F408995

General Info

Members Datasets Scaffolds Average Seq Length
327 237 654 464

Family's Representative Sequence

Representative Sequence 3300053122|Ga0500608_000224|Ga0500608_000224_3179_4726
Length 515
Sequence VVLPKDGQAQRLSIQHQLCVATSPPDLTIRSSRGGFFTLFTRHQGNGAMDGVRGIKRAIAATLLASVALAGCGKGSGDQAKPAASANGIEKPTLKLGFIKLTDIAPLVVAQEKGFFKDEGLTVTLEPQANWKVLLDGVTGGQLDGAHMLAGQVLASGAGIGSKVPLVTPFSLDINGKGVTVSNQVWDMIAPTLPKGPDGKVQMPISAEALKPVVAKFKAEGKPFKMGMVFPVSTHNYILRYWLAAGGLNPGYYLPADTAGVTGAEVQLSVTPPPQMPSTMEAGTINGYSVGEPWNQASVAKKIGVPIIVDPDIAGTTGDKVFGLTAEFAKKNPNTVKAITRALIRASMWLDADGGKNRPEAVKLLANSKYVGADEKVLMASMTGSFTFGAGDTRSTPEFNLFFNQQASYPFYSDGIWFLTQMRRWGQIPDDKSDQWYLDTVKSVYREDLYDEAAKSLVADGKAKAEDFPKTDGFRVYAHKAIDGVPFDAHKPAAYAASFTIGLKPGQKVTPAGVK

