F408947

General Info

Members Datasets Scaffolds Average Seq Length
327 230 327 183

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0052344|Ga0495686_0052344_1470_2078
Length 202
Sequence LRSCCSPFPPGAEALVKLNKIYTRTGDDGTTGLVDGSRVPKSDPRMAAIGDVDEANSAIGVARTHFMDSAEFDAMLARIQNDLFDLGADLATPLAGDQTYALRVTPAQAEWLEHSIDRMNSGLAPLKSFVLPAGEAGAAALHLARAITRRAERSAVAAAATADIRAEVLTYLNRLSDFLFVAARAVNQNGAGDVLWVPGASR

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
69 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
70 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
73 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
75 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
133 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
141 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
142 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
143 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
148 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
149 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
150 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
151 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
152 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
155 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
156 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
157 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
158 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
159 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
160 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
161 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
162 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
163 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
166 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
167 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
168 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
169 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
170 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
171 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
174 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
175 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
176 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
177 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
178 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
179 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
194 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
195 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
196 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
197 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
198 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
199 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
200 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
201 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
202 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
213 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
214 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
215 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
216 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
217 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
218 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
219 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
220 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
221 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
222 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
223 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
224 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
225 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
226 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
227 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
228 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
229 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
230 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.17
Nodule 0
Rhizoplane 3.67
Rhizosphere 81.96
Stem 0
Stem Tuber 0
Unclassified 5.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1002108 3300001915 Bacteria 5312
2 JGI24740J21852_10000988 3300001979 Bacteria 12702
3 JGI24740J21852_10063484 3300001979 Bacteria 1011
4 JGI24737J22298_10002123 3300001990 Bacteria 7072
5 JGI24735J21928_10051921 3300002067 Bacteria 1183
6 JGI25153J46596_10000007 3300003215 Bacteria 377573
7 Ga0055525_1000127 3300003759 Bacteria 113683
8 Ga0070658_10000716 3300005327 Bacteria 28749
9 Ga0070658_10013018 3300005327 Bacteria 6676
10 Ga0070658_10049683 3300005327 Bacteria 3398
11 Ga0070658_10358492 3300005327 Bacteria 1249
12 Ga0070676_10214013 3300005328 Bacteria 1270
13 Ga0070670_100001596 3300005331 Bacteria 18298
14 Ga0070670_100506244 3300005331 Bacteria 1074
15 Ga0070666_10000598 3300005335 Bacteria 21686
16 Ga0070660_100000212 3300005339 Bacteria 39028
17 Ga0070660_100386955 3300005339 Bacteria 1155
18 Ga0070692_10034336 3300005345 Bacteria 2562
19 Ga0070668_100014928 3300005347 Bacteria 5807
20 Ga0070669_100000001 3300005353 Bacteria 537589
21 Ga0070675_100140238 3300005354 Bacteria 2066
22 Ga0070671_100000007 3300005355 Bacteria 250397
23 Ga0070674_100000209 3300005356 Bacteria 28138
