F408947
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 327 | 230 | 327 | 183 |
Family's Representative Sequence
| Representative Sequence | 3300047472|Ga0495686_0052344|Ga0495686_0052344_1470_2078 |
| Length | 202 |
| Sequence | LRSCCSPFPPGAEALVKLNKIYTRTGDDGTTGLVDGSRVPKSDPRMAAIGDVDEANSAIGVARTHFMDSAEFDAMLARIQNDLFDLGADLATPLAGDQTYALRVTPAQAEWLEHSIDRMNSGLAPLKSFVLPAGEAGAAALHLARAITRRAERSAVAAAATADIRAEVLTYLNRLSDFLFVAARAVNQNGAGDVLWVPGASR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 6 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 69 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 70 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 73 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 122 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 123 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 124 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 125 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 126 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 127 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 128 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 129 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 130 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 131 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 132 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 133 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 134 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 135 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 136 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 137 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 138 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 139 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 140 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 141 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 142 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 143 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 144 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 145 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 146 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 147 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 183 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 184 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 185 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 186 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 187 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 188 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 189 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 190 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 191 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 192 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 193 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 194 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 195 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 196 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 197 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 198 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 199 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 200 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 201 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 202 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 203 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 213 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 214 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 215 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 216 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 217 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 218 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 219 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 220 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 221 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 222 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 223 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 224 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 225 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 226 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 227 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 228 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 229 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 230 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.69 |
| Metatranscriptomes | 0.31 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.17 |
| Nodule | 0 |
| Rhizoplane | 3.67 |
| Rhizosphere | 81.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1002108 | 3300001915 | Bacteria | 5312 |
| 2 | JGI24740J21852_10000988 | 3300001979 | Bacteria | 12702 |
| 3 | JGI24740J21852_10063484 | 3300001979 | Bacteria | 1011 |
| 4 | JGI24737J22298_10002123 | 3300001990 | Bacteria | 7072 |
| 5 | JGI24735J21928_10051921 | 3300002067 | Bacteria | 1183 |
| 6 | JGI25153J46596_10000007 | 3300003215 | Bacteria | 377573 |
| 7 | Ga0055525_1000127 | 3300003759 | Bacteria | 113683 |
| 8 | Ga0070658_10000716 | 3300005327 | Bacteria | 28749 |
| 9 | Ga0070658_10013018 | 3300005327 | Bacteria | 6676 |
| 10 | Ga0070658_10049683 | 3300005327 | Bacteria | 3398 |
| 11 | Ga0070658_10358492 | 3300005327 | Bacteria | 1249 |
| 12 | Ga0070676_10214013 | 3300005328 | Bacteria | 1270 |
| 13 | Ga0070670_100001596 | 3300005331 | Bacteria | 18298 |
| 14 | Ga0070670_100506244 | 3300005331 | Bacteria | 1074 |
| 15 | Ga0070666_10000598 | 3300005335 | Bacteria | 21686 |
| 16 | Ga0070660_100000212 | 3300005339 | Bacteria | 39028 |
| 17 | Ga0070660_100386955 | 3300005339 | Bacteria | 1155 |
| 18 | Ga0070692_10034336 | 3300005345 | Bacteria | 2562 |
| 19 | Ga0070668_100014928 | 3300005347 | Bacteria | 5807 |
| 20 | Ga0070669_100000001 | 3300005353 | Bacteria | 537589 |
| 21 | Ga0070675_100140238 | 3300005354 | Bacteria | 2066 |
| 22 | Ga0070671_100000007 | 3300005355 | Bacteria | 250397 |
| 23 | Ga0070674_100000209 | 3300005356 | Bacteria | 28138 |
| 24 | Ga0070674_100531932 | 3300005356 | Bacteria | 983 |
| 25 | Ga0070673_100166900 | 3300005364 | Bacteria | 1876 |
| 26 | Ga0070673_100855925 | 3300005364 | Bacteria | 841 |
| 27 | Ga0070659_100094940 | 3300005366 | Bacteria | 2395 |
