Ga0068862_100041663
394 Ga0075365_10053623
395 Ga0075363_100185327
396 Ga0075362_10063872
397 Ga0075367_10120068
398 Ga0075366_10014892
399 Ga0075366_10169583
400 Ga0097621_100007774
401 Ga0075370_10000825
402 Ga0075370_10060778
403 Ga0068871_100002112
404 Ga0068871_100317619
405 Ga0075430_100042207
406 Ga0075430_100317552
407 Ga0075431_100019506
408 Ga0075431_100510606
409 Ga0075429_100399575
410 Ga0068865_100000371
411 Ga0068865_100028857
412 Ga0097620_100035816
413 Ga0097620_100053433
414 Ga0097620_100162601
415 Ga0105245_10123142
416 Ga0105243_10056478
417 Ga0105242_10489382
418 Ga0105248_10002843
419 Ga0105248_10483919
420 Ga0105238_10687771
421 Ga0105249_10052708
422 Ga0105249_10142374
423 Ga0157373_10391680
424 Ga0157374_10014408
425 Ga0157378_10010272
426 Ga0157378_10153520
427 Ga0163162_10004491
428 Ga0163162_10012168
429 Ga0157375_10011190
430 Ga0157380_10212790
431 Ga0157379_10010421
432 Ga0157376_10003285
433 Ga0163161_10022474
434 Ga0207425_1000737
435 Ga0209129_1000075
436 Ga0209130_1003748
437 Ga0209675_1001283
438 Ga0209676_1030119
439 Ga0209025_1000700
440 Ga0209564_1000046
441 Ga0209758_1000045
442 Ga0209758_1000052
443 Ga0209050_1000257
444 Ga0209257_1024493
445 Ga0207697_10040562
446 Ga0207656_10064122
447 Ga0207682_10021873
448 Ga0207682_10093992
449 Ga0207680_10132328
450 Ga0207645_10000039
451 Ga0207705_10192517
452 Ga0207649_10319384
453 Ga0207681_10061136
454 Ga0207681_10218155
455 Ga0207659_10023693
456 Ga0207644_10152297
457 Ga0207709_10044197
458 Ga0207669_10008907
459 Ga0207669_10008950
460 Ga0207704_10008131
461 Ga0207704_10088140
462 Ga0207704_10108172
463 Ga0207691_10000027
464 Ga0207691_10118875
465 Ga0207711_10016406
466 Ga0207711_10523490
467 Ga0207689_10020095
468 Ga0207651_10102631
469 Ga0207712_10057128
470 Ga0207668_10010752
471 Ga0207668_10096067
472 Ga0207658_10000682
473 Ga0207658_10128182
474 Ga0207677_10252780
475 Ga0207703_10029920
476 Ga0207703_10098736
477 Ga0207708_10018904
478 Ga0207641_10004919
479 Ga0207641_10052083
480 Ga0207648_10000149
481 Ga0207648_10011696
482 Ga0207676_10019761
483 Ga0207676_10337016
484 Ga0207675_100009000
485 Ga0207675_100109305
486 Ga0207683_10000061
487 Ga0207683_10164449
488 Ga0209969_1003248
489 Ga0209967_1006794
490 Ga0209968_1006512
491 Ga0209999_1003433
492 Ga0268266_10009493
493 Ga0268265_10027297
494 Ga0268264_10011913
495 Ga0268264_10021917
496 Ga0268264_10288894
497 Ga0268264_10292180
498 Ga0307517_10091137
499 Ga0307517_10093398
500 Ga0307515_10003694
501 Ga0307515_10062265
502 Ga0307515_10226263
503 Ga0265327_10000194
504 Ga0307513_10016206
505 Ga0307513_10083657
506 Ga0307513_10175729
507 Ga0307513_10283373
508 Ga0307509_10394941
509 Ga0307408_100031806
510 Ga0307408_100201582
511 Ga0307408_100346951
512 Ga0316576_10134505
513 Ga0316578_10219203
514 Ga0307516_10002426
515 Ga0307516_10004231
516 Ga0307516_10005929
517 Ga0307516_10027890
518 Ga0307405_10129545
519 Ga0307413_10115249
520 Ga0307413_10260318
521 Ga0307410_10365533
522 Ga0307412_10494070
523 Ga0307416_100115378
524 Ga0307416_100517026
525 Ga0316574_0072702
526 Ga0395905_0155559
527 Ga0451789_0450837
528 Ga0451795_1053407
529 Ga0451833_0575700
530 Ga0451839_1091095
531 Ga0451853_3584764
532 Ga0439441_002101
533 Ga0439443_001990
534 Ga0439445_0009037
535 Ga0450888_005948
536 Ga0450897_010430
537 Ga0439434_0072308
538 Ga0439435_0001172
539 Ga0439444_0005291
540 Ga0439460_0002976
541 Ga0439460_0047157
542 Ga0495650_0004691
543 Ga0495610_0044523
544 Ga0495610_0066833
545 Ga0495632_0002042
546 Ga0495632_0070884
547 Ga0495643_0105313
548 Ga0495642_0154037
549 Ga0495597_0095760
550 Ga0495656_0000171
551 Ga0495625_0044662
552 Ga0495677_0089672