24 Ga0070674_100531932 3300005356 Bacteria 983
25 Ga0070673_100166900 3300005364 Bacteria 1876
26 Ga0070673_100855925 3300005364 Bacteria 841
27 Ga0070659_100094940 3300005366 Bacteria 2395
28 Ga0070667_100042248 3300005367 Bacteria 3825
29 Ga0070667_100297191 3300005367 Bacteria 1453
30 Ga0070705_100122983 3300005440 Bacteria 1679
31 Ga0070708_100002367 3300005445 Bacteria 14596
32 Ga0070708_100004154 3300005445 Bacteria 11369
33 Ga0070708_100008609 3300005445 Bacteria 8196
34 Ga0070663_101046342 3300005455 Bacteria 711
35 Ga0070678_100001063 3300005456 Bacteria 14344
36 Ga0070678_101128401 3300005456 Bacteria 725
37 Ga0070662_100056253 3300005457 Bacteria 2855
38 Ga0070662_100070515 3300005457 Bacteria 2575
39 Ga0068867_100416022 3300005459 Bacteria 1138
40 Ga0070707_100046578 3300005468 Bacteria 4150
41 Ga0070679_100136585 3300005530 Bacteria 2433
42 Ga0070697_100140304 3300005536 Bacteria 2032
43 Ga0068853_100000592 3300005539 Bacteria 24848
44 Ga0070686_100198963 3300005544 Bacteria 1435
45 Ga0070665_100000084 3300005548 Bacteria 180481
46 Ga0070665_100031261 3300005548 Bacteria 5358
47 Ga0068855_100000079 3300005563 Bacteria 117264
48 Ga0070664_100371756 3300005564 Bacteria 1303
49 Ga0068857_101202389 3300005577 Bacteria 734
50 Ga0068856_100334840 3300005614 Bacteria 1531
51 Ga0068859_100000294 3300005617 Bacteria 49703
52 Ga0068864_100030177 3300005618 Bacteria 4595
53 Ga0068861_100028256 3300005719 Bacteria 4092
54 Ga0068863_100003969 3300005841 Bacteria 14610
55 Ga0068858_100008774 3300005842 Bacteria 9697
56 Ga0068860_100001225 3300005843 Bacteria 27956
57 Ga0068862_100007071 3300005844 Bacteria 9319
58 Ga0070717_10001790 3300006028 Bacteria 14984
59 Ga0070712_100243259 3300006175 Unclassified 1434
60 Ga0075370_10046602 3300006353 Bacteria 2453
61 Ga0068871_100023276 3300006358 Bacteria 4789
62 Ga0097620_100000294 3300006931 Bacteria 49703
63 Ga0105240_10307329 3300009093 Unclassified 1812
64 Ga0105247_10000569 3300009101 Bacteria 30032
65 Ga0105243_10000388 3300009148 Bacteria 46841
66 Ga0105243_11034699 3300009148 Bacteria 826
67 Ga0105241_10012716 3300009174 Bacteria 6177
68 Ga0105248_10036583 3300009177 Bacteria 5490
69 Ga0105237_10186238 3300009545 Unclassified 2076
70 Ga0105249_10005513 3300009553 Bacteria 10933
71 Ga0105239_11501517 3300010375 Bacteria 779
72 Ga0105239_12026062 3300010375 Bacteria 668
73 Ga0105246_10061329 3300011119 Bacteria 2616
74 Ga0157373_10104476 3300013100 Bacteria 1992
75 Ga0157371_10000011 3300013102 Bacteria 377608
76 Ga0157371_10000558 3300013102 Bacteria 44161
77 Ga0157371_10011263 3300013102 Bacteria 6906
78 Ga0157371_10041575 3300013102 Bacteria 3279
79 Ga0157371_10501089 3300013102 Bacteria 897
80 Ga0157370_10124451 3300013104 Bacteria 2407
81 Ga0157374_10425578 3300013296 Bacteria 1327
82 Ga0163162_10073777 3300013306 Bacteria 3469
83 Ga0157372_10183971 3300013307 Bacteria 2419
84 Ga0157372_10225065 3300013307 Bacteria 2175
85 Ga0163163_10107295 3300014325 Bacteria 2819
86 Ga0157379_10110725 3300014968 Bacteria 2466
87 Ga0163161_10222128 3300017792 Bacteria 1463
88 Ga0206353_11057062 3300020082 Bacteria 1105
89 Ga0213872_10000350 3300021361 Bacteria 38938
90 Ga0213872_10016886 3300021361 Bacteria 3382
91 Ga0213872_10031888 3300021361 Bacteria 2415
92 Ga0213872_10124734 3300021361 Bacteria 1137
93 Ga0213875_10012825 3300021388 Bacteria 4129
94 Ga0209674_105675 3300025226 Bacteria 1807
95 Ga0209563_100125 3300025230 Bacteria 113854
96 Ga0209026_1017896 3300025250 Bacteria 1126
97 Ga0209677_109316 3300025253 Bacteria 1777
98 Ga0209233_1008500 3300025261 Bacteria 3174
99 Ga0209233_1026606 3300025261 Bacteria 1411
100 Ga0209455_1022384 3300025272 Bacteria 1206
101 Ga0209758_1000017 3300025297 Bacteria 754393
102 Ga0207697_10008759 3300025315 Bacteria 4406
103 Ga0207656_10063540 3300025321 Bacteria 1625
104 Ga0207710_10011520 3300025900 Bacteria 3721
105 Ga0207680_10000600 3300025903 Bacteria 16998
106 Ga0207647_10010978 3300025904 Bacteria 6371
107 Ga0207647_10124832 3300025904 Bacteria 1515
108 Ga0207645_10068638 3300025907 Bacteria 2267
109 Ga0207705_10000190 3300025909 Bacteria 62546
110 Ga0207705_10001711 3300025909 Bacteria 17397
111 Ga0207705_10186205 3300025909 Bacteria 1568
112 Ga0207705_10229964 3300025909 Bacteria 1410
113 Ga0207705_10360477 3300025909 Bacteria 1121
114 Ga0207654_10000246 3300025911 Bacteria 32849
115 Ga0207695_10033239 3300025913 Bacteria 5630
116 Ga0207695_10549432 3300025913 Bacteria 1036
117 Ga0207671_10042814 3300025914 Bacteria 3351
118 Ga0207693_10272997 3300025915 Unclassified 1325
119 Ga0207657_10000407 3300025919 Bacteria 45521
120 Ga0207657_10002570 3300025919 Bacteria 19633
121 Ga0207657_10176679 3300025919 Bacteria 1728
122 Ga0207657_10196601 3300025919 Bacteria 1624
123 Ga0207657_10414684 3300025919 Bacteria 1059
124 Ga0207649_10001563 3300025920 Bacteria 13376
125 Ga0207649_10069292 3300025920 Bacteria 2246
126 Ga0207652_10089227 3300025921 Bacteria 2707
127 Ga0207646_10032576 3300025922 Bacteria 4716
128 Ga0207681_10000002 3300025923 Bacteria 985597
129 Ga0207650_10027821 3300025925 Bacteria 4050
130 Ga0207650_10488561 3300025925 Bacteria 1028
131 Ga0207650_10559697 3300025925 Bacteria 959
132 Ga0207659_10087314 3300025926 Bacteria 2321