| 28 | Ga0070667_100042248 | 3300005367 | Bacteria | 3825 |
| 29 | Ga0070667_100297191 | 3300005367 | Bacteria | 1453 |
| 30 | Ga0070705_100122983 | 3300005440 | Bacteria | 1679 |
| 31 | Ga0070708_100002367 | 3300005445 | Bacteria | 14596 |
| 32 | Ga0070708_100004154 | 3300005445 | Bacteria | 11369 |
| 33 | Ga0070708_100008609 | 3300005445 | Bacteria | 8196 |
| 34 | Ga0070663_101046342 | 3300005455 | Bacteria | 711 |
| 35 | Ga0070678_100001063 | 3300005456 | Bacteria | 14344 |
| 36 | Ga0070678_101128401 | 3300005456 | Bacteria | 725 |
| 37 | Ga0070662_100056253 | 3300005457 | Bacteria | 2855 |
| 38 | Ga0070662_100070515 | 3300005457 | Bacteria | 2575 |
| 39 | Ga0068867_100416022 | 3300005459 | Bacteria | 1138 |
| 40 | Ga0070707_100046578 | 3300005468 | Bacteria | 4150 |
| 41 | Ga0070679_100136585 | 3300005530 | Bacteria | 2433 |
| 42 | Ga0070697_100140304 | 3300005536 | Bacteria | 2032 |
| 43 | Ga0068853_100000592 | 3300005539 | Bacteria | 24848 |
| 44 | Ga0070686_100198963 | 3300005544 | Bacteria | 1435 |
| 45 | Ga0070665_100000084 | 3300005548 | Bacteria | 180481 |
| 46 | Ga0070665_100031261 | 3300005548 | Bacteria | 5358 |
| 47 | Ga0068855_100000079 | 3300005563 | Bacteria | 117264 |
| 48 | Ga0070664_100371756 | 3300005564 | Bacteria | 1303 |
| 49 | Ga0068857_101202389 | 3300005577 | Bacteria | 734 |
| 50 | Ga0068856_100334840 | 3300005614 | Bacteria | 1531 |
| 51 | Ga0068859_100000294 | 3300005617 | Bacteria | 49703 |
| 52 | Ga0068864_100030177 | 3300005618 | Bacteria | 4595 |
| 53 | Ga0068861_100028256 | 3300005719 | Bacteria | 4092 |
| 54 | Ga0068863_100003969 | 3300005841 | Bacteria | 14610 |
| 55 | Ga0068858_100008774 | 3300005842 | Bacteria | 9697 |
| 56 | Ga0068860_100001225 | 3300005843 | Bacteria | 27956 |
| 57 | Ga0068862_100007071 | 3300005844 | Bacteria | 9319 |
| 58 | Ga0070717_10001790 | 3300006028 | Bacteria | 14984 |
| 59 | Ga0070712_100243259 | 3300006175 | Unclassified | 1434 |
| 60 | Ga0075370_10046602 | 3300006353 | Bacteria | 2453 |
| 61 | Ga0068871_100023276 | 3300006358 | Bacteria | 4789 |
| 62 | Ga0097620_100000294 | 3300006931 | Bacteria | 49703 |
| 63 | Ga0105240_10307329 | 3300009093 | Unclassified | 1812 |
| 64 | Ga0105247_10000569 | 3300009101 | Bacteria | 30032 |
| 65 | Ga0105243_10000388 | 3300009148 | Bacteria | 46841 |
| 66 | Ga0105243_11034699 | 3300009148 | Bacteria | 826 |
| 67 | Ga0105241_10012716 | 3300009174 | Bacteria | 6177 |
| 68 | Ga0105248_10036583 | 3300009177 | Bacteria | 5490 |
| 69 | Ga0105237_10186238 | 3300009545 | Unclassified | 2076 |
| 70 | Ga0105249_10005513 | 3300009553 | Bacteria | 10933 |
| 71 | Ga0105239_11501517 | 3300010375 | Bacteria | 779 |
| 72 | Ga0105239_12026062 | 3300010375 | Bacteria | 668 |
| 73 | Ga0105246_10061329 | 3300011119 | Bacteria | 2616 |
| 74 | Ga0157373_10104476 | 3300013100 | Bacteria | 1992 |
| 75 | Ga0157371_10000011 | 3300013102 | Bacteria | 377608 |
| 76 | Ga0157371_10000558 | 3300013102 | Bacteria | 44161 |
| 77 | Ga0157371_10011263 | 3300013102 | Bacteria | 6906 |
| 78 | Ga0157371_10041575 | 3300013102 | Bacteria | 3279 |
| 79 | Ga0157371_10501089 | 3300013102 | Bacteria | 897 |
| 80 | Ga0157370_10124451 | 3300013104 | Bacteria | 2407 |
| 81 | Ga0157374_10425578 | 3300013296 | Bacteria | 1327 |
| 82 | Ga0163162_10073777 | 3300013306 | Bacteria | 3469 |
| 83 | Ga0157372_10183971 | 3300013307 | Bacteria | 2419 |
| 84 | Ga0157372_10225065 | 3300013307 | Bacteria | 2175 |
| 85 | Ga0163163_10107295 | 3300014325 | Bacteria | 2819 |
| 86 | Ga0157379_10110725 | 3300014968 | Bacteria | 2466 |
| 87 | Ga0163161_10222128 | 3300017792 | Bacteria | 1463 |
| 88 | Ga0206353_11057062 | 3300020082 | Bacteria | 1105 |
| 89 | Ga0213872_10000350 | 3300021361 | Bacteria | 38938 |
| 90 | Ga0213872_10016886 | 3300021361 | Bacteria | 3382 |
| 91 | Ga0213872_10031888 | 3300021361 | Bacteria | 2415 |
| 92 | Ga0213872_10124734 | 3300021361 | Bacteria | 1137 |
| 93 | Ga0213875_10012825 | 3300021388 | Bacteria | 4129 |
| 94 | Ga0209674_105675 | 3300025226 | Bacteria | 1807 |
| 95 | Ga0209563_100125 | 3300025230 | Bacteria | 113854 |
| 96 | Ga0209026_1017896 | 3300025250 | Bacteria | 1126 |
| 97 | Ga0209677_109316 | 3300025253 | Bacteria | 1777 |
| 98 | Ga0209233_1008500 | 3300025261 | Bacteria | 3174 |
| 99 | Ga0209233_1026606 | 3300025261 | Bacteria | 1411 |
| 100 | Ga0209455_1022384 | 3300025272 | Bacteria | 1206 |
| 101 | Ga0209758_1000017 | 3300025297 | Bacteria | 754393 |
| 102 | Ga0207697_10008759 | 3300025315 | Bacteria | 4406 |
| 103 | Ga0207656_10063540 | 3300025321 | Bacteria | 1625 |
| 104 | Ga0207710_10011520 | 3300025900 | Bacteria | 3721 |
| 105 | Ga0207680_10000600 | 3300025903 | Bacteria | 16998 |
| 106 | Ga0207647_10010978 | 3300025904 | Bacteria | 6371 |
| 107 | Ga0207647_10124832 | 3300025904 | Bacteria | 1515 |
| 108 | Ga0207645_10068638 | 3300025907 | Bacteria | 2267 |
| 109 | Ga0207705_10000190 | 3300025909 | Bacteria | 62546 |
| 110 | Ga0207705_10001711 | 3300025909 | Bacteria | 17397 |
| 111 | Ga0207705_10186205 | 3300025909 | Bacteria | 1568 |
| 112 | Ga0207705_10229964 | 3300025909 | Bacteria | 1410 |
| 113 | Ga0207705_10360477 | 3300025909 | Bacteria | 1121 |
| 114 | Ga0207654_10000246 | 3300025911 | Bacteria | 32849 |
| 115 | Ga0207695_10033239 | 3300025913 | Bacteria | 5630 |
| 116 | Ga0207695_10549432 | 3300025913 | Bacteria | 1036 |
| 117 | Ga0207671_10042814 | 3300025914 | Bacteria | 3351 |
| 118 | Ga0207693_10272997 | 3300025915 | Unclassified | 1325 |
| 119 | Ga0207657_10000407 | 3300025919 | Bacteria | 45521 |
| 120 | Ga0207657_10002570 | 3300025919 | Bacteria | 19633 |
| 121 | Ga0207657_10176679 | 3300025919 | Bacteria | 1728 |
| 122 | Ga0207657_10196601 | 3300025919 | Bacteria | 1624 |
| 123 | Ga0207657_10414684 | 3300025919 | Bacteria | 1059 |
| 124 | Ga0207649_10001563 | 3300025920 | Bacteria | 13376 |
| 125 | Ga0207649_10069292 | 3300025920 | Bacteria | 2246 |
| 126 | Ga0207652_10089227 | 3300025921 | Bacteria | 2707 |
| 127 | Ga0207646_10032576 | 3300025922 | Bacteria | 4716 |
| 128 | Ga0207681_10000002 | 3300025923 | Bacteria | 985597 |
| 129 | Ga0207650_10027821 | 3300025925 | Bacteria | 4050 |
| 130 | Ga0207650_10488561 | 3300025925 | Bacteria | 1028 |
| 131 | Ga0207650_10559697 | 3300025925 | Bacteria | 959 |
| 132 | Ga0207659_10087314 | 3300025926 | Bacteria | 2321 |