Samples

Sample ID Description Type Environment
1 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
72 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
73 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
74 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
75 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
115 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
116 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
117 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
132 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
135 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
136 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
137 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
138 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
139 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
145 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
146 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
147 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
148 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
149 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
150 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
151 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
154 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
167 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
168 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
178 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
179 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
180 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
185 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
186 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
187 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
188 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
189 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
190 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
191 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
192 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
193 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
194 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
195 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
196 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
197 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
198 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
199 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
200 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
201 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
204 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
205 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
206 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
207 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
208 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
209 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
210 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
211 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
212 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
213 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
214 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
215 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
216 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
217 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
218 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
219 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
220 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
221 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
222 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
223 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
224 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
225 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
226 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
227 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
228 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
229 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
230 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
231 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
232 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
233 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
234 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
235 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
236 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
237 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.46
Metatranscriptomes 1.83
Isolates 10.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.84
Nodule 2.75
Rhizoplane 2.45
Rhizosphere 68.81
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500608_000224 3300053122 Bacteria 22253
2 SwRhRL2b_contig_539634 2162886007 Bacteria 21292
3 JGI24751J29686_10000134 3300002459 Bacteria 37360
4 JGI25153J46596_10000010 3300003215 Bacteria 337769
5 rootH2_10012658 3300003320 Bacteria 82320
6 rootH1_10267483 3300003323 Bacteria 4689
7 Ga0055531_10019110 3300003794 Bacteria 2792
8 Ga0065704_10000191 3300005289 Bacteria 318191
9 Ga0065707_10083905 3300005295 Bacteria 8009
10 Ga0065707_10133118 3300005295 Bacteria 1887
11 Ga0070658_10000486 3300005327 Bacteria 34470
12 Ga0070683_100011322 3300005329 Bacteria 7704
13 Ga0070683_100211797 3300005329 Bacteria 1841
14 Ga0070690_100005887 3300005330 Bacteria 6915
15 Ga0070670_100020715 3300005331 Bacteria 5655
16 Ga0068868_100010709 3300005338 Bacteria 6647
17 Ga0070689_100009668 3300005340 Bacteria 6841
18 Ga0070691_10052180 3300005341 Bacteria 1955
19 Ga0070669_100069163 3300005353 Bacteria 2607
20 Ga0070675_100005379 3300005354 Bacteria 9785
21 Ga0070675_100051956 3300005354 Bacteria 3369
22 Ga0070671_100028552 3300005355 Bacteria 4595
23 Ga0070674_100069854 3300005356 Bacteria 2479
24 Ga0070673_100035714 3300005364 Bacteria 3770
25 Ga0070673_100110931 3300005364 Bacteria 2275
26 Ga0070688_100044936 3300005365 Bacteria 2727
27 Ga0070667_100001223 3300005367 Bacteria 23386
28 Ga0070705_100054996 3300005440 Bacteria 2337
29 Ga0070678_100056657 3300005456 Bacteria 2868
30 Ga0068867_100102628 3300005459 Bacteria 2186
31 Ga0070685_10028263 3300005466 Bacteria 3107
32 Ga0070699_100006662 3300005518 Bacteria 10041
33 Ga0070672_100005632 3300005543 Bacteria 8336
34 Ga0070672_100103764 3300005543 Bacteria 2309
35 Ga0070686_100013313 3300005544 Bacteria 4705
36 Ga0068855_100031451 3300005563 Bacteria 6337
37 Ga0068855_100115257 3300005563 Bacteria 3081
38 Ga0070664_100000900 3300005564 Bacteria 23120
39 Ga0068854_100000459 3300005578 Bacteria 25127
40 Ga0068856_100000776 3300005614 Bacteria 34703
41 Ga0068856_100011271 3300005614 Bacteria 8677
42 Ga0068856_100013718 3300005614 Bacteria 7834
43 Ga0070702_100007747 3300005615 Bacteria 5159
44 Ga0068852_100000231 3300005616 Bacteria 37728
45 Ga0068852_100019858 3300005616 Bacteria 5330
46 Ga0068852_100098575 3300005616 Bacteria 2632
47 Ga0068859_100003052 3300005617 Bacteria 16996
48 Ga0068870_10004252 3300005840 Bacteria 6154
49 Ga0068863_100005703 3300005841 Bacteria 12224
50 Ga0068863_100147282 3300005841 Bacteria 2252
51 Ga0068858_100001710 3300005842 Bacteria 22428
52 Ga0068858_100057350 3300005842 Bacteria 3599
53 Ga0068860_100004891 3300005843 Bacteria 13657
54 Ga0068860_100009817 3300005843 Bacteria 9501
55 Ga0068860_100083230 3300005843 Bacteria 3043
56 Ga0068862_100000095 3300005844 Bacteria 105957
57 Ga0068862_100004950 3300005844 Bacteria 11216
58 Ga0068862_100006952 3300005844 Bacteria 9389
59 Ga0081455_10064098 3300005937 Bacteria 3079
60 Ga0075368_10000041 3300006042 Bacteria 29722
61 Ga0075432_10001736 3300006058 Bacteria 7174
62 Ga0070712_100086488 3300006175 Bacteria 2285
63 Ga0075362_10000042 3300006177 Bacteria 45768
64 Ga0075362_10001396 3300006177 Bacteria 7673
65 Ga0075369_10001319 3300006186 Bacteria 8437
66 Ga0075366_10000086 3300006195 Bacteria 36542
67 Ga0075366_10008795 3300006195 Bacteria 5623
68 Ga0097621_100012010 3300006237 Bacteria 6409
69 Ga0097621_100076411 3300006237 Bacteria 2778
70 Ga0075370_10000026 3300006353 Bacteria 51806
71 Ga0075370_10003519 3300006353 Bacteria 7469
72 Ga0068871_100061054 3300006358 Bacteria 3077
73 Ga0097620_100003052 3300006931 Bacteria 16996
74 Ga0105240_10013931 3300009093 Bacteria 11008
75 Ga0105240_10267262 3300009093 Bacteria 1971
76 Ga0105245_10003339 3300009098 Bacteria 14395
77 Ga0105247_10001474 3300009101 Bacteria 16937
78 Ga0114129_10034549 3300009147 Bacteria 7142
79 Ga0105243_10122182 3300009148 Bacteria 2197
80 Ga0105241_10036769 3300009174 Bacteria 3686
81 Ga0105248_10010752 3300009177 Bacteria 10102
82 Ga0105238_10006007 3300009551 Bacteria 12035
83 Ga0105249_10000079 3300009553 Bacteria 139904
84 Ga0105239_10153081 3300010375 Bacteria 2574
85 Ga0157374_10003995 3300013296 Bacteria 12394
86 Ga0157374_10155193 3300013296 Bacteria 2227
87 Ga0157372_10256815 3300013307 Bacteria 2029
88 Ga0157375_10001697 3300013308 Bacteria 18902
89 Ga0163163_10004421 3300014325 Bacteria 11982
90 Ga0157380_10071815 3300014326 Bacteria 2801
91 Ga0157380_10168607 3300014326 Bacteria 1910
92 Ga0157379_10002963 3300014968 Bacteria 14324