133 Ga0207644_10000002 3300025931 Bacteria 942221
134 Ga0207690_10000630 3300025932 Bacteria 22732
135 Ga0207706_10165691 3300025933 Bacteria 1942
136 Ga0207706_10498952 3300025933 Bacteria 1051
137 Ga0207709_10000116 3300025935 Bacteria 123061
138 Ga0207669_10000022 3300025937 Bacteria 100002
139 Ga0207669_10497792 3300025937 Bacteria 974
140 Ga0207704_10087607 3300025938 Bacteria 2034
141 Ga0207661_10256600 3300025944 Bacteria 1556
142 Ga0207667_10000001 3300025949 Bacteria 1178522
143 Ga0207667_10001479 3300025949 Bacteria 29480
144 Ga0207667_10740089 3300025949 Bacteria 983
145 Ga0207712_10146289 3300025961 Bacteria 1820
146 Ga0207668_10000463 3300025972 Bacteria 25556
147 Ga0207640_10007061 3300025981 Bacteria 6185
148 Ga0207640_11089532 3300025981 Bacteria 706
149 Ga0207658_10002991 3300025986 Bacteria 12086
150 Ga0207658_10082667 3300025986 Bacteria 2467
151 Ga0207703_10011124 3300026035 Bacteria 7006
152 Ga0207639_10030774 3300026041 Bacteria 3938
153 Ga0207678_10002526 3300026067 Bacteria 16670
154 Ga0207702_10002653 3300026078 Bacteria 16796
155 Ga0207641_10025978 3300026088 Bacteria 4831
156 Ga0207648_10329461 3300026089 Bacteria 1373
157 Ga0207676_10022592 3300026095 Bacteria 4627
158 Ga0207674_10111943 3300026116 Bacteria 2704
159 Ga0207674_10616462 3300026116 Bacteria 1048
160 Ga0207675_100005694 3300026118 Bacteria 11925
161 Ga0207683_10004363 3300026121 Bacteria 12218
162 Ga0207683_10824441 3300026121 Bacteria 861
163 Ga0207698_10157092 3300026142 Bacteria 1983
164 Ga0268266_10000002 3300028379 Bacteria 3059047
165 Ga0268266_10079444 3300028379 Bacteria 2856
166 Ga0268265_10000065 3300028380 Bacteria 142834
167 Ga0268264_10000071 3300028381 Bacteria 267236
168 Ga0307517_10008198 3300028786 Bacteria 15025
169 Ga0265338_10013280 3300028800 Bacteria 9313
170 Ga0307408_100152772 3300031548 Bacteria 1824
171 Ga0307413_10033414 3300031824 Bacteria 2929
172 Ga0307410_10022617 3300031852 Bacteria 3890
173 Ga0307406_10109412 3300031901 Bacteria 1899
174 Ga0307412_10580382 3300031911 Bacteria 946
175 Ga0307409_102698386 3300031995 Bacteria 525
176 Ga0307416_100243218 3300032002 Bacteria 1745
177 Ga0307416_102187998 3300032002 Bacteria 654
178 Ga0307414_10245960 3300032004 Bacteria 1484
179 Ga0307414_10971222 3300032004 Bacteria 781
180 Ga0307411_10096167 3300032005 Bacteria 2081
181 Ga0307411_10119441 3300032005 Bacteria 1904
182 Ga0307510_10041550 3300033180 Bacteria 5025
183 Ga0316574_0394679 3300035398 Bacteria 872
184 Ga0395899_0000737 3300037312 Bacteria 32666
185 Ga0395899_0051334 3300037312 Bacteria 3061
186 Ga0395899_0057000 3300037312 Bacteria 2886
187 Ga0395899_0140269 3300037312 Bacteria 1720
188 Ga0395899_0249948 3300037312 Bacteria 1217
189 Ga0395900_0000364 3300037418 Bacteria 65068
190 Ga0395900_0530217 3300037418 Bacteria 1124
191 Ga0395898_0019963 3300037466 Bacteria 6814
192 Ga0395905_0091731 3300037471 Bacteria 2848
193 Ga0395905_0162552 3300037471 Bacteria 2098
194 Ga0395905_0362221 3300037471 Bacteria 1343
195 Ga0436364_1155132 3300037853 Bacteria 16641
196 Ga0395901_0000209 3300038443 Bacteria 73635
197 Ga0395901_0056589 3300038443 Bacteria 4080
198 Ga0395901_0072640 3300038443 Bacteria 3587
199 Ga0436360_0389708 3300039438 Bacteria 1608
200 Ga0436361_0248698 3300039447 Bacteria 1358
201 Ga0436361_0436707 3300039447 Bacteria 1113
202 Ga0436361_0584244 3300039447 Bacteria 4384
203 Ga0436361_0681369 3300039447 Bacteria 2475
204 Ga0436361_0855224 3300039447 Bacteria 1066
205 Ga0436361_0954566 3300039447 Bacteria 1477
206 Ga0436361_1053164 3300039447 Bacteria 1479
207 Ga0450918_055006 3300042531 Bacteria 729
208 Ga0466966_0001152 3300044684 Bacteria 16994
209 Ga0466957_0256105 3300044842 Bacteria 1165
210 Ga0466959_0134539 3300045049 Bacteria 1751
211 Ga0466967_0310372 3300045976 Bacteria 1519
212 Ga0466967_1386644 3300045976 Bacteria 700
213 Ga0495638_0020131 3300046460 Bacteria 4409
214 Ga0495650_0000967 3300046471 Bacteria 32924
215 Ga0495584_0142256 3300046491 Bacteria 1218
216 Ga0495585_0074848 3300046492 Bacteria 1842
217 Ga0495596_0002245 3300046500 Bacteria 10515
218 Ga0495583_0001392 3300046506 Bacteria 24725
219 Ga0495583_0022735 3300046506 Bacteria 3189
220 Ga0495583_0026156 3300046506 Bacteria 2900
221 Ga0495583_0049378 3300046506 Bacteria 1927
222 Ga0495583_0066402 3300046506 Bacteria 1596
223 Ga0495606_0000178 3300046507 Bacteria 112329
224 Ga0495606_0117414 3300046507 Bacteria 1596
225 Ga0495610_0089157 3300046512 Bacteria 1401
226 Ga0495616_0028640 3300046513 Bacteria 2948
227 Ga0495620_0177664 3300046515 Bacteria 824
228 Ga0495631_0008546 3300046518 Bacteria 5155
229 Ga0495631_0058191 3300046518 Bacteria 1681
230 Ga0495637_0006333 3300046520 Bacteria 5947
231 Ga0495643_0003953 3300046522 Bacteria 10606
232 Ga0495643_0024114 3300046522 Bacteria 3453
233 Ga0495643_0038389 3300046522 Bacteria 2623
234 Ga0495643_0124480 3300046522 Bacteria 1299
235 Ga0495648_0005491 3300046524 Bacteria 10521
236 Ga0495663_0001685 3300046525 Bacteria 6891
237 Ga0495663_0011324 3300046525 Bacteria 2483
238 Ga0495663_0014108 3300046525 Bacteria 2238
239 Ga0495642_0014556 3300046528 Bacteria 3048
240 Ga0495654_0000620 3300046530 Bacteria 28271
241 Ga0495645_0158777 3300046543 Bacteria 1565