| 133 | Ga0207644_10000002 | 3300025931 | Bacteria | 942221 |
| 134 | Ga0207690_10000630 | 3300025932 | Bacteria | 22732 |
| 135 | Ga0207706_10165691 | 3300025933 | Bacteria | 1942 |
| 136 | Ga0207706_10498952 | 3300025933 | Bacteria | 1051 |
| 137 | Ga0207709_10000116 | 3300025935 | Bacteria | 123061 |
| 138 | Ga0207669_10000022 | 3300025937 | Bacteria | 100002 |
| 139 | Ga0207669_10497792 | 3300025937 | Bacteria | 974 |
| 140 | Ga0207704_10087607 | 3300025938 | Bacteria | 2034 |
| 141 | Ga0207661_10256600 | 3300025944 | Bacteria | 1556 |
| 142 | Ga0207667_10000001 | 3300025949 | Bacteria | 1178522 |
| 143 | Ga0207667_10001479 | 3300025949 | Bacteria | 29480 |
| 144 | Ga0207667_10740089 | 3300025949 | Bacteria | 983 |
| 145 | Ga0207712_10146289 | 3300025961 | Bacteria | 1820 |
| 146 | Ga0207668_10000463 | 3300025972 | Bacteria | 25556 |
| 147 | Ga0207640_10007061 | 3300025981 | Bacteria | 6185 |
| 148 | Ga0207640_11089532 | 3300025981 | Bacteria | 706 |
| 149 | Ga0207658_10002991 | 3300025986 | Bacteria | 12086 |
| 150 | Ga0207658_10082667 | 3300025986 | Bacteria | 2467 |
| 151 | Ga0207703_10011124 | 3300026035 | Bacteria | 7006 |
| 152 | Ga0207639_10030774 | 3300026041 | Bacteria | 3938 |
| 153 | Ga0207678_10002526 | 3300026067 | Bacteria | 16670 |
| 154 | Ga0207702_10002653 | 3300026078 | Bacteria | 16796 |
| 155 | Ga0207641_10025978 | 3300026088 | Bacteria | 4831 |
| 156 | Ga0207648_10329461 | 3300026089 | Bacteria | 1373 |
| 157 | Ga0207676_10022592 | 3300026095 | Bacteria | 4627 |
| 158 | Ga0207674_10111943 | 3300026116 | Bacteria | 2704 |
| 159 | Ga0207674_10616462 | 3300026116 | Bacteria | 1048 |
| 160 | Ga0207675_100005694 | 3300026118 | Bacteria | 11925 |
| 161 | Ga0207683_10004363 | 3300026121 | Bacteria | 12218 |
| 162 | Ga0207683_10824441 | 3300026121 | Bacteria | 861 |
| 163 | Ga0207698_10157092 | 3300026142 | Bacteria | 1983 |
| 164 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 165 | Ga0268266_10079444 | 3300028379 | Bacteria | 2856 |
| 166 | Ga0268265_10000065 | 3300028380 | Bacteria | 142834 |
| 167 | Ga0268264_10000071 | 3300028381 | Bacteria | 267236 |
| 168 | Ga0307517_10008198 | 3300028786 | Bacteria | 15025 |
| 169 | Ga0265338_10013280 | 3300028800 | Bacteria | 9313 |
| 170 | Ga0307408_100152772 | 3300031548 | Bacteria | 1824 |
| 171 | Ga0307413_10033414 | 3300031824 | Bacteria | 2929 |
| 172 | Ga0307410_10022617 | 3300031852 | Bacteria | 3890 |
| 173 | Ga0307406_10109412 | 3300031901 | Bacteria | 1899 |
| 174 | Ga0307412_10580382 | 3300031911 | Bacteria | 946 |
| 175 | Ga0307409_102698386 | 3300031995 | Bacteria | 525 |
| 176 | Ga0307416_100243218 | 3300032002 | Bacteria | 1745 |
| 177 | Ga0307416_102187998 | 3300032002 | Bacteria | 654 |
| 178 | Ga0307414_10245960 | 3300032004 | Bacteria | 1484 |
| 179 | Ga0307414_10971222 | 3300032004 | Bacteria | 781 |
| 180 | Ga0307411_10096167 | 3300032005 | Bacteria | 2081 |
| 181 | Ga0307411_10119441 | 3300032005 | Bacteria | 1904 |
| 182 | Ga0307510_10041550 | 3300033180 | Bacteria | 5025 |
| 183 | Ga0316574_0394679 | 3300035398 | Bacteria | 872 |
| 184 | Ga0395899_0000737 | 3300037312 | Bacteria | 32666 |
| 185 | Ga0395899_0051334 | 3300037312 | Bacteria | 3061 |
| 186 | Ga0395899_0057000 | 3300037312 | Bacteria | 2886 |
| 187 | Ga0395899_0140269 | 3300037312 | Bacteria | 1720 |
| 188 | Ga0395899_0249948 | 3300037312 | Bacteria | 1217 |
| 189 | Ga0395900_0000364 | 3300037418 | Bacteria | 65068 |
| 190 | Ga0395900_0530217 | 3300037418 | Bacteria | 1124 |
| 191 | Ga0395898_0019963 | 3300037466 | Bacteria | 6814 |
| 192 | Ga0395905_0091731 | 3300037471 | Bacteria | 2848 |
| 193 | Ga0395905_0162552 | 3300037471 | Bacteria | 2098 |
| 194 | Ga0395905_0362221 | 3300037471 | Bacteria | 1343 |
| 195 | Ga0436364_1155132 | 3300037853 | Bacteria | 16641 |
| 196 | Ga0395901_0000209 | 3300038443 | Bacteria | 73635 |
| 197 | Ga0395901_0056589 | 3300038443 | Bacteria | 4080 |
| 198 | Ga0395901_0072640 | 3300038443 | Bacteria | 3587 |
| 199 | Ga0436360_0389708 | 3300039438 | Bacteria | 1608 |
| 200 | Ga0436361_0248698 | 3300039447 | Bacteria | 1358 |
| 201 | Ga0436361_0436707 | 3300039447 | Bacteria | 1113 |
| 202 | Ga0436361_0584244 | 3300039447 | Bacteria | 4384 |
| 203 | Ga0436361_0681369 | 3300039447 | Bacteria | 2475 |
| 204 | Ga0436361_0855224 | 3300039447 | Bacteria | 1066 |
| 205 | Ga0436361_0954566 | 3300039447 | Bacteria | 1477 |
| 206 | Ga0436361_1053164 | 3300039447 | Bacteria | 1479 |
| 207 | Ga0450918_055006 | 3300042531 | Bacteria | 729 |
| 208 | Ga0466966_0001152 | 3300044684 | Bacteria | 16994 |
| 209 | Ga0466957_0256105 | 3300044842 | Bacteria | 1165 |
| 210 | Ga0466959_0134539 | 3300045049 | Bacteria | 1751 |
| 211 | Ga0466967_0310372 | 3300045976 | Bacteria | 1519 |
| 212 | Ga0466967_1386644 | 3300045976 | Bacteria | 700 |
| 213 | Ga0495638_0020131 | 3300046460 | Bacteria | 4409 |
| 214 | Ga0495650_0000967 | 3300046471 | Bacteria | 32924 |
| 215 | Ga0495584_0142256 | 3300046491 | Bacteria | 1218 |
| 216 | Ga0495585_0074848 | 3300046492 | Bacteria | 1842 |
| 217 | Ga0495596_0002245 | 3300046500 | Bacteria | 10515 |
| 218 | Ga0495583_0001392 | 3300046506 | Bacteria | 24725 |
| 219 | Ga0495583_0022735 | 3300046506 | Bacteria | 3189 |
| 220 | Ga0495583_0026156 | 3300046506 | Bacteria | 2900 |
| 221 | Ga0495583_0049378 | 3300046506 | Bacteria | 1927 |
| 222 | Ga0495583_0066402 | 3300046506 | Bacteria | 1596 |
| 223 | Ga0495606_0000178 | 3300046507 | Bacteria | 112329 |
| 224 | Ga0495606_0117414 | 3300046507 | Bacteria | 1596 |
| 225 | Ga0495610_0089157 | 3300046512 | Bacteria | 1401 |
| 226 | Ga0495616_0028640 | 3300046513 | Bacteria | 2948 |
| 227 | Ga0495620_0177664 | 3300046515 | Bacteria | 824 |
| 228 | Ga0495631_0008546 | 3300046518 | Bacteria | 5155 |
| 229 | Ga0495631_0058191 | 3300046518 | Bacteria | 1681 |
| 230 | Ga0495637_0006333 | 3300046520 | Bacteria | 5947 |
| 231 | Ga0495643_0003953 | 3300046522 | Bacteria | 10606 |
| 232 | Ga0495643_0024114 | 3300046522 | Bacteria | 3453 |
| 233 | Ga0495643_0038389 | 3300046522 | Bacteria | 2623 |
| 234 | Ga0495643_0124480 | 3300046522 | Bacteria | 1299 |
| 235 | Ga0495648_0005491 | 3300046524 | Bacteria | 10521 |
| 236 | Ga0495663_0001685 | 3300046525 | Bacteria | 6891 |
| 237 | Ga0495663_0011324 | 3300046525 | Bacteria | 2483 |