553 Ga0495686_0164458
554 Ga0496110_0104435
555 Ga0501031_0027550
556 Ga0501031_0336710
557 Ga0501033_0103716
558 Ga0501039_0027324
559 Ga0501039_0092213
560 Ga0501039_0361584
561 Ga0501040_0042712
562 Ga0501040_0322458
563 Ga0501041_0075208
564 Ga0501041_0202785
565 Ga0501042_0039807
566 Ga0501042_0247888
567 Ga0501042_0391806
568 Ga0501043_0125227
569 Ga0501046_0124744
570 Ga0501046_0337732
571 Ga0501046_0408962
572 Ga0501048_0034017
573 Ga0501071_0000191
574 Ga0501071_0083938
575 Ga0501072_0033091
576 Ga0501072_0078898
577 Ga0501074_0087082
578 Ga0501074_0136749
579 Ga0501074_0578509
580 Ga0501075_0022290
581 Ga0501075_0025919
582 Ga0501075_0035016
583 Ga0501076_0051183
584 Ga0501076_0206925
585 Ga0501077_0030202
586 Ga0501077_0040388
587 Ga0501077_0069784
588 Ga0501077_0183054
589 Ga0501079_0007640
590 Ga0501079_0043496
591 Ga0501080_0001849
592 Ga0501080_0091750
593 Ga0501080_0101148
594 Ga0501080_0124175
595 Ga0501080_0577267
596 Ga0501081_0052880
597 Ga0501081_0101118
598 Ga0501081_0129697
599 Ga0501283_009799
600 Ga0501035_0383036
601 Ga0501045_0033502
602 Ga0501045_0098423
603 nmdc:mga03683_27046_c2
604 nmdc:mga03683_43808_c1
605 nmdc:mga03n38_180274_c1
606 nmdc:mga00v17_3538_c1
607 nmdc:mga0yw44_53927_c1
608 nmdc:mga0k408_2052_c1
609 nmdc:mga0k408_216765_c1
610 nmdc:mga0k408_63366_c1
611 nmdc:mga0k408_64964_c1
612 nmdc:mga07m45_194_c1
613 nmdc:mga09592_255581_c1
614 nmdc:mga0qj67_20012_c1
615 nmdc:mga0qj67_416775_c1
616 nmdc:mga06r32_360533_c1
617 nmdc:mga06r32_53619_c1
618 nmdc:mga0sz30_193732_c1
619 nmdc:mga0sz30_32502_c1
620 Ga0500635_0066765
621 Ga0500578_0001274
622 Ga0500644_0013050
623 Ga0500583_0001275
624 Ga0500641_0188462
625 Ga0500562_001157
626 Ga0500562_022313
627 Ga0500593_006313
628 Ga0500642_0022160
629 Ga0500652_000948
630 Ga0500658_0030541
631 Ga0500559_0053455
632 Ga0500568_0023214
633 Ga0500622_0000164
634 Ga0500587_002291
635 Ga0501084_0023221
636 Ga0501084_0052006
637 Ga0590071_013364
638 Ga0590074_019942
639 Ga0590075_030387
640 Ga0501082_0011090
641 Ga0501082_0170801
642 Ga0530510_0131038
643 Ga0530510_0162384
644 Ga0530510_0165510
645 Ga0530510_0494238
646 2587730000
647 2587734874
648 2587757927
649 2588293175
650 2643968405
651 2644141803
652 2644272527
653 2739252128
654 2935767069

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

59

203

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.924 10 241
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9152 12 228
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.8944 12 241
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.8925 12 239
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.8906 10 241
ID Description Score Start End Superfamily
af_A0A1D6Q2V7_231_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9237 10 75 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9226 8 241 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9164 12 223 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9136 12 240 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9074 8 241 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A160UW17-F1-model_v4 deleted 0.9924 11 241
AF-A0A160UW17-F1-model_v4 deleted 0.9797 11 241
AF-A0A652ZTX6-F1-model_v4 High-affinity branched-chain amino acid transport ATP-binding protein BraG 0.9762 11 241 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A1F3ZYT2-F1-model_v4 ABC transporter ATP-binding protein 0.9732 19 241 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887
AF-A0A4R3M7V2-F1-model_v4 Amino acid/amide ABC transporter ATP-binding protein 2 (HAAT family) 0.9695 12 241 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887

Map