93 Ga0157379_10078162 3300014968 Bacteria 2963
94 Ga0157376_10052737 3300014969 Bacteria 3383
95 Ga0214544_1007743 3300021320 Bacteria 18523
96 Ga0214542_1000082 3300021321 Bacteria 120825
97 Ga0214543_1000075 3300021327 Bacteria 120861
98 Ga0209758_1000033 3300025297 Bacteria 469998
99 Ga0209758_1016919 3300025297 Bacteria 3670
100 Ga0209050_1004613 3300025298 Bacteria 9204
101 Ga0209257_1000237 3300025304 Bacteria 128812
102 Ga0207682_10000460 3300025893 Bacteria 18816
103 Ga0207680_10029494 3300025903 Bacteria 3083
104 Ga0207647_10016969 3300025904 Bacteria 4957
105 Ga0207645_10015834 3300025907 Bacteria 4997
106 Ga0207705_10000004 3300025909 Bacteria 705756
107 Ga0207693_10085513 3300025915 Bacteria 2470
108 Ga0207663_10140522 3300025916 Bacteria 1681
109 Ga0207659_10023892 3300025926 Bacteria 4087
110 Ga0207644_10005436 3300025931 Bacteria 8307
111 Ga0207686_10070370 3300025934 Bacteria 2248
112 Ga0207670_10021273 3300025936 Bacteria 4000
113 Ga0207691_10003078 3300025940 Bacteria 16275
114 Ga0207691_10085255 3300025940 Bacteria 2835
115 Ga0207691_10091825 3300025940 Bacteria 2719
116 Ga0207711_10082036 3300025941 Bacteria 2818
117 Ga0207689_10051691 3300025942 Bacteria 3387
118 Ga0207679_10068565 3300025945 Bacteria 2665
119 Ga0207667_10073620 3300025949 Bacteria 3549
120 Ga0207667_10115765 3300025949 Bacteria 2763
121 Ga0207651_10024624 3300025960 Bacteria 3727
122 Ga0207712_10000030 3300025961 Bacteria 216514
123 Ga0207668_10166690 3300025972 Bacteria 1723
124 Ga0207640_10000508 3300025981 Bacteria 23527
125 Ga0207658_10064520 3300025986 Bacteria 2747
126 Ga0207677_10060707 3300026023 Bacteria 2615
127 Ga0207703_10023384 3300026035 Bacteria 4853
128 Ga0207702_10004366 3300026078 Bacteria 12605
129 Ga0207702_10018238 3300026078 Bacteria 5806
130 Ga0207702_10059451 3300026078 Bacteria 3255
131 Ga0207641_10001899 3300026088 Bacteria 20063
132 Ga0207641_10004134 3300026088 Bacteria 12647
133 Ga0207648_10025130 3300026089 Bacteria 5311
134 Ga0207676_10025068 3300026095 Bacteria 4422
135 Ga0207674_10011136 3300026116 Bacteria 10115
136 Ga0207675_100084181 3300026118 Bacteria 2984
137 Ga0207675_100102841 3300026118 Bacteria 2692
138 Ga0207683_10021106 3300026121 Bacteria 5574
139 Ga0207683_10038214 3300026121 Bacteria 4182
140 Ga0207698_10000058 3300026142 Bacteria 78048
141 Ga0209813_10000435 3300027866 Bacteria 10213
142 Ga0268266_10038776 3300028379 Bacteria 4056
143 Ga0268265_10000132 3300028380 Bacteria 95410
144 Ga0268265_10008102 3300028380 Bacteria 7101
145 Ga0268264_10000779 3300028381 Bacteria 35038
146 Ga0268264_10007130 3300028381 Bacteria 9367
147 Ga0268264_10066177 3300028381 Bacteria 3047
148 Ga0265338_10043333 3300028800 Bacteria 4176
149 Ga0307513_10000914 3300031456 Bacteria 42646
150 Ga0307513_10014670 3300031456 Bacteria 9538
151 Ga0307509_10008486 3300031507 Bacteria 13080
152 Ga0307508_10034010 3300031616 Bacteria 4596
153 Ga0316579_10038386 3300031691 Bacteria 2214
154 Ga0307516_10052291 3300031730 Bacteria 3999
155 Ga0307405_10016515 3300031731 Bacteria 4028
156 Ga0307405_10031886 3300031731 Bacteria 3108
157 Ga0307412_10000866 3300031911 Bacteria 17389
158 Ga0307412_10029158 3300031911 Bacteria 3461
159 Ga0307409_100053391 3300031995 Bacteria 3105
160 Ga0307409_100077331 3300031995 Bacteria 2673
161 Ga0307414_10002587 3300032004 Bacteria 9520
162 Ga0307414_10031392 3300032004 Bacteria 3484
163 Ga0307415_100093597 3300032126 Bacteria 2183
164 Ga0316592_1000294 3300033524 Bacteria 6357
165 Ga0316596_1000407 3300033541 Bacteria 7145
166 Ga0316596_1002523 3300033541 Bacteria 3918
167 Ga0316596_1002630 3300033541 Bacteria 3850
168 Ga0316596_1003043 3300033541 Bacteria 3643
169 Ga0316596_1014933 3300033541 Bacteria 1932
170 Ga0316574_0005375 3300035398 Bacteria 6827
171 Ga0373931_0025365 3300035691 Bacteria 3011
172 Ga0373931_0080347 3300035691 Bacteria 1798
173 Ga0373935_0062949 3300035692 Bacteria 2377
174 Ga0373927_0006067 3300035695 Bacteria 8278
175 Ga0373947_0023724 3300035725 Bacteria 3571
176 Ga0373937_0122471 3300036401 Bacteria 2424
177 Ga0373937_0123462 3300036401 Bacteria 2414
178 Ga0316582_0003576 3300036647 Bacteria 7655
179 Ga0316582_0014450 3300036647 Bacteria 4480
180 Ga0316582_0034477 3300036647 Bacteria 3118
181 Ga0316582_0064491 3300036647 Bacteria 2356
182 Ga0316584_0014068 3300036712 Bacteria 5682
183 Ga0316584_0014219 3300036712 Bacteria 5660
184 Ga0316584_0026398 3300036712 Bacteria 4270
185 Ga0316584_0080571 3300036712 Bacteria 2439
186 Ga0316584_0084018 3300036712 Bacteria 2384
187 Ga0373925_0003815 3300037068 Bacteria 11568