| 238 | Ga0495663_0014108 | 3300046525 | Bacteria | 2238 |
| 239 | Ga0495642_0014556 | 3300046528 | Bacteria | 3048 |
| 240 | Ga0495654_0000620 | 3300046530 | Bacteria | 28271 |
| 241 | Ga0495645_0158777 | 3300046543 | Bacteria | 1565 |
| 242 | Ga0495622_0004613 | 3300046557 | Bacteria | 6382 |
| 243 | Ga0495633_0000308 | 3300046558 | Bacteria | 55659 |
| 244 | Ga0495633_0043661 | 3300046558 | Bacteria | 2126 |
| 245 | Ga0495633_0114846 | 3300046558 | Bacteria | 1248 |
| 246 | Ga0495668_0000013 | 3300046616 | Bacteria | 452938 |
| 247 | Ga0495668_0001088 | 3300046616 | Bacteria | 28328 |
| 248 | Ga0495668_0042487 | 3300046616 | Bacteria | 2531 |
| 249 | Ga0495668_0077130 | 3300046616 | Bacteria | 1830 |
| 250 | Ga0495611_0003563 | 3300046648 | Bacteria | 6844 |
| 251 | Ga0495611_0053247 | 3300046648 | Bacteria | 1826 |
| 252 | Ga0495625_0000397 | 3300046660 | Bacteria | 66539 |
| 253 | Ga0495625_0025884 | 3300046660 | Bacteria | 4440 |
| 254 | Ga0495625_0037553 | 3300046660 | Bacteria | 3553 |
| 255 | Ga0495625_0094483 | 3300046660 | Bacteria | 2063 |
| 256 | Ga0495625_0625318 | 3300046660 | Bacteria | 644 |
| 257 | Ga0495661_0076996 | 3300046665 | Bacteria | 1934 |
| 258 | Ga0495669_0000515 | 3300046684 | Bacteria | 17617 |
| 259 | Ga0495613_0567429 | 3300046689 | Bacteria | 758 |
| 260 | Ga0495649_0062557 | 3300046694 | Bacteria | 2000 |
| 261 | Ga0495600_0041539 | 3300046809 | Bacteria | 2997 |
| 262 | Ga0495660_0054496 | 3300046810 | Bacteria | 2166 |
| 263 | Ga0495683_0019558 | 3300047323 | Bacteria | 3494 |
| 264 | Ga0495683_0033113 | 3300047323 | Bacteria | 2631 |
| 265 | Ga0495687_000250 | 3300047443 | Bacteria | 72797 |
| 266 | Ga0495687_000614 | 3300047443 | Bacteria | 41339 |
| 267 | Ga0495677_0000498 | 3300047445 | Bacteria | 16705 |
| 268 | Ga0495681_0021885 | 3300047470 | Bacteria | 3434 |
| 269 | Ga0495686_0000262 | 3300047472 | Bacteria | 94462 |
| 270 | Ga0495686_0052344 | 3300047472 | Bacteria | 2560 |
| 271 | Ga0495615_0042916 | 3300048090 | Bacteria | 1136 |
| 272 | Ga0496101_0139913 | 3300048904 | Bacteria | 1844 |
| 273 | Ga0496102_0001391 | 3300048905 | Bacteria | 21494 |
| 274 | Ga0496102_0256561 | 3300048905 | Bacteria | 1648 |
| 275 | Ga0496103_0000055 | 3300048906 | Bacteria | 143870 |
| 276 | Ga0496104_0006008 | 3300048907 | Bacteria | 10644 |
| 277 | Ga0496105_0000358 | 3300048908 | Bacteria | 30167 |
| 278 | Ga0496110_0032833 | 3300048913 | Bacteria | 4487 |
| 279 | Ga0496111_0014255 | 3300048914 | Bacteria | 5425 |
| 280 | Ga0496112_1726718 | 3300048915 | Bacteria | 538 |
| 281 | Ga0496113_0046399 | 3300048916 | Bacteria | 3225 |
| 282 | Ga0496114_0005872 | 3300048917 | Bacteria | 9647 |
| 283 | Ga0496115_0000267 | 3300048918 | Bacteria | 46248 |
| 284 | Ga0496117_0000549 | 3300048920 | Bacteria | 61657 |
| 285 | Ga0496118_0000552 | 3300048921 | Bacteria | 61677 |
| 286 | Ga0496119_0003632 | 3300048922 | Bacteria | 15861 |
| 287 | Ga0496120_0049069 | 3300048923 | Bacteria | 2425 |
| 288 | Ga0496121_0001191 | 3300048924 | Bacteria | 45526 |
| 289 | Ga0496122_0014451 | 3300048925 | Bacteria | 7632 |
| 290 | Ga0496123_0047464 | 3300048926 | Bacteria | 2901 |
| 291 | Ga0496124_0000585 | 3300048927 | Bacteria | 61469 |
| 292 | Ga0496125_0001142 | 3300048928 | Bacteria | 40357 |
| 293 | Ga0496125_0456703 | 3300048928 | Bacteria | 730 |
| 294 | Ga0496126_0001094 | 3300048929 | Bacteria | 45520 |
| 295 | Ga0496126_0396029 | 3300048929 | Bacteria | 1121 |
| 296 | Ga0501033_0015378 | 3300049570 | Bacteria | 5805 |
| 297 | Ga0501034_0433196 | 3300049571 | Bacteria | 1234 |
| 298 | Ga0501034_0830551 | 3300049571 | Bacteria | 815 |
| 299 | Ga0501036_0512644 | 3300049572 | Bacteria | 998 |
| 300 | Ga0501038_0041942 | 3300049574 | Bacteria | 3988 |
| 301 | Ga0501039_0546065 | 3300049575 | Bacteria | 909 |
| 302 | Ga0501047_0193555 | 3300049581 | Bacteria | 1896 |
| 303 | Ga0501035_0015500 | 3300049822 | Bacteria | 7031 |
| 304 | Ga0501035_0212585 | 3300049822 | Bacteria | 1654 |
| 305 | Ga0501044_0013532 | 3300049823 | Bacteria | 8820 |
| 306 | Ga0501044_1003605 | 3300049823 | Bacteria | 706 |
| 307 | Ga0501045_0741240 | 3300049824 | Bacteria | 724 |
| 308 | nmdc:mga0k408_15621_c1 | 3300050493 | Bacteria | 4200 |
| 309 | Ga0500610_0000092 | 3300053079 | Bacteria | 27411 |
| 310 | Ga0500643_001723 | 3300053087 | Bacteria | 12139 |
| 311 | Ga0500641_0047984 | 3300053096 | Bacteria | 1748 |
| 312 | Ga0500562_030409 | 3300053108 | Bacteria | 1423 |
| 313 | Ga0500592_001951 | 3300053116 | Bacteria | 3316 |
| 314 | Ga0500595_002254 | 3300053119 | Bacteria | 9758 |
| 315 | Ga0500597_271185 | 3300053120 | Bacteria | 687 |
| 316 | Ga0500607_102173 | 3300053121 | Bacteria | 1422 |
| 317 | Ga0500642_0001228 | 3300053130 | Bacteria | 7335 |
| 318 | Ga0500568_0074205 | 3300053139 | Bacteria | 1298 |
| 319 | Ga0500573_0048717 | 3300053140 | Bacteria | 2439 |
| 320 | Ga0500604_0013997 | 3300053151 | Bacteria | 2180 |
| 321 | Ga0500604_0100946 | 3300053151 | Bacteria | 951 |
| 322 | Ga0500619_003506 | 3300053154 | Bacteria | 3227 |
| 323 | Ga0500624_000085 | 3300053157 | Bacteria | 47798 |
| 324 | Ga0500627_0000110 | 3300053158 | Bacteria | 26911 |
| 325 | Ga0500636_0007580 | 3300053177 | Bacteria | 6276 |
| 326 | Ga0500637_0000023 | 3300053178 | Bacteria | 61044 |
| 327 | Ga0500645_000024 | 3300053730 | Bacteria | 126024 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025315 | Ga0207697_10008759 | Ga0207697_100087595 | 149 |
| 2 | 3300005331 | Ga0070670_100506244 | Ga0070670_1005062442 | 154 |
| 3 | 3300025925 | Ga0207650_10488561 | Ga0207650_104885612 | 154 |
| 4 | 3300037312 | Ga0395899_0057000 | Ga0395899_0057000_18_482 | 154 |
| 5 | 3300048915 | Ga0496112_1726718 | Ga0496112_1726718_31_495 | 154 |
| 6 | 3300031995 | Ga0307409_102698386 | Ga0307409_1026983861 | 155 |
| 7 | 3300037312 | Ga0395899_0249948 | Ga0395899_0249948_728_1195 | 155 |
| 8 | 3300042531 | Ga0450918_055006 | Ga0450918_055006_27_494 | 155 |
| 9 | 3300045976 | Ga0466967_1386644 | Ga0466967_1386644_199_669 | 155 |
| 10 | 3300046660 | Ga0495625_0000397 | Ga0495625_0000397_48469_48981 | 162 |
| 11 | 3300053151 | Ga0500604_0100946 | Ga0500604_0100946_308_811 | 162 |
| 12 | 3300046525 | Ga0495663_0014108 | Ga0495663_0014108_472_1047 | 164 |
| 13 | 3300053116 | Ga0500592_001951 | Ga0500592_001951_1191_1766 | 164 |