242 Ga0495622_0004613 3300046557 Bacteria 6382
243 Ga0495633_0000308 3300046558 Bacteria 55659
244 Ga0495633_0043661 3300046558 Bacteria 2126
245 Ga0495633_0114846 3300046558 Bacteria 1248
246 Ga0495668_0000013 3300046616 Bacteria 452938
247 Ga0495668_0001088 3300046616 Bacteria 28328
248 Ga0495668_0042487 3300046616 Bacteria 2531
249 Ga0495668_0077130 3300046616 Bacteria 1830
250 Ga0495611_0003563 3300046648 Bacteria 6844
251 Ga0495611_0053247 3300046648 Bacteria 1826
252 Ga0495625_0000397 3300046660 Bacteria 66539
253 Ga0495625_0025884 3300046660 Bacteria 4440
254 Ga0495625_0037553 3300046660 Bacteria 3553
255 Ga0495625_0094483 3300046660 Bacteria 2063
256 Ga0495625_0625318 3300046660 Bacteria 644
257 Ga0495661_0076996 3300046665 Bacteria 1934
258 Ga0495669_0000515 3300046684 Bacteria 17617
259 Ga0495613_0567429 3300046689 Bacteria 758
260 Ga0495649_0062557 3300046694 Bacteria 2000
261 Ga0495600_0041539 3300046809 Bacteria 2997
262 Ga0495660_0054496 3300046810 Bacteria 2166
263 Ga0495683_0019558 3300047323 Bacteria 3494
264 Ga0495683_0033113 3300047323 Bacteria 2631
265 Ga0495687_000250 3300047443 Bacteria 72797
266 Ga0495687_000614 3300047443 Bacteria 41339
267 Ga0495677_0000498 3300047445 Bacteria 16705
268 Ga0495681_0021885 3300047470 Bacteria 3434
269 Ga0495686_0000262 3300047472 Bacteria 94462
270 Ga0495686_0052344 3300047472 Bacteria 2560
271 Ga0495615_0042916 3300048090 Bacteria 1136
272 Ga0496101_0139913 3300048904 Bacteria 1844
273 Ga0496102_0001391 3300048905 Bacteria 21494
274 Ga0496102_0256561 3300048905 Bacteria 1648
275 Ga0496103_0000055 3300048906 Bacteria 143870
276 Ga0496104_0006008 3300048907 Bacteria 10644
277 Ga0496105_0000358 3300048908 Bacteria 30167
278 Ga0496110_0032833 3300048913 Bacteria 4487
279 Ga0496111_0014255 3300048914 Bacteria 5425
280 Ga0496112_1726718 3300048915 Bacteria 538
281 Ga0496113_0046399 3300048916 Bacteria 3225
282 Ga0496114_0005872 3300048917 Bacteria 9647
283 Ga0496115_0000267 3300048918 Bacteria 46248
284 Ga0496117_0000549 3300048920 Bacteria 61657
285 Ga0496118_0000552 3300048921 Bacteria 61677
286 Ga0496119_0003632 3300048922 Bacteria 15861
287 Ga0496120_0049069 3300048923 Bacteria 2425
288 Ga0496121_0001191 3300048924 Bacteria 45526
289 Ga0496122_0014451 3300048925 Bacteria 7632
290 Ga0496123_0047464 3300048926 Bacteria 2901
291 Ga0496124_0000585 3300048927 Bacteria 61469
292 Ga0496125_0001142 3300048928 Bacteria 40357
293 Ga0496125_0456703 3300048928 Bacteria 730
294 Ga0496126_0001094 3300048929 Bacteria 45520
295 Ga0496126_0396029 3300048929 Bacteria 1121
296 Ga0501033_0015378 3300049570 Bacteria 5805
297 Ga0501034_0433196 3300049571 Bacteria 1234
298 Ga0501034_0830551 3300049571 Bacteria 815
299 Ga0501036_0512644 3300049572 Bacteria 998
300 Ga0501038_0041942 3300049574 Bacteria 3988
301 Ga0501039_0546065 3300049575 Bacteria 909
302 Ga0501047_0193555 3300049581 Bacteria 1896
303 Ga0501035_0015500 3300049822 Bacteria 7031
304 Ga0501035_0212585 3300049822 Bacteria 1654
305 Ga0501044_0013532 3300049823 Bacteria 8820
306 Ga0501044_1003605 3300049823 Bacteria 706
307 Ga0501045_0741240 3300049824 Bacteria 724
308 nmdc:mga0k408_15621_c1 3300050493 Bacteria 4200
309 Ga0500610_0000092 3300053079 Bacteria 27411
310 Ga0500643_001723 3300053087 Bacteria 12139
311 Ga0500641_0047984 3300053096 Bacteria 1748
312 Ga0500562_030409 3300053108 Bacteria 1423
313 Ga0500592_001951 3300053116 Bacteria 3316
314 Ga0500595_002254 3300053119 Bacteria 9758
315 Ga0500597_271185 3300053120 Bacteria 687
316 Ga0500607_102173 3300053121 Bacteria 1422
317 Ga0500642_0001228 3300053130 Bacteria 7335
318 Ga0500568_0074205 3300053139 Bacteria 1298
319 Ga0500573_0048717 3300053140 Bacteria 2439
320 Ga0500604_0013997 3300053151 Bacteria 2180
321 Ga0500604_0100946 3300053151 Bacteria 951
322 Ga0500619_003506 3300053154 Bacteria 3227
323 Ga0500624_000085 3300053157 Bacteria 47798
324 Ga0500627_0000110 3300053158 Bacteria 26911
325 Ga0500636_0007580 3300053177 Bacteria 6276
326 Ga0500637_0000023 3300053178 Bacteria 61044
327 Ga0500645_000024 3300053730 Bacteria 126024

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025315 Ga0207697_10008759 Ga0207697_100087595 149
2 3300005331 Ga0070670_100506244 Ga0070670_1005062442 154
3 3300025925 Ga0207650_10488561 Ga0207650_104885612 154
4 3300037312 Ga0395899_0057000 Ga0395899_0057000_18_482 154
5 3300048915 Ga0496112_1726718 Ga0496112_1726718_31_495 154
6 3300031995 Ga0307409_102698386 Ga0307409_1026983861 155
7 3300037312 Ga0395899_0249948 Ga0395899_0249948_728_1195 155
8 3300042531 Ga0450918_055006 Ga0450918_055006_27_494 155
9 3300045976 Ga0466967_1386644 Ga0466967_1386644_199_669 155
10 3300046660 Ga0495625_0000397 Ga0495625_0000397_48469_48981 162
11 3300053151 Ga0500604_0100946 Ga0500604_0100946_308_811 162
12 3300046525 Ga0495663_0014108 Ga0495663_0014108_472_1047 164
13 3300053116 Ga0500592_001951 Ga0500592_001951_1191_1766 164
14 3300053139 Ga0500568_0074205 Ga0500568_0074205_261_866 164
15 3300005331 Ga0070670_100001596 Ga0070670_10000159612 165
16 3300005335 Ga0070666_10000598 Ga0070666_100005984 165
17 3300005347 Ga0070668_100014928 Ga0070668_1000149286 165
18 3300005353 Ga0070669_100000001 Ga0070669_100000001105 165
19 3300005355 Ga0070671_100000007 Ga0070671_100000007162 165
20 3300005367 Ga0070667_100042248 Ga0070667_1000422484 165
21 3300005440 Ga0070705_100122983 Ga0070705_1001229832 165
22 3300005544 Ga0070686_100198963 Ga0070686_1001989632 165
23 3300005548 Ga0070665_100031261 Ga0070665_1000312614 165
24 3300005617 Ga0068859_100000294 Ga0068859_10000029416 165
25 3300005618 Ga0068864_100030177 Ga0068864_1000301774 165
26 3300005719 Ga0068861_100028256 Ga0068861_1000282565 165
27 3300005841 Ga0068863_100003969 Ga0068863_1000039696 165
28 3300005842 Ga0068858_100008774 Ga0068858_1000087743 165
29 3300005843 Ga0068860_100001225 Ga0068860_10000122512 165
30 3300005844 Ga0068862_100007071 Ga0068862_1000070712 165
31 3300006931 Ga0097620_100000294 Ga0097620_10000029416 165
32 3300009101 Ga0105247_10000569 Ga0105247_1000056916 165
33 3300009177 Ga0105248_10036583 Ga0105248_100365831 165
34 3300009553 Ga0105249_10005513 Ga0105249_100055137 165
35 3300013306 Ga0163162_10073777 Ga0163162_100737773 165
36 3300014325 Ga0163163_10107295 Ga0163163_101072951 165
37 3300014968 Ga0157379_10110725 Ga0157379_101107252 165
38 3300025900 Ga0207710_10011520 Ga0207710_100115203 165
39 3300025903 Ga0207680_10000600 Ga0207680_100006002 165
40 3300025923 Ga0207681_10000002 Ga0207681_10000002898 165
41 3300025925 Ga0207650_10027821 Ga0207650_100278214 165
42 3300025931 Ga0207644_10000002 Ga0207644_10000002838 165
43 3300025961 Ga0207712_10146289 Ga0207712_101462893 165
44 3300025972 Ga0207668_10000463 Ga0207668_1000046321 165
45 3300025986 Ga0207658_10002991 Ga0207658_1000299110 165
46 3300026035 Ga0207703_10011124 Ga0207703_100111246 165
47 3300026088 Ga0207641_10025978 Ga0207641_100259786 165
48 3300026095 Ga0207676_10022592 Ga0207676_100225923 165
49 3300026118 Ga0207675_100005694 Ga0207675_1000056943 165
50 3300028379 Ga0268266_10079444 Ga0268266_100794442 165
51 3300028380 Ga0268265_10000065 Ga0268265_10000065138 165
52 3300028381 Ga0268264_10000071 Ga0268264_1000007184 165
53 3300053087 Ga0500643_001723 Ga0500643_001723_10833_11351 167
54 3300031548 Ga0307408_100152772 Ga0307408_1001527723 168
55 3300031824 Ga0307413_10033414 Ga0307413_100334143 168
56 3300031901 Ga0307406_10109412 Ga0307406_101094122 168
57 3300031911 Ga0307412_10580382 Ga0307412_105803822 168
58 3300032002 Ga0307416_100243218 Ga0307416_1002432183 168
59 3300032005 Ga0307411_10119441 Ga0307411_101194412 168
60 3300005445 Ga0070708_100004154 Ga0070708_1000041547 170
61 3300005445 Ga0070708_100008609 Ga0070708_1000086094 170
62 3300005468 Ga0070707_100046578 Ga0070707_1000465782 170
63 3300005536 Ga0070697_100140304 Ga0070697_1001403041 170
64 3300025922 Ga0207646_10032576 Ga0207646_100325766 170
65 3300005445 Ga0070708_100002367 Ga0070708_10000236712 176
66 3300006028 Ga0070717_10001790 Ga0070717_1000179013 176
67 3300006175 Ga0070712_100243259 Ga0070712_1002432592 176
68 3300009093 Ga0105240_10307329 Ga0105240_103073292 176
69 3300009545 Ga0105237_10186238 Ga0105237_101862382 176
70 3300013307 Ga0157372_10225065 Ga0157372_102250652 176
71 3300025913 Ga0207695_10549432 Ga0207695_105494322 176
72 3300025915 Ga0207693_10272997 Ga0207693_102729972 176
73 3300046460 Ga0495638_0020131 Ga0495638_0020131_2756_3325 176
74 3300045049 Ga0466959_0134539 Ga0466959_0134539_873_1433 177
75 3300048929 Ga0496126_0396029 Ga0496126_0396029_374_955 177
76 3300013102 Ga0157371_10000011 Ga0157371_1000001168 178
77 3300035398 Ga0316574_0394679 Ga0316574_0394679_140_709 179
78 3300053108 Ga0500562_030409 Ga0500562_030409_371_925 180
79 3300006353 Ga0075370_10046602 Ga0075370_100466022 181
80 3300046491 Ga0495584_0142256 Ga0495584_0142256_623_1189 181
81 3300046512 Ga0495610_0089157 Ga0495610_0089157_679_1245 181
82 3300046522 Ga0495643_0038389 Ga0495643_0038389_1968_2534 181
83 3300046528 Ga0495642_0014556 Ga0495642_0014556_1782_2348 181
84 3300047445 Ga0495677_0000498 Ga0495677_0000498_5915_6481 181
85 3300053140 Ga0500573_0048717 Ga0500573_0048717_655_1218 183
86 3300047472 Ga0495686_0000262 Ga0495686_0000262_8360_8914 184
87 3300047472 Ga0495686_0052344 Ga0495686_0052344_1470_2078 184
88 3300053096 Ga0500641_0047984 Ga0500641_0047984_337_903 184
89 3300053120 Ga0500597_271185 Ga0500597_271185_107_673 184
90 3300053157 Ga0500624_000085 Ga0500624_000085_25585_26151 184
91 3300053178 Ga0500637_0000023 Ga0500637_0000023_20158_20724 184
92 3300003215 JGI25153J46596_10000007 JGI25153J46596_10000007325 185
93 3300003759 Ga0055525_1000127 Ga0055525_100012761 185
94 3300005327 Ga0070658_10000716 Ga0070658_1000071612 185
95 3300005327 Ga0070658_10013018 Ga0070658_100130186 185
96 3300005328 Ga0070676_10214013 Ga0070676_102140132 185
97 3300005339 Ga0070660_100000212 Ga0070660_10000021229 185
98 3300005339 Ga0070660_100386955 Ga0070660_1003869553 185
99 3300005345 Ga0070692_10034336 Ga0070692_100343362 185
100 3300005354 Ga0070675_100140238 Ga0070675_1001402382 185
101 3300005356 Ga0070674_100000209 Ga0070674_1000002093 185
102 3300005356 Ga0070674_100531932 Ga0070674_1005319322 185
103 3300005364 Ga0070673_100166900 Ga0070673_1001669003 185
104 3300005364 Ga0070673_100855925 Ga0070673_1008559251 185
105 3300005367 Ga0070667_100297191 Ga0070667_1002971912 185
106 3300005456 Ga0070678_100001063 Ga0070678_10000106316 185
107 3300005456 Ga0070678_101128401 Ga0070678_1011284011 185
108 3300005457 Ga0070662_100056253 Ga0070662_1000562533 185
109 3300005457 Ga0070662_100070515 Ga0070662_1000705151 185
110 3300005459 Ga0068867_100416022 Ga0068867_1004160222 185
111 3300005530 Ga0070679_100136585 Ga0070679_1001365853 185
112 3300005539 Ga0068853_100000592 Ga0068853_10000059217 185
113 3300005548 Ga0070665_100000084 Ga0070665_10000008490 185
114 3300005563 Ga0068855_100000079 Ga0068855_10000007993 185
115 3300005577 Ga0068857_101202389 Ga0068857_1012023891 185
116 3300006358 Ga0068871_100023276 Ga0068871_1000232766 185
117 3300009148 Ga0105243_10000388 Ga0105243_1000038840 185
118 3300009148 Ga0105243_11034699 Ga0105243_110346991 185
119 3300011119 Ga0105246_10061329 Ga0105246_100613292 185
120 3300013100 Ga0157373_10104476 Ga0157373_101044763 185
121 3300013102 Ga0157371_10000558 Ga0157371_1000055830 185
122 3300013102 Ga0157371_10011263 Ga0157371_100112634 185
123 3300013102 Ga0157371_10041575 Ga0157371_100415754 185
124 3300013104 Ga0157370_10124451 Ga0157370_101244513 185
125 3300013296 Ga0157374_10425578 Ga0157374_104255782 185
126 3300017792 Ga0163161_10222128 Ga0163161_102221282 185
127 3300025226 Ga0209674_105675 Ga0209674_1056752 185
128 3300025230 Ga0209563_100125 Ga0209563_10012554 185
129 3300025250 Ga0209026_1017896 Ga0209026_10178962 185
130 3300025253 Ga0209677_109316 Ga0209677_1093162 185
131 3300025261 Ga0209233_1008500 Ga0209233_10085002 185
132 3300025272 Ga0209455_1022384 Ga0209455_10223842 185
133 3300025297 Ga0209758_1000017 Ga0209758_1000017321 185
134 3300025904 Ga0207647_10010978 Ga0207647_100109783 185
135 3300025907 Ga0207645_10068638 Ga0207645_100686382 185
136 3300025909 Ga0207705_10000190 Ga0207705_1000019045 185
137 3300025909 Ga0207705_10186205 Ga0207705_101862052 185
138 3300025909 Ga0207705_10229964 Ga0207705_102299643 185
139 3300025919 Ga0207657_10000407 Ga0207657_1000040731 185
140 3300025919 Ga0207657_10002570 Ga0207657_1000257014 185
141 3300025919 Ga0207657_10176679 Ga0207657_101766792 185
142 3300025919 Ga0207657_10414684 Ga0207657_104146842 185
143 3300025920 Ga0207649_10069292 Ga0207649_100692922 185
144 3300025921 Ga0207652_10089227 Ga0207652_100892273 185
145 3300025925 Ga0207650_10559697 Ga0207650_105596972 185
146 3300025926 Ga0207659_10087314 Ga0207659_100873142 185
147 3300025933 Ga0207706_10165691 Ga0207706_101656913 185
148 3300025933 Ga0207706_10498952 Ga0207706_104989521 185
149 3300025935 Ga0207709_10000116 Ga0207709_1000011650 185
150 3300025937 Ga0207669_10000022 Ga0207669_1000002232 185
151 3300025937 Ga0207669_10497792 Ga0207669_104977922 185
152 3300025938 Ga0207704_10087607 Ga0207704_100876073 185
153 3300025949 Ga0207667_10001479 Ga0207667_1000147931 185
154 3300025986 Ga0207658_10082667 Ga0207658_100826672 185
155 3300026089 Ga0207648_10329461 Ga0207648_103294612 185
156 3300026116 Ga0207674_10616462 Ga0207674_106164622 185
157 3300026121 Ga0207683_10004363 Ga0207683_1000436311 185
158 3300026121 Ga0207683_10824441 Ga0207683_108244412 185
159 3300028379 Ga0268266_10000002 Ga0268266_10000002816 185
160 3300028786 Ga0307517_10008198 Ga0307517_100081988 185
161 3300033180 Ga0307510_10041550 Ga0307510_100415502 185
162 3300037312 Ga0395899_0000737 Ga0395899_0000737_19635_20192 185
163 3300037312 Ga0395899_0140269 Ga0395899_0140269_1052_1609 185
164 3300037418 Ga0395900_0000364 Ga0395900_0000364_11109_11666 185
165 3300037466 Ga0395898_0019963 Ga0395898_0019963_2443_3000 185
166 3300037471 Ga0395905_0091731 Ga0395905_0091731_1743_2300 185
167 3300038443 Ga0395901_0000209 Ga0395901_0000209_53403_53960 185
168 3300044684 Ga0466966_0001152 Ga0466966_0001152_2932_3489 185
169 3300046471 Ga0495650_0000967 Ga0495650_0000967_29010_29570 185
170 3300046492 Ga0495585_0074848 Ga0495585_0074848_1006_1563 185
171 3300046500 Ga0495596_0002245 Ga0495596_0002245_1359_1916 185
172 3300046506 Ga0495583_0001392 Ga0495583_0001392_2793_3353 185
173 3300046506 Ga0495583_0022735 Ga0495583_0022735_2259_2816 185
174 3300046506 Ga0495583_0026156 Ga0495583_0026156_859_1416 185
175 3300046506 Ga0495583_0049378 Ga0495583_0049378_63_620 185
176 3300046506 Ga0495583_0066402 Ga0495583_0066402_836_1393 185
177 3300046507 Ga0495606_0000178 Ga0495606_0000178_72448_73005 185
178 3300046507 Ga0495606_0117414 Ga0495606_0117414_953_1513 185
179 3300046513 Ga0495616_0028640 Ga0495616_0028640_20_577 185
180 3300046515 Ga0495620_0177664 Ga0495620_0177664_81_638 185
181 3300046518 Ga0495631_0008546 Ga0495631_0008546_3578_4135 185
182 3300046518 Ga0495631_0058191 Ga0495631_0058191_146_703 185
183 3300046520 Ga0495637_0006333 Ga0495637_0006333_1865_2422 185
184 3300046522 Ga0495643_0003953 Ga0495643_0003953_8084_8641 185
185 3300046522 Ga0495643_0024114 Ga0495643_0024114_1671_2228 185
186 3300046522 Ga0495643_0124480 Ga0495643_0124480_90_647 185
187 3300046524 Ga0495648_0005491 Ga0495648_0005491_3956_4513 185
188 3300046525 Ga0495663_0001685 Ga0495663_0001685_6037_6594 185
189 3300046557 Ga0495622_0004613 Ga0495622_0004613_771_1331 185
190 3300046558 Ga0495633_0000308 Ga0495633_0000308_26412_26969 185
191 3300046558 Ga0495633_0043661 Ga0495633_0043661_375_935 185
192 3300046558 Ga0495633_0114846 Ga0495633_0114846_197_766 185
193 3300046616 Ga0495668_0000013 Ga0495668_0000013_249352_249909 185
194 3300046616 Ga0495668_0042487 Ga0495668_0042487_471_1031 185
195 3300046616 Ga0495668_0077130 Ga0495668_0077130_512_1069 185
196 3300046648 Ga0495611_0003563 Ga0495611_0003563_1678_2235 185
197 3300046648 Ga0495611_0053247 Ga0495611_0053247_92_649 185
198 3300046660 Ga0495625_0025884 Ga0495625_0025884_2538_3095 185
199 3300046660 Ga0495625_0037553 Ga0495625_0037553_2015_2572 185
200 3300046660 Ga0495625_0094483 Ga0495625_0094483_408_965 185
201 3300046660 Ga0495625_0625318 Ga0495625_0625318_27_587 185
202 3300046665 Ga0495661_0076996 Ga0495661_0076996_1025_1585 185
203 3300046684 Ga0495669_0000515 Ga0495669_0000515_9037_9594 185
204 3300046689 Ga0495613_0567429 Ga0495613_0567429_93_653 185
205 3300046694 Ga0495649_0062557 Ga0495649_0062557_193_750 185
206 3300046809 Ga0495600_0041539 Ga0495600_0041539_1942_2502 185
207 3300046810 Ga0495660_0054496 Ga0495660_0054496_1594_2151 185
208 3300047323 Ga0495683_0019558 Ga0495683_0019558_2617_3174 185
209 3300047323 Ga0495683_0033113 Ga0495683_0033113_458_1015 185
210 3300047443 Ga0495687_000250 Ga0495687_000250_35421_35978 185
211 3300047443 Ga0495687_000614 Ga0495687_000614_6565_7122 185
212 3300047470 Ga0495681_0021885 Ga0495681_0021885_907_1464 185
213 3300048090 Ga0495615_0042916 Ga0495615_0042916_215_772 185
214 3300048904 Ga0496101_0139913 Ga0496101_0139913_983_1540 185
215 3300048905 Ga0496102_0001391 Ga0496102_0001391_14675_15232 185
216 3300048906 Ga0496103_0000055 Ga0496103_0000055_121511_122068 185
217 3300048907 Ga0496104_0006008 Ga0496104_0006008_4434_4991 185
218 3300048908 Ga0496105_0000358 Ga0496105_0000358_23960_24517 185
219 3300048913 Ga0496110_0032833 Ga0496110_0032833_1169_1726 185
220 3300048914 Ga0496111_0014255 Ga0496111_0014255_2619_3176 185
221 3300048916 Ga0496113_0046399 Ga0496113_0046399_1814_2371 185
222 3300048917 Ga0496114_0005872 Ga0496114_0005872_7108_7665 185
223 3300048918 Ga0496115_0000267 Ga0496115_0000267_39321_39878 185
224 3300048920 Ga0496117_0000549 Ga0496117_0000549_21975_22532 185
225 3300048921 Ga0496118_0000552 Ga0496118_0000552_21857_22414 185
226 3300048922 Ga0496119_0003632 Ga0496119_0003632_5679_6236 185
227 3300048923 Ga0496120_0049069 Ga0496120_0049069_31_588 185
228 3300048924 Ga0496121_0001191 Ga0496121_0001191_5651_6208 185
229 3300048925 Ga0496122_0014451 Ga0496122_0014451_5682_6239 185
230 3300048926 Ga0496123_0047464 Ga0496123_0047464_2068_2625 185
231 3300048927 Ga0496124_0000585 Ga0496124_0000585_21728_22285 185
232 3300048928 Ga0496125_0001142 Ga0496125_0001142_33634_34191 185
233 3300048928 Ga0496125_0456703 Ga0496125_0456703_12_581 185
234 3300048929 Ga0496126_0001094 Ga0496126_0001094_5659_6216 185
235 3300050493 nmdc:mga0k408_15621_c1 nmdc:mga0k408_15621_c1_2650_3207 185
236 3300053079 Ga0500610_0000092 Ga0500610_0000092_4817_5374 185
237 3300053119 Ga0500595_002254 Ga0500595_002254_3018_3578 185
238 3300053121 Ga0500607_102173 Ga0500607_102173_71_631 185
239 3300053130 Ga0500642_0001228 Ga0500642_0001228_474_1031 185
240 3300053154 Ga0500619_003506 Ga0500619_003506_430_990 185
241 3300053177 Ga0500636_0007580 Ga0500636_0007580_2744_3301 185
242 3300053730 Ga0500645_000024 Ga0500645_000024_37101_37658 185
243 3300001979 JGI24740J21852_10063484 JGI24740J21852_100634842 186
244 3300005327 Ga0070658_10358492 Ga0070658_103584922 186
245 3300013102 Ga0157371_10501089 Ga0157371_105010891 186
246 3300020082 Ga0206353_11057062 Ga0206353_110570622 186
247 3300021361 Ga0213872_10000350 Ga0213872_1000035015 186
248 3300021361 Ga0213872_10016886 Ga0213872_100168862 186
249 3300021361 Ga0213872_10031888 Ga0213872_100318882 186
250 3300021361 Ga0213872_10124734 Ga0213872_101247342 186
251 3300021388 Ga0213875_10012825 Ga0213875_100128255 186
252 3300025261 Ga0209233_1026606 Ga0209233_10266062 186
253 3300025909 Ga0207705_10360477 Ga0207705_103604772 186
254 3300031852 Ga0307410_10022617 Ga0307410_100226173 186
255 3300032002 Ga0307416_102187998 Ga0307416_1021879981 186
256 3300032004 Ga0307414_10245960 Ga0307414_102459602 186
257 3300032004 Ga0307414_10971222 Ga0307414_109712222 186
258 3300032005 Ga0307411_10096167 Ga0307411_100961672 186
259 3300037312 Ga0395899_0051334 Ga0395899_0051334_343_906 186
260 3300037418 Ga0395900_0530217 Ga0395900_0530217_543_1106 186
261 3300037471 Ga0395905_0162552 Ga0395905_0162552_673_1236 186
262 3300037471 Ga0395905_0362221 Ga0395905_0362221_423_983 186
263 3300037853 Ga0436364_1155132 Ga0436364_1155132_950_1510 186
264 3300038443 Ga0395901_0056589 Ga0395901_0056589_1524_2087 186
265 3300038443 Ga0395901_0072640 Ga0395901_0072640_1376_1939 186
266 3300039438 Ga0436360_0389708 Ga0436360_0389708_276_845 186
267 3300039447 Ga0436361_0248698 Ga0436361_0248698_60_629 186
268 3300039447 Ga0436361_0436707 Ga0436361_0436707_236_805 186
269 3300039447 Ga0436361_0584244 Ga0436361_0584244_3607_4176 186
270 3300039447 Ga0436361_0681369 Ga0436361_0681369_405_974 186
271 3300039447 Ga0436361_0855224 Ga0436361_0855224_113_682 186
272 3300039447 Ga0436361_0954566 Ga0436361_0954566_730_1299 186
273 3300039447 Ga0436361_1053164 Ga0436361_1053164_611_1180 186
274 3300045976 Ga0466967_0310372 Ga0466967_0310372_793_1356 186
275 3300046525 Ga0495663_0011324 Ga0495663_0011324_1612_2187 186
276 3300046530 Ga0495654_0000620 Ga0495654_0000620_12121_12696 186
277 3300046543 Ga0495645_0158777 Ga0495645_0158777_436_999 186
278 3300046616 Ga0495668_0001088 Ga0495668_0001088_15814_16389 186
279 3300048905 Ga0496102_0256561 Ga0496102_0256561_834_1409 186
280 3300049570 Ga0501033_0015378 Ga0501033_0015378_3630_4211 186
281 3300049571 Ga0501034_0433196 Ga0501034_0433196_331_912 186
282 3300049571 Ga0501034_0830551 Ga0501034_0830551_41_613 186
283 3300049572 Ga0501036_0512644 Ga0501036_0512644_103_684 186
284 3300049574 Ga0501038_0041942 Ga0501038_0041942_1690_2271 186
285 3300049575 Ga0501039_0546065 Ga0501039_0546065_269_850 186
286 3300049581 Ga0501047_0193555 Ga0501047_0193555_729_1310 186
287 3300049822 Ga0501035_0015500 Ga0501035_0015500_136_717 186
288 3300049822 Ga0501035_0212585 Ga0501035_0212585_984_1565 186
289 3300049823 Ga0501044_0013532 Ga0501044_0013532_4965_5546 186
290 3300049823 Ga0501044_1003605 Ga0501044_1003605_108_689 186
291 3300049824 Ga0501045_0741240 Ga0501045_0741240_47_628 186
292 3300053151 Ga0500604_0013997 Ga0500604_0013997_432_1007 186
293 3300053158 Ga0500627_0000110 Ga0500627_0000110_14473_15048 186
294 3300001915 JGI24741J21665_1002108 JGI24741J21665_10021087 187
295 3300001979 JGI24740J21852_10000988 JGI24740J21852_100009882 187
296 3300001990 JGI24737J22298_10002123 JGI24737J22298_100021236 187
297 3300002067 JGI24735J21928_10051921 JGI24735J21928_100519212 187
298 3300005327 Ga0070658_10049683 Ga0070658_100496833 187
299 3300005366 Ga0070659_100094940 Ga0070659_1000949403 187
300 3300005455 Ga0070663_101046342 Ga0070663_1010463421 187
301 3300005564 Ga0070664_100371756 Ga0070664_1003717563 187
302 3300005614 Ga0068856_100334840 Ga0068856_1003348401 187
303 3300009174 Ga0105241_10012716 Ga0105241_100127165 187
304 3300010375 Ga0105239_11501517 Ga0105239_115015171 187
305 3300010375 Ga0105239_12026062 Ga0105239_120260621 187
306 3300013307 Ga0157372_10183971 Ga0157372_101839714 187
307 3300025321 Ga0207656_10063540 Ga0207656_100635401 187
308 3300025904 Ga0207647_10124832 Ga0207647_101248323 187
309 3300025909 Ga0207705_10001711 Ga0207705_100017116 187
310 3300025911 Ga0207654_10000246 Ga0207654_1000024629 187
311 3300025913 Ga0207695_10033239 Ga0207695_100332395 187
312 3300025914 Ga0207671_10042814 Ga0207671_100428142 187
313 3300025919 Ga0207657_10196601 Ga0207657_101966012 187
314 3300025920 Ga0207649_10001563 Ga0207649_100015638 187
315 3300025932 Ga0207690_10000630 Ga0207690_1000063025 187
316 3300025944 Ga0207661_10256600 Ga0207661_102566002 187
317 3300025949 Ga0207667_10000001 Ga0207667_10000001545 187
318 3300025949 Ga0207667_10740089 Ga0207667_107400891 187
319 3300025981 Ga0207640_10007061 Ga0207640_100070618 187
320 3300025981 Ga0207640_11089532 Ga0207640_110895321 187
321 3300026041 Ga0207639_10030774 Ga0207639_100307745 187
322 3300026067 Ga0207678_10002526 Ga0207678_100025261 187
323 3300026078 Ga0207702_10002653 Ga0207702_100026538 187
324 3300026116 Ga0207674_10111943 Ga0207674_101119433 187
325 3300026142 Ga0207698_10157092 Ga0207698_101570922 187
326 3300028800 Ga0265338_10013280 Ga0265338_1001328012 187
327 3300044842 Ga0466957_0256105 Ga0466957_0256105_537_1121 187

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01923

Cob_adeno_trans

Cobalamin adenosyltransferase

21

186

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8g3k-assembly1.cif.gz_B cryo-em imaging scaffold subunits a and b used to display kras g12c complex with gdp 0.9581 30 172
2ah6-assembly1.cif.gz_C crystal structure of a putative cobalamin adenosyltransferase (bh1595) from bacillus halodurans c-125 at 1.60 a resolution 0.9489 29 182
5im6-assembly1.cif.gz_A crystal structure of designed two-component self-assembling icosahedral cage i32-28 0.9452 29 181
3ke4-assembly1.cif.gz_B crystal structure of a pduo-type atp:cob(i)alamin adenosyltransferase from bacillus cereus 0.9384 15 181
2zhy-assembly1.cif.gz_A crystal structure of a pduo-type atp:cobalamin adenosyltransferase from burkholderia thailandensis 0.9384 29 179
ID Description Score Start End Superfamily
2zhzB01 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.9496 16 181 1.20.1200.10
2zhzB01 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.944 16 181 1.20.1200.10
5cy5A00 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.9374 29 170 1.20.1200.10
2ah6A00 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.9353 29 181 1.20.1200.10
4nwpB00 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.9298 27 172 1.20.1200.10
ID Description Score Start End GO Terms
AF-A0A2H6AX01-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9873 88 187 GO:0005524
GO:0008817
GO:0009236
AF-A0A2H6AX01-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9777 88 187 GO:0005524
GO:0008817
GO:0009236
AF-A0A1F5HMK9-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9637 60 180 GO:0005524
GO:0008817
GO:0009236
AF-A0A4Q3XWD5-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9631 59 186 GO:0005524
GO:0008817
GO:0009236
AF-A0A7V9MBJ5-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9616 23 185 GO:0005524
GO:0008817
GO:0009236

Feature Viewer

pLDDT pTM Quality
91.82 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map