188 Ga0373925_0024075 3300037068 Bacteria 4444
189 Ga0373925_0069798 3300037068 Bacteria 2655
190 Ga0316581_0003288 3300037588 Bacteria 4007
191 Ga0316581_0005685 3300037588 Bacteria 3264
192 Ga0400490_02808 3300038726 Bacteria 16281
193 Ga0400491_23555 3300038727 Bacteria 9874
194 Ga0400483_018242 3300039062 Bacteria 11628
195 Ga0400483_031978 3300039062 Bacteria 104878
196 Ga0400483_062144 3300039062 Bacteria 10878
197 Ga0400483_071737 3300039062 Bacteria 4871
198 Ga0400483_113767 3300039062 Bacteria 3088
199 Ga0400483_144965 3300039062 Bacteria 108715
200 Ga0400483_148749 3300039062 Bacteria 1985
201 Ga0400483_192144 3300039062 Bacteria 3637
202 Ga0400483_221680 3300039062 Bacteria 2072
203 Ga0400483_280444 3300039062 Bacteria 1639
204 Ga0439435_0006568 3300042436 Bacteria 2618
205 Ga0451577_0000091 3300042876 Bacteria 201647
206 Ga0451577_0009299 3300042876 Bacteria 9473
207 Ga0453684_0000632 3300044712 Bacteria 127568
208 Ga0453684_0000838 3300044712 Bacteria 103849
209 Ga0453684_0054058 3300044712 Bacteria 5235
210 Ga0453684_0073999 3300044712 Bacteria 4292
211 Ga0453684_0119751 3300044712 Bacteria 3181
212 Ga0451576_0000449 3300045051 Bacteria 93533
213 Ga0451576_0023332 3300045051 Bacteria 6699
214 Ga0495627_000799 3300046453 Bacteria 23006
215 Ga0495651_0050937 3300046462 Bacteria 3194
216 Ga0495650_0000565 3300046471 Bacteria 52077
217 Ga0495596_0000313 3300046500 Bacteria 31894
218 Ga0495583_0012249 3300046506 Bacteria 4867
219 Ga0495610_0001553 3300046512 Bacteria 20242
220 Ga0495620_0010179 3300046515 Bacteria 4967
221 Ga0495632_0057373 3300046519 Bacteria 1900
222 Ga0495643_0005754 3300046522 Bacteria 8294
223 Ga0495644_0005626 3300046523 Bacteria 4888
224 Ga0495652_0124169 3300046529 Bacteria 2054
225 Ga0495621_0007641 3300046539 Bacteria 3209
226 Ga0495656_0015274 3300046615 Bacteria 2896
227 Ga0495625_0014725 3300046660 Bacteria 6226
228 Ga0495625_0015263 3300046660 Bacteria 6092
229 Ga0495625_0058477 3300046660 Bacteria 2739
230 Ga0495658_0044903 3300046683 Bacteria 2477
231 Ga0495681_0000014 3300047470 Bacteria 184395
232 Ga0495686_0056507 3300047472 Bacteria 2452
233 Ga0496109_0007421 3300048912 Bacteria 9281
234 Ga0496110_0188285 3300048913 Bacteria 1874
235 Ga0496111_0040413 3300048914 Bacteria 3346
236 Ga0496112_0006325 3300048915 Bacteria 10399
237 Ga0496113_0116976 3300048916 Bacteria 2081
238 Ga0496114_0010463 3300048917 Bacteria 7382
239 Ga0496114_0016581 3300048917 Bacteria 5938
240 Ga0496115_0058098 3300048918 Bacteria 3112
241 Ga0496123_0090645 3300048926 Bacteria 1817
242 Ga0496126_0002855 3300048929 Bacteria 22592
243 Ga0501031_0128958 3300049568 Bacteria 1652
244 Ga0501032_0007778 3300049569 Bacteria 7817
245 Ga0501034_0000012 3300049571 Bacteria 310504
246 Ga0501034_0197008 3300049571 Bacteria 1974
247 Ga0501036_0105384 3300049572 Bacteria 2385
248 Ga0501036_0233542 3300049572 Bacteria 1543
249 Ga0501037_0111545 3300049573 Bacteria 1970
250 Ga0501038_0000500 3300049574 Bacteria 34410
251 Ga0501041_0090088 3300049577 Bacteria 1894
252 Ga0501042_0073526 3300049578 Bacteria 2445
253 Ga0501047_0082802 3300049581 Bacteria 3084
254 Ga0501071_0057276 3300049587 Bacteria 2816
255 Ga0501073_0003752 3300049589 Bacteria 11419
256 Ga0501075_0161250 3300049591 Bacteria 1711
257 Ga0501257_000001 3300049686 Bacteria 74809
258 Ga0501080_0052905 3300049742 Bacteria 3780
259 Ga0501083_0001453 3300049744 Bacteria 16170
260 Ga0501083_0004532 3300049744 Bacteria 9816
261 Ga0501083_0013371 3300049744 Bacteria 5737
262 Ga0501044_0000032 3300049823 Bacteria 169439
263 Ga0501044_0001887 3300049823 Bacteria 24285
264 Ga0501044_0048823 3300049823 Bacteria 4370
265 Ga0501044_0183863 3300049823 Bacteria 2056
266 nmdc:mga03683_313_c1 3300050489 Bacteria 13884
267 nmdc:mga03683_53_c1 3300050489 Bacteria 47904
268 nmdc:mga03n38_2795_c1 3300050490 Bacteria 5482
269 nmdc:mga03n38_46312_c1 3300050490 Bacteria 1920
270 nmdc:mga00v17_1428_c1 3300050491 Bacteria 12538
271 nmdc:mga0k408_5_c2 3300050493 Bacteria 142245
272 nmdc:mga06z11_282_c1 3300050494 Bacteria 19918
273 nmdc:mga04h51_81_c1 3300050495 Bacteria 30329
274 nmdc:mga07m45_17_c1 3300050496 Bacteria 140936
275 nmdc:mga07m45_30_c1 3300050496 Bacteria 85279
276 nmdc:mga07m45_37919_c1 3300050496 Bacteria 2688
277 nmdc:mga07m45_473_c1 3300050496 Bacteria 10557
278 nmdc:mga0sz30_17156_c1 3300050516 Bacteria 1721
279 nmdc:mga0sz30_5677_c1 3300050516 Bacteria 4589
280 nmdc:mga0sz30_78_c2 3300050516 Bacteria 28116
281 Ga0500643_008178 3300053087 Bacteria 4137
282 Ga0500607_000240 3300053121 Bacteria 51266
283 Ga0500559_0015761 3300053136 Bacteria 3192
284 Ga0500564_000656 3300053138 Bacteria 10676
285 Ga0500568_0026229 3300053139 Bacteria 2448
286 Ga0500616_0000074 3300053153 Bacteria 222910
287 Ga0500616_0004027 3300053153 Bacteria 10695
288 Ga0500622_0006886 3300053156 Bacteria 6522
289 Ga0500636_0061915 3300053177 Bacteria 2183
290 Ga0500625_000037 3300053729 Bacteria 44475
291 Ga0500552_000421 3300053733 Bacteria 3917
292 Ga0501084_0086564 3300054114 Bacteria 2631
293 2508541647 2508501009 Bacteria 7784016
294 2511127388 2510917021 Bacteria 5705459
295 2512035813 2511231221 Bacteria 6846400
296 2585398051 2582581866 Bacteria 6859583
297 2597810577 2597489875 Bacteria 7010078
298 2599102340 2597490356 Bacteria 7030811
299 2643754609 2643221547 Bacteria 4740017
300 2657683377 2657244999 Bacteria 5946535
301 2738945698 2738541317 Bacteria 5340176
302 2739650261 2739367664 Bacteria 4114334
303 2740028734 2739367865 Bacteria 4114482
304 2788437136 2786546940 Bacteria 6396474
305 2792580456 2791355082 Bacteria 5973319
306 2804754677 2802429268 Bacteria 6094027
307 2837654342 2837651117 Bacteria 3772164
308 2837679002 2837678835 Bacteria 5252418
309 2838077759 2838074704 Bacteria 6785777
310 2840884037 2840878972 Bacteria 5483153
311 2846957004 2846952575 Bacteria 6587527
312 2848861508 2848858292 Bacteria 7391279
313 2891052261 2891048133 Bacteria 4447501
314 2896185267 2896184354 Bacteria 3258548
315 2896391873 2896384573 Bacteria 7700774
316 2913296717 2913295892 Bacteria 6333755
317 2913310620 2913308742 Bacteria 5350706
318 2919493743 2919493220 Bacteria 4598500
319 2919536599 2919534386 Bacteria 4577686
320 2919545626 2919543075 Bacteria 4728703
321 2920764985 2920760137 Bacteria 7427611
322 2923527367 2923525760 Bacteria 4472324
323 8005662741 8005658619 Bacteria 4500593
324 8049298507 8049293176 Bacteria 6128433
325 8054003600 8054002106 Bacteria 7987183
326 8054563605 8054558443 Bacteria 5204801
327 8056687272 8056681323 Bacteria 8472857
328 Ga0500608_000224
329 SwRhRL2b_contig_539634
330 JGI24751J29686_10000134
331 JGI25153J46596_10000010
332 rootH2_10012658
333 rootH1_10267483
334 Ga0055531_10019110
335 Ga0065704_10000191
336 Ga0065707_10083905
337 Ga0065707_10133118
338 Ga0070658_10000486
339 Ga0070683_100011322
340 Ga0070683_100211797
341 Ga0070690_100005887
342 Ga0070670_100020715
343 Ga0068868_100010709
344 Ga0070689_100009668
345 Ga0070691_10052180
346 Ga0070669_100069163
347 Ga0070675_100005379
348 Ga0070675_100051956
349 Ga0070671_100028552
350 Ga0070674_100069854
351 Ga0070673_100035714
352 Ga0070673_100110931
353 Ga0070688_100044936
354 Ga0070667_100001223
355 Ga0070705_100054996
356 Ga0070678_100056657
357 Ga0068867_100102628
358 Ga0070685_10028263
359 Ga0070699_100006662
360 Ga0070672_100005632
361 Ga0070672_100103764
362 Ga0070686_100013313
363 Ga0068855_100031451
364 Ga0068855_100115257
365 Ga0070664_100000900
366 Ga0068854_100000459
367 Ga0068856_100000776
368 Ga0068856_100011271
369 Ga0068856_100013718
370 Ga0070702_100007747
371 Ga0068852_100000231
372 Ga0068852_100019858
373 Ga0068852_100098575
374 Ga0068859_100003052
375 Ga0068870_10004252
376 Ga0068863_100005703
377 Ga0068863_100147282
378 Ga0068858_100001710
379 Ga0068858_100057350
380 Ga0068860_100004891
381 Ga0068860_100009817
382 Ga0068860_100083230
383 Ga0068862_100000095
384 Ga0068862_100004950
385 Ga0068862_100006952
386 Ga0081455_10064098
387 Ga0075368_10000041
388 Ga0075432_10001736
389 Ga0070712_100086488
390 Ga0075362_10000042
391 Ga0075362_10001396
392 Ga0075369_10001319
393 Ga0075366_10000086
394 Ga0075366_10008795
395 Ga0097621_100012010
396 Ga0097621_100076411
397 Ga0075370_10000026
398 Ga0075370_10003519
399 Ga0068871_100061054
400 Ga0097620_100003052
401 Ga0105240_10013931
402 Ga0105240_10267262
403 Ga0105245_10003339
404 Ga0105247_10001474
405 Ga0114129_10034549
406 Ga0105243_10122182
407 Ga0105241_10036769
408 Ga0105248_10010752
409 Ga0105238_10006007
410 Ga0105249_10000079
411 Ga0105239_10153081
412 Ga0157374_10003995
413 Ga0157374_10155193
414 Ga0157372_10256815
415 Ga0157375_10001697
416 Ga0163163_10004421
417 Ga0157380_10071815
418 Ga0157380_10168607
419 Ga0157379_10002963
420 Ga0157379_10078162
421 Ga0157376_10052737
422 Ga0214544_1007743
423 Ga0214542_1000082
424 Ga0214543_1000075
425 Ga0209758_1000033
426 Ga0209758_1016919
427 Ga0209050_1004613
428 Ga0209257_1000237
429 Ga0207682_10000460
430 Ga0207680_10029494
431 Ga0207647_10016969
432 Ga0207645_10015834
433 Ga0207705_10000004
434 Ga0207693_10085513
435 Ga0207663_10140522
436 Ga0207659_10023892
437 Ga0207644_10005436
438 Ga0207686_10070370
439 Ga0207670_10021273
440 Ga0207691_10003078
441 Ga0207691_10085255
442 Ga0207691_10091825
443 Ga0207711_10082036
444 Ga0207689_10051691
445 Ga0207679_10068565
446 Ga0207667_10073620
447 Ga0207667_10115765
448 Ga0207651_10024624
449 Ga0207712_10000030
450 Ga0207668_10166690
451 Ga0207640_10000508
452 Ga0207658_10064520
453 Ga0207677_10060707
454 Ga0207703_10023384
455 Ga0207702_10004366
456 Ga0207702_10018238
457 Ga0207702_10059451
458 Ga0207641_10001899
459 Ga0207641_10004134
460 Ga0207648_10025130
461 Ga0207676_10025068
462 Ga0207674_10011136
463 Ga0207675_100084181
464 Ga0207675_100102841
465 Ga0207683_10021106
466 Ga0207683_10038214
467 Ga0207698_10000058
468 Ga0209813_10000435
469 Ga0268266_10038776
470 Ga0268265_10000132
471 Ga0268265_10008102
472 Ga0268264_10000779
473 Ga0268264_10007130
474 Ga0268264_10066177
475 Ga0265338_10043333
476 Ga0307513_10000914
477 Ga0307513_10014670
478 Ga0307509_10008486
479 Ga0307508_10034010
480 Ga0316579_10038386
481 Ga0307516_10052291
482 Ga0307405_10016515
483 Ga0307405_10031886
484 Ga0307412_10000866
485 Ga0307412_10029158
486 Ga0307409_100053391
487 Ga0307409_100077331
488 Ga0307414_10002587
489 Ga0307414_10031392
490 Ga0307415_100093597
491 Ga0316592_1000294
492 Ga0316596_1000407
493 Ga0316596_1002523
494 Ga0316596_1002630
495 Ga0316596_1003043
496 Ga0316596_1014933
497 Ga0316574_0005375
498 Ga0373931_0025365
499 Ga0373931_0080347
500 Ga0373935_0062949
501 Ga0373927_0006067
502 Ga0373947_0023724
503 Ga0373937_0122471
504 Ga0373937_0123462
505 Ga0316582_0003576
506 Ga0316582_0014450
507 Ga0316582_0034477
508 Ga0316582_0064491
509 Ga0316584_0014068
510 Ga0316584_0014219
511 Ga0316584_0026398
512 Ga0316584_0080571
513 Ga0316584_0084018
514 Ga0373925_0003815
515 Ga0373925_0024075
516 Ga0373925_0069798
517 Ga0316581_0003288
518 Ga0316581_0005685
519 Ga0400490_02808
520 Ga0400491_23555
521 Ga0400483_018242
522 Ga0400483_031978
523 Ga0400483_062144
524 Ga0400483_071737
525 Ga0400483_113767
526 Ga0400483_144965
527 Ga0400483_148749
528 Ga0400483_192144
529 Ga0400483_221680
530 Ga0400483_280444
531 Ga0439435_0006568
532 Ga0451577_0000091
533 Ga0451577_0009299
534 Ga0453684_0000632
535 Ga0453684_0000838
536 Ga0453684_0054058
537 Ga0453684_0073999
538 Ga0453684_0119751
539 Ga0451576_0000449
540 Ga0451576_0023332
541 Ga0495627_000799
542 Ga0495651_0050937
543 Ga0495650_0000565
544 Ga0495596_0000313
545 Ga0495583_0012249
546 Ga0495610_0001553
547 Ga0495620_0010179
548 Ga0495632_0057373
549 Ga0495643_0005754
550 Ga0495644_0005626
551 Ga0495652_0124169
552 Ga0495621_0007641
553 Ga0495656_0015274
554 Ga0495625_0014725
555 Ga0495625_0015263
556 Ga0495625_0058477
557 Ga0495658_0044903
558 Ga0495681_0000014
559 Ga0495686_0056507
560 Ga0496109_0007421
561 Ga0496110_0188285
562 Ga0496111_0040413
563 Ga0496112_0006325
564 Ga0496113_0116976
565 Ga0496114_0010463
566 Ga0496114_0016581
567 Ga0496115_0058098
568 Ga0496123_0090645
569 Ga0496126_0002855
570 Ga0501031_0128958
571 Ga0501032_0007778
572 Ga0501034_0000012
573 Ga0501034_0197008
574 Ga0501036_0105384
575 Ga0501036_0233542
576 Ga0501037_0111545
577 Ga0501038_0000500
578 Ga0501041_0090088
579 Ga0501042_0073526
580 Ga0501047_0082802
581 Ga0501071_0057276
582 Ga0501073_0003752
583 Ga0501075_0161250
584 Ga0501257_000001
585 Ga0501080_0052905
586 Ga0501083_0001453
587 Ga0501083_0004532
588 Ga0501083_0013371
589 Ga0501044_0000032
590 Ga0501044_0001887
591 Ga0501044_0048823
592 Ga0501044_0183863
593 nmdc:mga03683_313_c1
594 nmdc:mga03683_53_c1
595 nmdc:mga03n38_2795_c1
596 nmdc:mga03n38_46312_c1
597 nmdc:mga00v17_1428_c1
598 nmdc:mga0k408_5_c2
599 nmdc:mga06z11_282_c1
600 nmdc:mga04h51_81_c1
601 nmdc:mga07m45_17_c1
602 nmdc:mga07m45_30_c1
603 nmdc:mga07m45_37919_c1
604 nmdc:mga07m45_473_c1
605 nmdc:mga0sz30_17156_c1
606 nmdc:mga0sz30_5677_c1
607 nmdc:mga0sz30_78_c2
608 Ga0500643_008178
609 Ga0500607_000240
610 Ga0500559_0015761
611 Ga0500564_000656
612 Ga0500568_0026229
613 Ga0500616_0000074
614 Ga0500616_0004027
615 Ga0500622_0006886
616 Ga0500636_0061915
617 Ga0500625_000037
618 Ga0500552_000421
619 Ga0501084_0086564
620 2508541647
621 2511127388
622 2512035813
623 2585398051
624 2597810577
625 2599102340
626 2643754609
627 2657683377
628 2738945698
629 2739650261
630 2740028734
631 2788437136
632 2792580456
633 2804754677
634 2837654342
635 2837679002
636 2838077759
637 2840884037
638 2846957004
639 2848861508
640 2891052261
641 2896185267
642 2896391873
643 2913296717
644 2913310620
645 2919493743
646 2919536599
647 2919545626
648 2920764985
649 2923527367
650 8005662741
651 8049298507
652 8054003600
653 8054563605
654 8056687272

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13379

NMT1_2

NMT1-like family

87

366

0.98

PF09084

NMT1

NMT1/THI5 like

101

168

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g29-assembly1.cif.gz_A crystal structure of the periplasmic nitrate-binding protein nrta from synechocystis pcc 6803 0.9263 47 460
2g29-assembly1.cif.gz_A crystal structure of the periplasmic nitrate-binding protein nrta from synechocystis pcc 6803 0.9216 47 460
2i49-assembly1.cif.gz_A crystal structure of apo form of bicarbonate transport protein cmpa from synechocystis sp. pcc 6803 0.8982 47 462
2i49-assembly1.cif.gz_A crystal structure of apo form of bicarbonate transport protein cmpa from synechocystis sp. pcc 6803 0.8939 47 462
3un6-assembly1.cif.gz_A 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound 0.8429 50 412
ID Description Score Start End Superfamily
2g29A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9253 47 435 3.40.190.10
2g29A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9008 47 435 3.40.190.10
2g29A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8812 134 271 3.40.190.10
2i4cA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.869 135 266 3.40.190.10
2x7qA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8515 51 337 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A0F9KG26-F1-model_v4 Nitrate ABC transporter substrate-binding protein 0.9952 63 381 GO:0005886
GO:0012505
AF-A0A0F9KG26-F1-model_v4 Nitrate ABC transporter substrate-binding protein 0.9921 63 381 GO:0005886
GO:0012505
AF-A0A1J5QUN4-F1-model_v4 Bicarbonate transport ATP-binding protein CmpC (EC 3.6.3.-) 0.9624 50 413 GO:0005524
GO:0005886
GO:0012505
GO:0016787
AF-A0A3M3HDL5-F1-model_v4 deleted 0.9578 48 463
AF-A0A838WII5-F1-model_v4 ABC transporter substrate-binding protein 0.9575 48 337 GO:0005524
GO:0005886
GO:0006811
GO:0015112
GO:0016887

Map