| 14 | 3300053139 | Ga0500568_0074205 | Ga0500568_0074205_261_866 | 164 |
| 15 | 3300005331 | Ga0070670_100001596 | Ga0070670_10000159612 | 165 |
| 16 | 3300005335 | Ga0070666_10000598 | Ga0070666_100005984 | 165 |
| 17 | 3300005347 | Ga0070668_100014928 | Ga0070668_1000149286 | 165 |
| 18 | 3300005353 | Ga0070669_100000001 | Ga0070669_100000001105 | 165 |
| 19 | 3300005355 | Ga0070671_100000007 | Ga0070671_100000007162 | 165 |
| 20 | 3300005367 | Ga0070667_100042248 | Ga0070667_1000422484 | 165 |
| 21 | 3300005440 | Ga0070705_100122983 | Ga0070705_1001229832 | 165 |
| 22 | 3300005544 | Ga0070686_100198963 | Ga0070686_1001989632 | 165 |
| 23 | 3300005548 | Ga0070665_100031261 | Ga0070665_1000312614 | 165 |
| 24 | 3300005617 | Ga0068859_100000294 | Ga0068859_10000029416 | 165 |
| 25 | 3300005618 | Ga0068864_100030177 | Ga0068864_1000301774 | 165 |
| 26 | 3300005719 | Ga0068861_100028256 | Ga0068861_1000282565 | 165 |
| 27 | 3300005841 | Ga0068863_100003969 | Ga0068863_1000039696 | 165 |
| 28 | 3300005842 | Ga0068858_100008774 | Ga0068858_1000087743 | 165 |
| 29 | 3300005843 | Ga0068860_100001225 | Ga0068860_10000122512 | 165 |
| 30 | 3300005844 | Ga0068862_100007071 | Ga0068862_1000070712 | 165 |
| 31 | 3300006931 | Ga0097620_100000294 | Ga0097620_10000029416 | 165 |
| 32 | 3300009101 | Ga0105247_10000569 | Ga0105247_1000056916 | 165 |
| 33 | 3300009177 | Ga0105248_10036583 | Ga0105248_100365831 | 165 |
| 34 | 3300009553 | Ga0105249_10005513 | Ga0105249_100055137 | 165 |
| 35 | 3300013306 | Ga0163162_10073777 | Ga0163162_100737773 | 165 |
| 36 | 3300014325 | Ga0163163_10107295 | Ga0163163_101072951 | 165 |
| 37 | 3300014968 | Ga0157379_10110725 | Ga0157379_101107252 | 165 |
| 38 | 3300025900 | Ga0207710_10011520 | Ga0207710_100115203 | 165 |
| 39 | 3300025903 | Ga0207680_10000600 | Ga0207680_100006002 | 165 |
| 40 | 3300025923 | Ga0207681_10000002 | Ga0207681_10000002898 | 165 |
| 41 | 3300025925 | Ga0207650_10027821 | Ga0207650_100278214 | 165 |
| 42 | 3300025931 | Ga0207644_10000002 | Ga0207644_10000002838 | 165 |
| 43 | 3300025961 | Ga0207712_10146289 | Ga0207712_101462893 | 165 |
| 44 | 3300025972 | Ga0207668_10000463 | Ga0207668_1000046321 | 165 |
| 45 | 3300025986 | Ga0207658_10002991 | Ga0207658_1000299110 | 165 |
| 46 | 3300026035 | Ga0207703_10011124 | Ga0207703_100111246 | 165 |
| 47 | 3300026088 | Ga0207641_10025978 | Ga0207641_100259786 | 165 |
| 48 | 3300026095 | Ga0207676_10022592 | Ga0207676_100225923 | 165 |
| 49 | 3300026118 | Ga0207675_100005694 | Ga0207675_1000056943 | 165 |
| 50 | 3300028379 | Ga0268266_10079444 | Ga0268266_100794442 | 165 |
| 51 | 3300028380 | Ga0268265_10000065 | Ga0268265_10000065138 | 165 |
| 52 | 3300028381 | Ga0268264_10000071 | Ga0268264_1000007184 | 165 |
| 53 | 3300053087 | Ga0500643_001723 | Ga0500643_001723_10833_11351 | 167 |
| 54 | 3300031548 | Ga0307408_100152772 | Ga0307408_1001527723 | 168 |
| 55 | 3300031824 | Ga0307413_10033414 | Ga0307413_100334143 | 168 |
| 56 | 3300031901 | Ga0307406_10109412 | Ga0307406_101094122 | 168 |
| 57 | 3300031911 | Ga0307412_10580382 | Ga0307412_105803822 | 168 |
| 58 | 3300032002 | Ga0307416_100243218 | Ga0307416_1002432183 | 168 |
| 59 | 3300032005 | Ga0307411_10119441 | Ga0307411_101194412 | 168 |
| 60 | 3300005445 | Ga0070708_100004154 | Ga0070708_1000041547 | 170 |
| 61 | 3300005445 | Ga0070708_100008609 | Ga0070708_1000086094 | 170 |
| 62 | 3300005468 | Ga0070707_100046578 | Ga0070707_1000465782 | 170 |
| 63 | 3300005536 | Ga0070697_100140304 | Ga0070697_1001403041 | 170 |
| 64 | 3300025922 | Ga0207646_10032576 | Ga0207646_100325766 | 170 |
| 65 | 3300005445 | Ga0070708_100002367 | Ga0070708_10000236712 | 176 |
| 66 | 3300006028 | Ga0070717_10001790 | Ga0070717_1000179013 | 176 |
| 67 | 3300006175 | Ga0070712_100243259 | Ga0070712_1002432592 | 176 |
| 68 | 3300009093 | Ga0105240_10307329 | Ga0105240_103073292 | 176 |
| 69 | 3300009545 | Ga0105237_10186238 | Ga0105237_101862382 | 176 |
| 70 | 3300013307 | Ga0157372_10225065 | Ga0157372_102250652 | 176 |
| 71 | 3300025913 | Ga0207695_10549432 | Ga0207695_105494322 | 176 |
| 72 | 3300025915 | Ga0207693_10272997 | Ga0207693_102729972 | 176 |
| 73 | 3300046460 | Ga0495638_0020131 | Ga0495638_0020131_2756_3325 | 176 |
| 74 | 3300045049 | Ga0466959_0134539 | Ga0466959_0134539_873_1433 | 177 |
| 75 | 3300048929 | Ga0496126_0396029 | Ga0496126_0396029_374_955 | 177 |
| 76 | 3300013102 | Ga0157371_10000011 | Ga0157371_1000001168 | 178 |
| 77 | 3300035398 | Ga0316574_0394679 | Ga0316574_0394679_140_709 | 179 |
| 78 | 3300053108 | Ga0500562_030409 | Ga0500562_030409_371_925 | 180 |
| 79 | 3300006353 | Ga0075370_10046602 | Ga0075370_100466022 | 181 |
| 80 | 3300046491 | Ga0495584_0142256 | Ga0495584_0142256_623_1189 | 181 |
| 81 | 3300046512 | Ga0495610_0089157 | Ga0495610_0089157_679_1245 | 181 |
| 82 | 3300046522 | Ga0495643_0038389 | Ga0495643_0038389_1968_2534 | 181 |
| 83 | 3300046528 | Ga0495642_0014556 | Ga0495642_0014556_1782_2348 | 181 |
| 84 | 3300047445 | Ga0495677_0000498 | Ga0495677_0000498_5915_6481 | 181 |
| 85 | 3300053140 | Ga0500573_0048717 | Ga0500573_0048717_655_1218 | 183 |
| 86 | 3300047472 | Ga0495686_0000262 | Ga0495686_0000262_8360_8914 | 184 |
| 87 | 3300047472 | Ga0495686_0052344 | Ga0495686_0052344_1470_2078 | 184 |
| 88 | 3300053096 | Ga0500641_0047984 | Ga0500641_0047984_337_903 | 184 |
| 89 | 3300053120 | Ga0500597_271185 | Ga0500597_271185_107_673 | 184 |
| 90 | 3300053157 | Ga0500624_000085 | Ga0500624_000085_25585_26151 | 184 |
| 91 | 3300053178 | Ga0500637_0000023 | Ga0500637_0000023_20158_20724 | 184 |
| 92 | 3300003215 | JGI25153J46596_10000007 | JGI25153J46596_10000007325 | 185 |
| 93 | 3300003759 | Ga0055525_1000127 | Ga0055525_100012761 | 185 |
| 94 | 3300005327 | Ga0070658_10000716 | Ga0070658_1000071612 | 185 |
| 95 | 3300005327 | Ga0070658_10013018 | Ga0070658_100130186 | 185 |
| 96 | 3300005328 | Ga0070676_10214013 | Ga0070676_102140132 | 185 |
| 97 | 3300005339 | Ga0070660_100000212 | Ga0070660_10000021229 | 185 |
| 98 | 3300005339 | Ga0070660_100386955 | Ga0070660_1003869553 | 185 |
| 99 | 3300005345 | Ga0070692_10034336 | Ga0070692_100343362 | 185 |
| 100 | 3300005354 | Ga0070675_100140238 | Ga0070675_1001402382 | 185 |
| 101 | 3300005356 | Ga0070674_100000209 | Ga0070674_1000002093 | 185 |
| 102 | 3300005356 | Ga0070674_100531932 | Ga0070674_1005319322 | 185 |
| 103 | 3300005364 | Ga0070673_100166900 | Ga0070673_1001669003 | 185 |
| 104 | 3300005364 | Ga0070673_100855925 | Ga0070673_1008559251 | 185 |
| 105 | 3300005367 | Ga0070667_100297191 | Ga0070667_1002971912 | 185 |
| 106 | 3300005456 | Ga0070678_100001063 | Ga0070678_10000106316 | 185 |
| 107 | 3300005456 | Ga0070678_101128401 | Ga0070678_1011284011 | 185 |
| 108 | 3300005457 | Ga0070662_100056253 | Ga0070662_1000562533 | 185 |
| 109 | 3300005457 | Ga0070662_100070515 | Ga0070662_1000705151 | 185 |
| 110 | 3300005459 | Ga0068867_100416022 | Ga0068867_1004160222 | 185 |
| 111 | 3300005530 | Ga0070679_100136585 | Ga0070679_1001365853 | 185 |
| 112 | 3300005539 | Ga0068853_100000592 | Ga0068853_10000059217 | 185 |
| 113 | 3300005548 | Ga0070665_100000084 | Ga0070665_10000008490 | 185 |
| 114 | 3300005563 | Ga0068855_100000079 | Ga0068855_10000007993 | 185 |
| 115 | 3300005577 | Ga0068857_101202389 | Ga0068857_1012023891 | 185 |
| 116 | 3300006358 | Ga0068871_100023276 | Ga0068871_1000232766 | 185 |
| 117 | 3300009148 | Ga0105243_10000388 | Ga0105243_1000038840 | 185 |
| 118 | 3300009148 | Ga0105243_11034699 | Ga0105243_110346991 | 185 |
| 119 | 3300011119 | Ga0105246_10061329 | Ga0105246_100613292 | 185 |
| 120 | 3300013100 | Ga0157373_10104476 | Ga0157373_101044763 | 185 |
| 121 | 3300013102 | Ga0157371_10000558 | Ga0157371_1000055830 | 185 |
| 122 | 3300013102 | Ga0157371_10011263 | Ga0157371_100112634 | 185 |
| 123 | 3300013102 | Ga0157371_10041575 | Ga0157371_100415754 | 185 |
| 124 | 3300013104 | Ga0157370_10124451 | Ga0157370_101244513 | 185 |
| 125 | 3300013296 | Ga0157374_10425578 | Ga0157374_104255782 | 185 |
| 126 | 3300017792 | Ga0163161_10222128 | Ga0163161_102221282 | 185 |
| 127 | 3300025226 | Ga0209674_105675 | Ga0209674_1056752 | 185 |
| 128 | 3300025230 | Ga0209563_100125 | Ga0209563_10012554 | 185 |
| 129 | 3300025250 | Ga0209026_1017896 | Ga0209026_10178962 | 185 |
| 130 | 3300025253 | Ga0209677_109316 | Ga0209677_1093162 | 185 |
| 131 | 3300025261 | Ga0209233_1008500 | Ga0209233_10085002 | 185 |
| 132 | 3300025272 | Ga0209455_1022384 | Ga0209455_10223842 | 185 |
| 133 | 3300025297 | Ga0209758_1000017 | Ga0209758_1000017321 | 185 |
| 134 | 3300025904 | Ga0207647_10010978 | Ga0207647_100109783 | 185 |
| 135 | 3300025907 | Ga0207645_10068638 | Ga0207645_100686382 | 185 |
| 136 | 3300025909 | Ga0207705_10000190 | Ga0207705_1000019045 | 185 |
| 137 | 3300025909 | Ga0207705_10186205 | Ga0207705_101862052 | 185 |
| 138 | 3300025909 | Ga0207705_10229964 | Ga0207705_102299643 | 185 |
| 139 | 3300025919 | Ga0207657_10000407 | Ga0207657_1000040731 | 185 |
| 140 | 3300025919 | Ga0207657_10002570 | Ga0207657_1000257014 | 185 |
| 141 | 3300025919 | Ga0207657_10176679 | Ga0207657_101766792 | 185 |
| 142 | 3300025919 | Ga0207657_10414684 | Ga0207657_104146842 | 185 |
| 143 | 3300025920 | Ga0207649_10069292 | Ga0207649_100692922 | 185 |
| 144 | 3300025921 | Ga0207652_10089227 | Ga0207652_100892273 | 185 |
| 145 | 3300025925 | Ga0207650_10559697 | Ga0207650_105596972 | 185 |
| 146 | 3300025926 | Ga0207659_10087314 | Ga0207659_100873142 | 185 |
| 147 | 3300025933 | Ga0207706_10165691 | Ga0207706_101656913 | 185 |
| 148 | 3300025933 | Ga0207706_10498952 | Ga0207706_104989521 | 185 |
| 149 | 3300025935 | Ga0207709_10000116 | Ga0207709_1000011650 | 185 |
| 150 | 3300025937 | Ga0207669_10000022 | Ga0207669_1000002232 | 185 |
| 151 | 3300025937 | Ga0207669_10497792 | Ga0207669_104977922 | 185 |
| 152 | 3300025938 | Ga0207704_10087607 | Ga0207704_100876073 | 185 |
| 153 | 3300025949 | Ga0207667_10001479 | Ga0207667_1000147931 | 185 |
| 154 | 3300025986 | Ga0207658_10082667 | Ga0207658_100826672 | 185 |
| 155 | 3300026089 | Ga0207648_10329461 | Ga0207648_103294612 | 185 |
| 156 | 3300026116 | Ga0207674_10616462 | Ga0207674_106164622 | 185 |
| 157 | 3300026121 | Ga0207683_10004363 | Ga0207683_1000436311 | 185 |
| 158 | 3300026121 | Ga0207683_10824441 | Ga0207683_108244412 | 185 |
| 159 | 3300028379 | Ga0268266_10000002 | Ga0268266_10000002816 | 185 |
| 160 | 3300028786 | Ga0307517_10008198 | Ga0307517_100081988 | 185 |
| 161 | 3300033180 | Ga0307510_10041550 | Ga0307510_100415502 | 185 |
| 162 | 3300037312 | Ga0395899_0000737 | Ga0395899_0000737_19635_20192 | 185 |
| 163 | 3300037312 | Ga0395899_0140269 | Ga0395899_0140269_1052_1609 | 185 |
| 164 | 3300037418 | Ga0395900_0000364 | Ga0395900_0000364_11109_11666 | 185 |
| 165 | 3300037466 | Ga0395898_0019963 | Ga0395898_0019963_2443_3000 | 185 |
| 166 | 3300037471 | Ga0395905_0091731 | Ga0395905_0091731_1743_2300 | 185 |
| 167 | 3300038443 | Ga0395901_0000209 | Ga0395901_0000209_53403_53960 | 185 |
| 168 | 3300044684 | Ga0466966_0001152 | Ga0466966_0001152_2932_3489 | 185 |
| 169 | 3300046471 | Ga0495650_0000967 | Ga0495650_0000967_29010_29570 | 185 |
| 170 | 3300046492 | Ga0495585_0074848 | Ga0495585_0074848_1006_1563 | 185 |
| 171 | 3300046500 | Ga0495596_0002245 | Ga0495596_0002245_1359_1916 | 185 |
| 172 | 3300046506 | Ga0495583_0001392 | Ga0495583_0001392_2793_3353 | 185 |
| 173 | 3300046506 | Ga0495583_0022735 | Ga0495583_0022735_2259_2816 | 185 |
| 174 | 3300046506 | Ga0495583_0026156 | Ga0495583_0026156_859_1416 | 185 |
| 175 | 3300046506 | Ga0495583_0049378 | Ga0495583_0049378_63_620 | 185 |
| 176 | 3300046506 | Ga0495583_0066402 | Ga0495583_0066402_836_1393 | 185 |
| 177 | 3300046507 | Ga0495606_0000178 | Ga0495606_0000178_72448_73005 | 185 |
| 178 | 3300046507 | Ga0495606_0117414 | Ga0495606_0117414_953_1513 | 185 |
| 179 | 3300046513 | Ga0495616_0028640 | Ga0495616_0028640_20_577 | 185 |
| 180 | 3300046515 | Ga0495620_0177664 | Ga0495620_0177664_81_638 | 185 |
| 181 | 3300046518 | Ga0495631_0008546 | Ga0495631_0008546_3578_4135 | 185 |
| 182 | 3300046518 | Ga0495631_0058191 | Ga0495631_0058191_146_703 | 185 |
| 183 | 3300046520 | Ga0495637_0006333 | Ga0495637_0006333_1865_2422 | 185 |
| 184 | 3300046522 | Ga0495643_0003953 | Ga0495643_0003953_8084_8641 | 185 |
| 185 | 3300046522 | Ga0495643_0024114 | Ga0495643_0024114_1671_2228 | 185 |
| 186 | 3300046522 | Ga0495643_0124480 | Ga0495643_0124480_90_647 | 185 |
| 187 | 3300046524 | Ga0495648_0005491 | Ga0495648_0005491_3956_4513 | 185 |
| 188 | 3300046525 | Ga0495663_0001685 | Ga0495663_0001685_6037_6594 | 185 |
| 189 | 3300046557 | Ga0495622_0004613 | Ga0495622_0004613_771_1331 | 185 |
| 190 | 3300046558 | Ga0495633_0000308 | Ga0495633_0000308_26412_26969 | 185 |
| 191 | 3300046558 | Ga0495633_0043661 | Ga0495633_0043661_375_935 | 185 |
| 192 | 3300046558 | Ga0495633_0114846 | Ga0495633_0114846_197_766 | 185 |
| 193 | 3300046616 | Ga0495668_0000013 | Ga0495668_0000013_249352_249909 | 185 |
| 194 | 3300046616 | Ga0495668_0042487 | Ga0495668_0042487_471_1031 | 185 |
| 195 | 3300046616 | Ga0495668_0077130 | Ga0495668_0077130_512_1069 | 185 |
| 196 | 3300046648 | Ga0495611_0003563 | Ga0495611_0003563_1678_2235 | 185 |
| 197 | 3300046648 | Ga0495611_0053247 | Ga0495611_0053247_92_649 | 185 |
| 198 | 3300046660 | Ga0495625_0025884 | Ga0495625_0025884_2538_3095 | 185 |
| 199 | 3300046660 | Ga0495625_0037553 | Ga0495625_0037553_2015_2572 | 185 |
| 200 | 3300046660 | Ga0495625_0094483 | Ga0495625_0094483_408_965 | 185 |
| 201 | 3300046660 | Ga0495625_0625318 | Ga0495625_0625318_27_587 | 185 |
| 202 | 3300046665 | Ga0495661_0076996 | Ga0495661_0076996_1025_1585 | 185 |
| 203 | 3300046684 | Ga0495669_0000515 | Ga0495669_0000515_9037_9594 | 185 |
| 204 | 3300046689 | Ga0495613_0567429 | Ga0495613_0567429_93_653 | 185 |
| 205 | 3300046694 | Ga0495649_0062557 | Ga0495649_0062557_193_750 | 185 |
| 206 | 3300046809 | Ga0495600_0041539 | Ga0495600_0041539_1942_2502 | 185 |
| 207 | 3300046810 | Ga0495660_0054496 | Ga0495660_0054496_1594_2151 | 185 |
| 208 | 3300047323 | Ga0495683_0019558 | Ga0495683_0019558_2617_3174 | 185 |
| 209 | 3300047323 | Ga0495683_0033113 | Ga0495683_0033113_458_1015 | 185 |
| 210 | 3300047443 | Ga0495687_000250 | Ga0495687_000250_35421_35978 | 185 |
| 211 | 3300047443 | Ga0495687_000614 | Ga0495687_000614_6565_7122 | 185 |
| 212 | 3300047470 | Ga0495681_0021885 | Ga0495681_0021885_907_1464 | 185 |
| 213 | 3300048090 | Ga0495615_0042916 | Ga0495615_0042916_215_772 | 185 |
| 214 | 3300048904 | Ga0496101_0139913 | Ga0496101_0139913_983_1540 | 185 |
| 215 | 3300048905 | Ga0496102_0001391 | Ga0496102_0001391_14675_15232 | 185 |
| 216 | 3300048906 | Ga0496103_0000055 | Ga0496103_0000055_121511_122068 | 185 |
| 217 | 3300048907 | Ga0496104_0006008 | Ga0496104_0006008_4434_4991 | 185 |
| 218 | 3300048908 | Ga0496105_0000358 | Ga0496105_0000358_23960_24517 | 185 |
| 219 | 3300048913 | Ga0496110_0032833 | Ga0496110_0032833_1169_1726 | 185 |
| 220 | 3300048914 | Ga0496111_0014255 | Ga0496111_0014255_2619_3176 | 185 |
| 221 | 3300048916 | Ga0496113_0046399 | Ga0496113_0046399_1814_2371 | 185 |
| 222 | 3300048917 | Ga0496114_0005872 | Ga0496114_0005872_7108_7665 | 185 |
| 223 | 3300048918 | Ga0496115_0000267 | Ga0496115_0000267_39321_39878 | 185 |
| 224 | 3300048920 | Ga0496117_0000549 | Ga0496117_0000549_21975_22532 | 185 |
| 225 | 3300048921 | Ga0496118_0000552 | Ga0496118_0000552_21857_22414 | 185 |
| 226 | 3300048922 | Ga0496119_0003632 | Ga0496119_0003632_5679_6236 | 185 |
| 227 | 3300048923 | Ga0496120_0049069 | Ga0496120_0049069_31_588 | 185 |
| 228 | 3300048924 | Ga0496121_0001191 | Ga0496121_0001191_5651_6208 | 185 |
| 229 | 3300048925 | Ga0496122_0014451 | Ga0496122_0014451_5682_6239 | 185 |
| 230 | 3300048926 | Ga0496123_0047464 | Ga0496123_0047464_2068_2625 | 185 |
| 231 | 3300048927 | Ga0496124_0000585 | Ga0496124_0000585_21728_22285 | 185 |
| 232 | 3300048928 | Ga0496125_0001142 | Ga0496125_0001142_33634_34191 | 185 |
| 233 | 3300048928 | Ga0496125_0456703 | Ga0496125_0456703_12_581 | 185 |
| 234 | 3300048929 | Ga0496126_0001094 | Ga0496126_0001094_5659_6216 | 185 |
| 235 | 3300050493 | nmdc:mga0k408_15621_c1 | nmdc:mga0k408_15621_c1_2650_3207 | 185 |
| 236 | 3300053079 | Ga0500610_0000092 | Ga0500610_0000092_4817_5374 | 185 |
| 237 | 3300053119 | Ga0500595_002254 | Ga0500595_002254_3018_3578 | 185 |
| 238 | 3300053121 | Ga0500607_102173 | Ga0500607_102173_71_631 | 185 |
| 239 | 3300053130 | Ga0500642_0001228 | Ga0500642_0001228_474_1031 | 185 |
| 240 | 3300053154 | Ga0500619_003506 | Ga0500619_003506_430_990 | 185 |
| 241 | 3300053177 | Ga0500636_0007580 | Ga0500636_0007580_2744_3301 | 185 |
| 242 | 3300053730 | Ga0500645_000024 | Ga0500645_000024_37101_37658 | 185 |
| 243 | 3300001979 | JGI24740J21852_10063484 | JGI24740J21852_100634842 | 186 |
| 244 | 3300005327 | Ga0070658_10358492 | Ga0070658_103584922 | 186 |
| 245 | 3300013102 | Ga0157371_10501089 | Ga0157371_105010891 | 186 |
| 246 | 3300020082 | Ga0206353_11057062 | Ga0206353_110570622 | 186 |
| 247 | 3300021361 | Ga0213872_10000350 | Ga0213872_1000035015 | 186 |
| 248 | 3300021361 | Ga0213872_10016886 | Ga0213872_100168862 | 186 |
| 249 | 3300021361 | Ga0213872_10031888 | Ga0213872_100318882 | 186 |
| 250 | 3300021361 | Ga0213872_10124734 | Ga0213872_101247342 | 186 |
| 251 | 3300021388 | Ga0213875_10012825 | Ga0213875_100128255 | 186 |
| 252 | 3300025261 | Ga0209233_1026606 | Ga0209233_10266062 | 186 |
| 253 | 3300025909 | Ga0207705_10360477 | Ga0207705_103604772 | 186 |
| 254 | 3300031852 | Ga0307410_10022617 | Ga0307410_100226173 | 186 |
| 255 | 3300032002 | Ga0307416_102187998 | Ga0307416_1021879981 | 186 |
| 256 | 3300032004 | Ga0307414_10245960 | Ga0307414_102459602 | 186 |
| 257 | 3300032004 | Ga0307414_10971222 | Ga0307414_109712222 | 186 |
| 258 | 3300032005 | Ga0307411_10096167 | Ga0307411_100961672 | 186 |
| 259 | 3300037312 | Ga0395899_0051334 | Ga0395899_0051334_343_906 | 186 |
| 260 | 3300037418 | Ga0395900_0530217 | Ga0395900_0530217_543_1106 | 186 |
| 261 | 3300037471 | Ga0395905_0162552 | Ga0395905_0162552_673_1236 | 186 |
| 262 | 3300037471 | Ga0395905_0362221 | Ga0395905_0362221_423_983 | 186 |
| 263 | 3300037853 | Ga0436364_1155132 | Ga0436364_1155132_950_1510 | 186 |
| 264 | 3300038443 | Ga0395901_0056589 | Ga0395901_0056589_1524_2087 | 186 |
| 265 | 3300038443 | Ga0395901_0072640 | Ga0395901_0072640_1376_1939 | 186 |
| 266 | 3300039438 | Ga0436360_0389708 | Ga0436360_0389708_276_845 | 186 |
| 267 | 3300039447 | Ga0436361_0248698 | Ga0436361_0248698_60_629 | 186 |
| 268 | 3300039447 | Ga0436361_0436707 | Ga0436361_0436707_236_805 | 186 |
| 269 | 3300039447 | Ga0436361_0584244 | Ga0436361_0584244_3607_4176 | 186 |
| 270 | 3300039447 | Ga0436361_0681369 | Ga0436361_0681369_405_974 | 186 |
| 271 | 3300039447 | Ga0436361_0855224 | Ga0436361_0855224_113_682 | 186 |
| 272 | 3300039447 | Ga0436361_0954566 | Ga0436361_0954566_730_1299 | 186 |
| 273 | 3300039447 | Ga0436361_1053164 | Ga0436361_1053164_611_1180 | 186 |
| 274 | 3300045976 | Ga0466967_0310372 | Ga0466967_0310372_793_1356 | 186 |
| 275 | 3300046525 | Ga0495663_0011324 | Ga0495663_0011324_1612_2187 | 186 |
| 276 | 3300046530 | Ga0495654_0000620 | Ga0495654_0000620_12121_12696 | 186 |
| 277 | 3300046543 | Ga0495645_0158777 | Ga0495645_0158777_436_999 | 186 |
| 278 | 3300046616 | Ga0495668_0001088 | Ga0495668_0001088_15814_16389 | 186 |
| 279 | 3300048905 | Ga0496102_0256561 | Ga0496102_0256561_834_1409 | 186 |
| 280 | 3300049570 | Ga0501033_0015378 | Ga0501033_0015378_3630_4211 | 186 |
| 281 | 3300049571 | Ga0501034_0433196 | Ga0501034_0433196_331_912 | 186 |
| 282 | 3300049571 | Ga0501034_0830551 | Ga0501034_0830551_41_613 | 186 |
| 283 | 3300049572 | Ga0501036_0512644 | Ga0501036_0512644_103_684 | 186 |
| 284 | 3300049574 | Ga0501038_0041942 | Ga0501038_0041942_1690_2271 | 186 |
| 285 | 3300049575 | Ga0501039_0546065 | Ga0501039_0546065_269_850 | 186 |
| 286 | 3300049581 | Ga0501047_0193555 | Ga0501047_0193555_729_1310 | 186 |
| 287 | 3300049822 | Ga0501035_0015500 | Ga0501035_0015500_136_717 | 186 |
| 288 | 3300049822 | Ga0501035_0212585 | Ga0501035_0212585_984_1565 | 186 |
| 289 | 3300049823 | Ga0501044_0013532 | Ga0501044_0013532_4965_5546 | 186 |
| 290 | 3300049823 | Ga0501044_1003605 | Ga0501044_1003605_108_689 | 186 |
| 291 | 3300049824 | Ga0501045_0741240 | Ga0501045_0741240_47_628 | 186 |
| 292 | 3300053151 | Ga0500604_0013997 | Ga0500604_0013997_432_1007 | 186 |
| 293 | 3300053158 | Ga0500627_0000110 | Ga0500627_0000110_14473_15048 | 186 |
| 294 | 3300001915 | JGI24741J21665_1002108 | JGI24741J21665_10021087 | 187 |
| 295 | 3300001979 | JGI24740J21852_10000988 | JGI24740J21852_100009882 | 187 |
| 296 | 3300001990 | JGI24737J22298_10002123 | JGI24737J22298_100021236 | 187 |
| 297 | 3300002067 | JGI24735J21928_10051921 | JGI24735J21928_100519212 | 187 |
| 298 | 3300005327 | Ga0070658_10049683 | Ga0070658_100496833 | 187 |
| 299 | 3300005366 | Ga0070659_100094940 | Ga0070659_1000949403 | 187 |
| 300 | 3300005455 | Ga0070663_101046342 | Ga0070663_1010463421 | 187 |
| 301 | 3300005564 | Ga0070664_100371756 | Ga0070664_1003717563 | 187 |
| 302 | 3300005614 | Ga0068856_100334840 | Ga0068856_1003348401 | 187 |
| 303 | 3300009174 | Ga0105241_10012716 | Ga0105241_100127165 | 187 |
| 304 | 3300010375 | Ga0105239_11501517 | Ga0105239_115015171 | 187 |
| 305 | 3300010375 | Ga0105239_12026062 | Ga0105239_120260621 | 187 |
| 306 | 3300013307 | Ga0157372_10183971 | Ga0157372_101839714 | 187 |
| 307 | 3300025321 | Ga0207656_10063540 | Ga0207656_100635401 | 187 |
| 308 | 3300025904 | Ga0207647_10124832 | Ga0207647_101248323 | 187 |
| 309 | 3300025909 | Ga0207705_10001711 | Ga0207705_100017116 | 187 |
| 310 | 3300025911 | Ga0207654_10000246 | Ga0207654_1000024629 | 187 |
| 311 | 3300025913 | Ga0207695_10033239 | Ga0207695_100332395 | 187 |
| 312 | 3300025914 | Ga0207671_10042814 | Ga0207671_100428142 | 187 |
| 313 | 3300025919 | Ga0207657_10196601 | Ga0207657_101966012 | 187 |
| 314 | 3300025920 | Ga0207649_10001563 | Ga0207649_100015638 | 187 |
| 315 | 3300025932 | Ga0207690_10000630 | Ga0207690_1000063025 | 187 |
| 316 | 3300025944 | Ga0207661_10256600 | Ga0207661_102566002 | 187 |
| 317 | 3300025949 | Ga0207667_10000001 | Ga0207667_10000001545 | 187 |
| 318 | 3300025949 | Ga0207667_10740089 | Ga0207667_107400891 | 187 |
| 319 | 3300025981 | Ga0207640_10007061 | Ga0207640_100070618 | 187 |
| 320 | 3300025981 | Ga0207640_11089532 | Ga0207640_110895321 | 187 |
| 321 | 3300026041 | Ga0207639_10030774 | Ga0207639_100307745 | 187 |
| 322 | 3300026067 | Ga0207678_10002526 | Ga0207678_100025261 | 187 |
| 323 | 3300026078 | Ga0207702_10002653 | Ga0207702_100026538 | 187 |
| 324 | 3300026116 | Ga0207674_10111943 | Ga0207674_101119433 | 187 |
| 325 | 3300026142 | Ga0207698_10157092 | Ga0207698_101570922 | 187 |
| 326 | 3300028800 | Ga0265338_10013280 | Ga0265338_1001328012 | 187 |
| 327 | 3300044842 | Ga0466957_0256105 | Ga0466957_0256105_537_1121 | 187 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8g3k-assembly1.cif.gz_B | cryo-em imaging scaffold subunits a and b used to display kras g12c complex with gdp | 0.9581 | 30 | 172 |
| 2ah6-assembly1.cif.gz_C | crystal structure of a putative cobalamin adenosyltransferase (bh1595) from bacillus halodurans c-125 at 1.60 a resolution | 0.9489 | 29 | 182 |
| 5im6-assembly1.cif.gz_A | crystal structure of designed two-component self-assembling icosahedral cage i32-28 | 0.9452 | 29 | 181 |
| 3ke4-assembly1.cif.gz_B | crystal structure of a pduo-type atp:cob(i)alamin adenosyltransferase from bacillus cereus | 0.9384 | 15 | 181 |
| 2zhy-assembly1.cif.gz_A | crystal structure of a pduo-type atp:cobalamin adenosyltransferase from burkholderia thailandensis | 0.9384 | 29 | 179 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2zhzB01 | Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like | 0.9496 | 16 | 181 | 1.20.1200.10 |
| 2zhzB01 | Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like | 0.944 | 16 | 181 | 1.20.1200.10 |
| 5cy5A00 | Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like | 0.9374 | 29 | 170 | 1.20.1200.10 |
| 2ah6A00 | Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like | 0.9353 | 29 | 181 | 1.20.1200.10 |
| 4nwpB00 | Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like | 0.9298 | 27 | 172 | 1.20.1200.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2H6AX01-F1-model_v4 | Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) | 0.9873 | 88 | 187 |
GO:0005524
GO:0008817 GO:0009236 |
| AF-A0A2H6AX01-F1-model_v4 | Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) | 0.9777 | 88 | 187 |
GO:0005524
GO:0008817 GO:0009236 |
| AF-A0A1F5HMK9-F1-model_v4 | Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) | 0.9637 | 60 | 180 |
GO:0005524
GO:0008817 GO:0009236 |
| AF-A0A4Q3XWD5-F1-model_v4 | Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) | 0.9631 | 59 | 186 |
GO:0005524
GO:0008817 GO:0009236 |
| AF-A0A7V9MBJ5-F1-model_v4 | Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) | 0.9616 | 23 | 185 |
GO:0005524
GO:0008817 GO:0009236 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar