F409000

General Info

Members Datasets Scaffolds Average Seq Length
327 216 656 309

Family's Representative Sequence

Representative Sequence 3300053156|Ga0500622_0000049|Ga0500622_0000049_100094_101164
Length 356
Sequence MLVEDQNFHAANKRKVGISLCYTLFFLLLRSIFASDCQLFTNYALLGSPVLPKKPSSGYFIGGVIIGLAGAICFSTKAIVVKLAYRETDVDAVTLLALRMLFSLPFFLVSAALTSSKSGNVKFTGKQWVAVAVVGILGYYVSSLLDFLGLQYISAGMERLILFIYPTLVVLMSACFFKQKIGRYQWLALLITYAGLLLAFWSEVNWSETPEEHFYLGVWLIFLCAITYALYIVGSGRLIPIVGAGKFNSYAMTFAAAAVLVHFFLASERSLFHLSGKIYVYSFIMAILSTVIPSYLVSEGIKRMGSDNAAIVGSVGPVSTILQAYIFLQEPVYPVQIVGTMLILIGVLLISKKGRS

Samples

Sample ID Description Type Environment
1 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
121 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
122 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
123 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
124 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
125 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
126 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
127 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
128 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
142 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
143 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
144 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
145 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
146 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
147 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
148 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
151 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
152 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
159 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
170 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
171 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
172 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
173 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
174 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
175 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
176 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
177 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
178 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
179 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
180 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
181 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
182 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
183 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
184 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
185 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
186 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
187 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
190 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
191 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
192 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
193 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
197 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
200 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
203 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
204 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
205 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
206 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
207 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
208 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
209 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
210 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
211 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
212 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
213 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
214 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
215 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
216 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.17
Metatranscriptomes 0
Isolates 1.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.03
Nodule 0
Rhizoplane 1.53
Rhizosphere 79.82
Stem 0
Stem Tuber 0
Unclassified 6.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500622_0000049 3300053156 Bacteria 145793
2 JGI25153J46596_10001505 3300003215 Bacteria 13889
3 rootH1_10020706 3300003316 Bacteria 2563
4 rootH1_10130526 3300003316 Bacteria 2989
5 rootH1_10136499 3300003316 Bacteria 1392
6 rootH2_10044354 3300003320 Unclassified 3553
7 rootH2_10088204 3300003320 Bacteria 1355
8 rootH2_10104900 3300003320 Bacteria 5798
9 rootH2_10122341 3300003320 Bacteria 4076
10 rootH2_10185509 3300003320 Bacteria 1359
11 rootH2_10227098 3300003320 Archaea 1907
12 rootL2_10004760 3300003322 Bacteria 10616
13 rootL2_10010050 3300003322 Bacteria 5737
14 rootL2_10017269 3300003322 Bacteria 9184
15 rootL2_10024635 3300003322 Bacteria 7950
16 rootL2_10265907 3300003322 Bacteria 1141
17 rootH1_10003667 3300003323 Bacteria 128566
18 rootH1_10005611 3300003316 Bacteria 17859
19 rootH1_10005611 3300003323 Bacteria 26216
20 rootH1_10019440 3300003323 Bacteria 21517
21 rootH1_10021645 3300003323 Bacteria 11788
22 rootH1_10027430 3300003316 Bacteria 7834
23 rootH1_10027430 3300003323 Bacteria 13272
24 rootH1_10056965 3300003323 Bacteria 5860
25 rootH1_10057940 3300003323 Bacteria 2715
26 rootH1_10088241 3300003323 Bacteria 16095
27 rootH1_10224653 3300003323 Unclassified 1209
28 rootH1_10337783 3300003323 Bacteria 1523
29 Ga0055531_10000206 3300003794 Bacteria 64979
30 Ga0065715_10098560 3300005293 Bacteria 3531
31 Ga0070676_10039228 3300005328 Bacteria 2738
32 Ga0070676_10041049 3300005328 Bacteria 2681
33 Ga0070670_100008875 3300005331 Bacteria 8581
34 Ga0070670_100018297 3300005331 Bacteria 6011
35 Ga0070670_100114374 3300005331 Bacteria 2326
36 Ga0070670_100405068 3300005331 Bacteria 1205
37 Ga0070677_10087241 3300005333 Bacteria 1349
38 Ga0070666_10201802 3300005335 Unclassified 1399
39 Ga0070682_100045321 3300005337 Bacteria 2725
40 Ga0070660_100298524 3300005339 Bacteria 1320
41 Ga0070661_100050268 3300005344 Bacteria 3050
42 Ga0070675_100090251 3300005354 Bacteria 2566
43 Ga0070671_100133927 3300005355 Bacteria 2088
44 Ga0070674_100011255 3300005356 Bacteria 5440
45 Ga0070659_100220760 3300005366 Bacteria 1564
46 Ga0070701_10021430 3300005438 Bacteria 3084
47 Ga0070694_100114059 3300005444 Bacteria 1929
48 Ga0070708_100429282 3300005445 Bacteria 1246
49 Ga0070681_10038618 3300005458 Bacteria 4786
50 Ga0070685_10008116 3300005466 Bacteria 5380
51 Ga0070685_10143667 3300005466 Bacteria 1505
52 Ga0070706_100128842 3300005467 Bacteria 2361
53 Ga0070707_100217231 3300005468 Unclassified 1863
54 Ga0070684_100041206 3300005535 Bacteria 3980
55 Ga0068853_100021950 3300005539 Bacteria 5325
56 Ga0068853_100119188 3300005539 Bacteria 2352
57 Ga0070672_100001841 3300005543 Bacteria 13233
58 Ga0070686_100054705 3300005544 Bacteria 2554
59 Ga0070665_100097659 3300005548 Bacteria 2942
60 Ga0070704_100023263 3300005549 Bacteria 4043
61 Ga0068855_100013458 3300005563 Bacteria 9862
62 Ga0068855_100166534 3300005563 Bacteria 2498
63 Ga0068855_100194620 3300005563 Bacteria 2285
64 Ga0070664_100015911 3300005564 Bacteria 6159
65 Ga0068857_100003072 3300005577 Bacteria 13802
66 Ga0068854_100248369 3300005578 Bacteria 1420
67 Ga0068856_100045021 3300005614 Bacteria 4343
68 Ga0068856_100045836 3300005614 Bacteria 4306
69 Ga0068852_100001764 3300005616 Bacteria 14723
70 Ga0068859_100125693 3300005617 Bacteria 2633
71 Ga0068864_100232654 3300005618 Bacteria 1705
72 Ga0068866_10001027 3300005718 Bacteria 12279
73 Ga0068861_100241782 3300005719 Bacteria 1536
74 Ga0068861_100475740 3300005719 Unclassified 1124
75 Ga0068860_100009185 3300005843 Bacteria 9826
76 Ga0068862_100013715 3300005844 Bacteria 6715
77 Ga0075364_10001129 3300006051 Bacteria 14254
78 Ga0075364_10014588 3300006051 Bacteria 4857
79 Ga0070716_100243307 3300006173 Unclassified 1221
80 Ga0075366_10308098 3300006195 Bacteria 969
81 Ga0097621_100033593 3300006237 Bacteria 4086
82 Ga0097621_100152909 3300006237 Bacteria 1979
83 Ga0075428_100167049 3300006844 Bacteria 2387
84 Ga0075430_100240539 3300006846 Bacteria 1500
85 Ga0075431_100011765 3300006847 Bacteria 8829
86 Ga0075429_100034249 3300006880 Bacteria 4412
87 Ga0068865_100262197 3300006881 Bacteria 1369
88 Ga0097620_100125698 3300006931 Bacteria 2633
89 Ga0105240_10000753 3300009093 Bacteria 59090
90 Ga0105240_10010625 3300009093 Bacteria 12934
91 Ga0105240_10020000 3300009093 Bacteria 8938
92 Ga0105240_10031950 3300009093 Bacteria 6819
93 Ga0105240_10205948 3300009093 Bacteria 2302
94 Ga0105240_10395872 3300009093 Bacteria 1557
95 Ga0105240_10471196 3300009093 Bacteria 1401
96 Ga0111539_10020892 3300009094 Bacteria 8061
97 Ga0111539_10022999 3300009094 Bacteria 7654
98 Ga0111539_10328954 3300009094 Bacteria 1779
99 Ga0105245_10038729 3300009098 Bacteria 4242
100 Ga0114129_10015093 3300009147 Bacteria 10994
101 Ga0105243_10010470 3300009148 Bacteria 7043
102 Ga0105241_10004808 3300009174 Bacteria 9951
103 Ga0105241_10062830 3300009174 Bacteria 2864
104 Ga0105241_10306409 3300009174 Bacteria 1365
105 Ga0105242_10044071 3300009176 Bacteria 3611
106 Ga0105248_10126249 3300009177 Bacteria 2886
107 Ga0105237_10000365 3300009545 Bacteria 64152
108 Ga0105237_10237886 3300009545 Bacteria 1822
109 Ga0105238_10015347 3300009551 Bacteria 7757
110 Ga0105239_10001872 3300010375 Bacteria 27549
111 Ga0105239_10081736 3300010375 Bacteria 3556
112 Ga0157371_10014609 3300013102 Bacteria 5918
113 Ga0157371_10037883 3300013102 Bacteria 3450
114 Ga0157371_10171106 3300013102 Bacteria 1552
115 Ga0157370_10020204 3300013104 Bacteria 6655
116 Ga0157370_10043954 3300013104 Bacteria 4297
117 Ga0157370_10286447 3300013104 Bacteria 1522
118 Ga0157369_10152501 3300013105 Bacteria 2442
119 Ga0157369_10937214 3300013105 Bacteria 887
120 Ga0157374_10018999 3300013296 Bacteria 6079
121 Ga0157374_10520905 3300013296 Bacteria 1195
122 Ga0157378_10013671 3300013297 Bacteria 7099
123 Ga0157372_10005542 3300013307 Bacteria 13422
124 Ga0157372_10106883 3300013307 Bacteria 3201
125 Ga0157372_10351132 3300013307 Bacteria 1718
126 Ga0157372_10378630 3300013307 Bacteria 1649
127 Ga0157375_10108596 3300013308 Bacteria 2869
128 Ga0163163_10013034 3300014325 Bacteria 7590
129 Ga0163163_10158770 3300014325 Unclassified 2306
130 Ga0157380_10000745 3300014326 Bacteria 20296
131 Ga0157380_10019354 3300014326 Bacteria 5072
132 Ga0157380_10109037 3300014326 Bacteria 2322
133 Ga0157377_10011625 3300014745 Bacteria 4399
134 Ga0157379_10073436 3300014968 Bacteria 3062
135 Ga0157376_10196397 3300014969 Bacteria 1854
136 Ga0157376_10302954 3300014969 Bacteria 1513
137 Ga0163161_10129627 3300017792 Bacteria 1901
138 Ga0209050_1001560 3300025298 Bacteria 23881
139 Ga0209257_1000007 3300025304 Bacteria 1564415
140 Ga0207697_10006337 3300025315 Bacteria 5369
141 Ga0207642_10001432 3300025899 Bacteria 7404
142 Ga0207688_10019553 3300025901 Bacteria 3692
143 Ga0207680_10168934 3300025903 Unclassified 1472
144 Ga0207684_10102941 3300025910 Bacteria 2442
145 Ga0207654_10035542 3300025911 Bacteria 2777
146 Ga0207695_10000982 3300025913 Bacteria 50708
147 Ga0207695_10026067 3300025913 Bacteria 6530
148 Ga0207695_10028107 3300025913 Bacteria 6244
149 Ga0207671_10002759 3300025914 Bacteria 18342
150 Ga0207671_10151552 3300025914 Bacteria 1791
151 Ga0207662_10011565 3300025918 Bacteria 4901
152 Ga0207657_10432258 3300025919 Unclassified 1034
153 Ga0207646_10183724 3300025922 Unclassified 1889
154 Ga0207681_10098917 3300025923 Bacteria 2099
155 Ga0207694_10035564 3300025924 Bacteria 3822
156 Ga0207650_10001164 3300025925 Bacteria 19325
157 Ga0207650_10014166 3300025925 Bacteria 5539
158 Ga0207650_10116833 3300025925 Bacteria 2072
159 Ga0207659_10052922 3300025926 Bacteria 2894
160 Ga0207687_10051885 3300025927 Bacteria 2860
161 Ga0207687_10065787 3300025927 Bacteria 2575
162 Ga0207644_10009518 3300025931 Bacteria 6383
163 Ga0207706_10098903 3300025933 Unclassified 2566
164 Ga0207686_10035849 3300025934 Bacteria 2980
165 Ga0207669_10003300 3300025937 Bacteria 6980
166 Ga0207691_10003634 3300025940 Bacteria 14963
167 Ga0207691_10139591 3300025940 Bacteria 2136
168 Ga0207679_10064106 3300025945 Bacteria 2745
169 Ga0207667_10009515 3300025949 Bacteria 11435
170 Ga0207667_10046302 3300025949 Bacteria 4605
171 Ga0207651_10008198 3300025960 Bacteria 5626
172 Ga0207677_10175733 3300026023 Bacteria 1679
173 Ga0207703_10020202 3300026035 Bacteria 5208
174 Ga0207639_10014401 3300026041 Bacteria 5562
175 Ga0207639_10290302 3300026041 Unclassified 1442
176 Ga0207639_10306962 3300026041 Unclassified 1404
177 Ga0207708_10006727 3300026075 Bacteria 8505
178 Ga0207702_10023986 3300026078 Bacteria 5062
179 Ga0207702_10065129 3300026078 Bacteria 3120
180 Ga0207641_10013799 3300026088 Bacteria 6623
181 Ga0207648_10023642 3300026089 Bacteria 5502
182 Ga0207676_10168896 3300026095 Bacteria 1904
183 Ga0207674_10004689 3300026116 Bacteria 16408
184 Ga0207674_10070735 3300026116 Bacteria 3508
185 Ga0207675_100002229 3300026118 Bacteria 19266
186 Ga0207675_100535313 3300026118 Unclassified 1169
187 Ga0207683_10005276 3300026121 Bacteria 11091
188 Ga0207698_10020301 3300026142 Bacteria 4570
189 Ga0207428_10006992 3300027907 Bacteria 10334
190 Ga0268265_10343873 3300028380 Bacteria 1359
191 Ga0268264_10001431 3300028381 Bacteria 22308
192 Ga0268264_10034169 3300028381 Bacteria 4181
193 Ga0265318_10012192 3300028577 Bacteria 3668
194 Ga0307517_10001115 3300028786 Bacteria 45308
195 Ga0265330_10010457 3300031235 Bacteria 4373
196 Ga0265332_10001790 3300031238 Bacteria 11556
197 Ga0265328_10028021 3300031239 Bacteria 2109
198 Ga0265329_10044307 3300031242 Bacteria 1422
199 Ga0265340_10021931 3300031247 Bacteria 3271
200 Ga0265331_10003027 3300031250 Bacteria 11025
201 Ga0265331_10076156 3300031250 Bacteria 1564
202 Ga0265316_10014805 3300031344 Bacteria 6846
203 Ga0307513_10130167 3300031456 Bacteria 2464
204 Ga0307513_10132769 3300031456 Bacteria 2432
205 Ga0307513_10260128 3300031456 Unclassified 1526
206 Ga0307509_10019958 3300031507 Bacteria 7621
207 Ga0307509_10053211 3300031507 Bacteria 4318
208 Ga0307509_10276102 3300031507 Bacteria 1445
209 Ga0307408_100003690 3300031548 Bacteria 10432
210 Ga0307408_100105657 3300031548 Unclassified 2153
211 Ga0307508_10023906 3300031616 Bacteria 5545
212 Ga0307508_10110005 3300031616 Bacteria 2355
213 Ga0265314_10011703 3300031711 Bacteria 7218
214 Ga0265342_10009725 3300031712 Bacteria 6736
215 Ga0307516_10179650 3300031730 Bacteria 1851
216 Ga0307412_10094329 3300031911 Unclassified 2101
217 Ga0307409_100033529 3300031995 Unclassified 3738
218 Ga0307416_100001534 3300032002 Bacteria 12624
219 Ga0307414_10023745 3300032004 Bacteria 3895
220 Ga0395900_0046459 3300037418 Bacteria 4471
221 Ga0439465_0027125 3300041413 Bacteria 1813
222 Ga0451798_0555165 3300041458 Bacteria 1550
223 Ga0451804_0963848 3300041463 Bacteria 1086
224 Ga0451851_0400526 3300041507 Bacteria 1359
225 Ga0439445_0051435 3300042004 Bacteria 1113
226 Ga0466972_0012933 3300044658 Bacteria 4192
227 Ga0453683_0013816 3300044673 Bacteria 5253
228 Ga0466964_0027773 3300044706 Bacteria 2224
229 Ga0451576_0009583 3300045051 Bacteria 11211
230 Ga0451576_0023699 3300045051 Bacteria 6641
231 Ga0495638_0000004 3300046460 Bacteria 700795
232 Ga0495638_0160726 3300046460 Bacteria 1296
233 Ga0495598_0008260 3300046537 Bacteria 2418
234 Ga0495622_0117431 3300046557 Bacteria 1216
235 Ga0495625_0151793 3300046660 Bacteria 1557
236 Ga0495686_0000025 3300047472 Bacteria 388098
237 Ga0495686_0038327 3300047472 Bacteria 3066
238 Ga0495686_0161977 3300047472 Unclassified 1306
239 Ga0496104_0475676 3300048907 Bacteria 1161
240 Ga0496110_0356222 3300048913 Bacteria 1333
241 Ga0496114_0020847 3300048917 Bacteria 5323
242 Ga0501298_004056 3300049521 Bacteria 2291
243 Ga0501031_0001881 3300049568 Bacteria 13215
244 Ga0501031_0105907 3300049568 Bacteria 1835
245 Ga0501032_0000118 3300049569 Bacteria 66260
246 Ga0501032_0001917 3300049569 Bacteria 16395
247 Ga0501033_0001938 3300049570 Bacteria 18014
248 Ga0501033_0103105 3300049570 Bacteria 2081
249 Ga0501034_0024849 3300049571 Bacteria 6095
250 Ga0501034_0115597 3300049571 Bacteria 2671
251 Ga0501034_0195865 3300049571 Bacteria 1980
252 Ga0501034_0332151 3300049571 Bacteria 1451
253 Ga0501037_0014917 3300049573 Bacteria 5715
254 Ga0501037_0018585 3300049573 Bacteria 5123
255 Ga0501037_0075818 3300049573 Bacteria 2442
256 Ga0501037_0119734 3300049573 Bacteria 1893
257 Ga0501038_0003882 3300049574 Bacteria 13896
258 Ga0501038_0006741 3300049574 Bacteria 10609
259 Ga0501039_0027765 3300049575 Bacteria 4352
260 Ga0501043_0002545 3300049579 Bacteria 15415
261 Ga0501043_0006014 3300049579 Bacteria 9758
262 Ga0501046_0001314 3300049580 Bacteria 24074
263 Ga0501047_0002250 3300049581 Bacteria 18471
264 Ga0501047_0012002 3300049581 Bacteria 8198
265 Ga0501047_0033928 3300049581 Bacteria 4926
266 Ga0501067_0000075 3300049583 Bacteria 56684
267 Ga0501067_0045245 3300049583 Bacteria 2444
268 Ga0501068_0140351 3300049584 Bacteria 1515
269 Ga0501069_0136365 3300049585 Bacteria 1406
270 Ga0501073_0000006 3300049589 Bacteria 228761
271 Ga0501073_0002326 3300049589 Bacteria 14220
272 Ga0501077_0000005 3300049593 Bacteria 120228
273 Ga0501202_003726 3300049652 Bacteria 2626
274 Ga0501202_015977 3300049652 Bacteria 1451
275 Ga0501207_000673 3300049654 Bacteria 3989
276 Ga0501207_000926 3300049654 Bacteria 3532
277 Ga0501216_007142 3300049660 Bacteria 1731
278 Ga0501217_004422 3300049661 Bacteria 2889
279 Ga0501222_005953 3300049662 Bacteria 1640
280 Ga0501223_007755 3300049663 Bacteria 2191
281 Ga0501235_022684 3300049669 Bacteria 1396
282 Ga0501242_001235 3300049674 Bacteria 2518
283 Ga0501242_004471 3300049674 Bacteria 1551
284 Ga0501257_000316 3300049686 Bacteria 9346
285 Ga0501259_000879 3300049688 Bacteria 4949
286 Ga0501221_000389 3300049704 Bacteria 6729
287 Ga0501225_0013151 3300049705 Bacteria 2318
288 Ga0501234_010608 3300049707 Bacteria 1437
289 Ga0501245_001928 3300049708 Bacteria 2736
290 Ga0501080_0000533 3300049742 Bacteria 29967
291 Ga0501080_0000767 3300049742 Bacteria 26070
292 Ga0501083_0005808 3300049744 Bacteria 8742
293 Ga0501241_003277 3300049758 Bacteria 3060
294 Ga0501264_000114 3300049761 Bacteria 12301
295 Ga0501268_014628 3300049765 Bacteria 1281
296 Ga0501279_015744 3300049775 Bacteria 1049
297 Ga0501035_0001296 3300049822 Bacteria 25823
298 Ga0501035_0036981 3300049822 Bacteria 4423
299 Ga0501044_0000916 3300049823 Bacteria 35511
300 Ga0501044_0012016 3300049823 Bacteria 9380
301 Ga0501044_0017292 3300049823 Bacteria 7735
302 Ga0501212_016700 3300049851 Unclassified 1104
303 nmdc:mga00v17_175352_c1 3300050491 Bacteria 1383
304 nmdc:mga00v17_4629_c1 3300050491 Bacteria 7177
305 nmdc:mga05p37_50737_c1 3300050507 Bacteria 5103
306 nmdc:mga09592_103103_c1 3300050508 Bacteria 2444
307 nmdc:mga0qj67_285615_c1 3300050509 Bacteria 1337
308 nmdc:mga08y16_10923_c1 3300050511 Bacteria 9537
309 nmdc:mga08y16_15724_c1 3300050511 Bacteria 7959
310 nmdc:mga08y16_324277_c1 3300050511 Bacteria 1585
311 Ga0500555_000754 3300053103 Bacteria 11896
312 Ga0500562_000271 3300053108 Bacteria 12969
313 Ga0500562_000334 3300053108 Bacteria 11304
314 Ga0500593_000777 3300053117 Bacteria 11907
315 Ga0500595_004220 3300053119 Bacteria 6498
316 Ga0500655_000194 3300053133 Bacteria 14548
317 Ga0500588_0000512 3300053146 Bacteria 6210
318 Ga0500604_0000157 3300053151 Bacteria 19961
319 Ga0500616_0000015 3300053153 Bacteria 633259
320 Ga0500616_0001885 3300053153 Bacteria 18871
321 Ga0500616_0011573 3300053153 Bacteria 5200
322 Ga0500622_0000056 3300053156 Bacteria 142254
323 Ga0500627_0002260 3300053158 Bacteria 5654
324 2739613349 2739367655 Bacteria 4051151
325 2840678267 2840677318 Bacteria 2664183
326 2881927808 2881927736 Bacteria 3993927
327 2896086084 2896085136 Bacteria 6129793
328 2910249016 2910245624 Bacteria 6935613
329 2911139381 2911138879 Bacteria 5811561
330 Ga0500622_0000049
331 JGI25153J46596_10001505
332 rootH1_10020706
333 rootH1_10130526
334 rootH1_10136499
335 rootH2_10044354
336 rootH2_10088204
337 rootH2_10104900
338 rootH2_10122341
339 rootH2_10185509
340 rootH2_10227098
341 rootL2_10004760
342 rootL2_10010050
343 rootL2_10017269
344 rootL2_10024635
345 rootL2_10265907
346 rootH1_10003667
347 rootH1_10005611
348 rootH1_10019440
349 rootH1_10021645
350 rootH1_10027430
351 rootH1_10056965
352 rootH1_10057940
353 rootH1_10088241
354 rootH1_10224653
355 rootH1_10337783
356 Ga0055531_10000206
357 Ga0065715_10098560
358 Ga0070676_10039228
359 Ga0070676_10041049
360 Ga0070670_100008875
361 Ga0070670_100018297
362 Ga0070670_100114374
363 Ga0070670_100405068
364 Ga0070677_10087241
365 Ga0070666_10201802
366 Ga0070682_100045321
367 Ga0070660_100298524
368 Ga0070661_100050268
369 Ga0070675_100090251
370 Ga0070671_100133927
371 Ga0070674_100011255
372 Ga0070659_100220760
373 Ga0070701_10021430
374 Ga0070694_100114059
375 Ga0070708_100429282
376 Ga0070681_10038618
377 Ga0070685_10008116
378 Ga0070685_10143667
379 Ga0070706_100128842
380 Ga0070707_100217231
381 Ga0070684_100041206
382 Ga0068853_100021950
383 Ga0068853_100119188
384 Ga0070672_100001841
385 Ga0070686_100054705
386 Ga0070665_100097659
387 Ga0070704_100023263
388 Ga0068855_100013458
389 Ga0068855_100166534
390 Ga0068855_100194620
391 Ga0070664_100015911
392 Ga0068857_100003072
393 Ga0068854_100248369
394 Ga0068856_100045021
395 Ga0068856_100045836
396 Ga0068852_100001764
397 Ga0068859_100125693
398 Ga0068864_100232654
399 Ga0068866_10001027
400 Ga0068861_100241782
401 Ga0068861_100475740
402 Ga0068860_100009185
403 Ga0068862_100013715
404 Ga0075364_10001129
405 Ga0075364_10014588
406 Ga0070716_100243307
407 Ga0075366_10308098
408 Ga0097621_100033593
409 Ga0097621_100152909
410 Ga0075428_100167049
411 Ga0075430_100240539
412 Ga0075431_100011765
413 Ga0075429_100034249
414 Ga0068865_100262197
415 Ga0097620_100125698
416 Ga0105240_10000753
417 Ga0105240_10010625
418 Ga0105240_10020000
419 Ga0105240_10031950
420 Ga0105240_10205948
421 Ga0105240_10395872
422 Ga0105240_10471196
423 Ga0111539_10020892
424 Ga0111539_10022999
425 Ga0111539_10328954
426 Ga0105245_10038729
427 Ga0114129_10015093
428 Ga0105243_10010470
429 Ga0105241_10004808
430 Ga0105241_10062830
431 Ga0105241_10306409
432 Ga0105242_10044071
433 Ga0105248_10126249
434 Ga0105237_10000365
435 Ga0105237_10237886
436 Ga0105238_10015347
437 Ga0105239_10001872
438 Ga0105239_10081736
439 Ga0157371_10014609
440 Ga0157371_10037883
441 Ga0157371_10171106
442 Ga0157370_10020204
443 Ga0157370_10043954
444 Ga0157370_10286447
445 Ga0157369_10152501
446 Ga0157369_10937214
447 Ga0157374_10018999
448 Ga0157374_10520905
449 Ga0157378_10013671
450 Ga0157372_10005542
451 Ga0157372_10106883
452 Ga0157372_10351132
453 Ga0157372_10378630
454 Ga0157375_10108596
455 Ga0163163_10013034
456 Ga0163163_10158770
457 Ga0157380_10000745
458 Ga0157380_10019354
459 Ga0157380_10109037
460 Ga0157377_10011625
461 Ga0157379_10073436
462 Ga0157376_10196397
463 Ga0157376_10302954
464 Ga0163161_10129627
465 Ga0209050_1001560
466 Ga0209257_1000007
467 Ga0207697_10006337
468 Ga0207642_10001432
469 Ga0207688_10019553
470 Ga0207680_10168934
471 Ga0207684_10102941
472 Ga0207654_10035542
473 Ga0207695_10000982
474 Ga0207695_10026067
475 Ga0207695_10028107
476 Ga0207671_10002759
477 Ga0207671_10151552
478 Ga0207662_10011565
479 Ga0207657_10432258
480 Ga0207646_10183724
481 Ga0207681_10098917
482 Ga0207694_10035564
483 Ga0207650_10001164
484 Ga0207650_10014166
485 Ga0207650_10116833
486 Ga0207659_10052922
487 Ga0207687_10051885
488 Ga0207687_10065787
489 Ga0207644_10009518
490 Ga0207706_10098903
491 Ga0207686_10035849
492 Ga0207669_10003300
493 Ga0207691_10003634
494 Ga0207691_10139591
495 Ga0207679_10064106
496 Ga0207667_10009515
497 Ga0207667_10046302
498 Ga0207651_10008198
499 Ga0207677_10175733
500 Ga0207703_10020202
501 Ga0207639_10014401
502 Ga0207639_10290302
503 Ga0207639_10306962
504 Ga0207708_10006727
505 Ga0207702_10023986
506 Ga0207702_10065129
507 Ga0207641_10013799
508 Ga0207648_10023642
509 Ga0207676_10168896
510 Ga0207674_10004689
511 Ga0207674_10070735
512 Ga0207675_100002229
513 Ga0207675_100535313
514 Ga0207683_10005276
515 Ga0207698_10020301
516 Ga0207428_10006992
517 Ga0268265_10343873
518 Ga0268264_10001431
519 Ga0268264_10034169
520 Ga0265318_10012192
521 Ga0307517_10001115
522 Ga0265330_10010457
523 Ga0265332_10001790
524 Ga0265328_10028021
525 Ga0265329_10044307
526 Ga0265340_10021931
527 Ga0265331_10003027
528 Ga0265331_10076156
529 Ga0265316_10014805
530 Ga0307513_10130167
531 Ga0307513_10132769
532 Ga0307513_10260128
533 Ga0307509_10019958
534 Ga0307509_10053211
535 Ga0307509_10276102
536 Ga0307408_100003690
537 Ga0307408_100105657
538 Ga0307508_10023906
539 Ga0307508_10110005
540 Ga0265314_10011703
541 Ga0265342_10009725
542 Ga0307516_10179650
543 Ga0307412_10094329
544 Ga0307409_100033529
545 Ga0307416_100001534
546 Ga0307414_10023745
547 Ga0395900_0046459
548 Ga0439465_0027125
549 Ga0451798_0555165
550 Ga0451804_0963848
551 Ga0451851_0400526
552 Ga0439445_0051435
553 Ga0466972_0012933
554 Ga0453683_0013816
555 Ga0466964_0027773
556 Ga0451576_0009583
557 Ga0451576_0023699
558 Ga0495638_0000004
559 Ga0495638_0160726
560 Ga0495598_0008260
561 Ga0495622_0117431
562 Ga0495625_0151793
563 Ga0495686_0000025
564 Ga0495686_0038327
565 Ga0495686_0161977
566 Ga0496104_0475676
567 Ga0496110_0356222
568 Ga0496114_0020847
569 Ga0501298_004056
570 Ga0501031_0001881
571 Ga0501031_0105907
572 Ga0501032_0000118
573 Ga0501032_0001917
574 Ga0501033_0001938
575 Ga0501033_0103105
576 Ga0501034_0024849
577 Ga0501034_0115597
578 Ga0501034_0195865
579 Ga0501034_0332151
580 Ga0501037_0014917
581 Ga0501037_0018585
582 Ga0501037_0075818
583 Ga0501037_0119734
584 Ga0501038_0003882
585 Ga0501038_0006741
586 Ga0501039_0027765
587 Ga0501043_0002545
588 Ga0501043_0006014
589 Ga0501046_0001314
590 Ga0501047_0002250
591 Ga0501047_0012002
592 Ga0501047_0033928
593 Ga0501067_0000075
594 Ga0501067_0045245
595 Ga0501068_0140351
596 Ga0501069_0136365
597 Ga0501073_0000006
598 Ga0501073_0002326
599 Ga0501077_0000005
600 Ga0501202_003726
601 Ga0501202_015977
602 Ga0501207_000673
603 Ga0501207_000926
604 Ga0501216_007142
605 Ga0501217_004422
606 Ga0501222_005953
607 Ga0501223_007755
608 Ga0501235_022684
609 Ga0501242_001235
610 Ga0501242_004471
611 Ga0501257_000316
612 Ga0501259_000879
613 Ga0501221_000389
614 Ga0501225_0013151
615 Ga0501234_010608
616 Ga0501245_001928
617 Ga0501080_0000533
618 Ga0501080_0000767
619 Ga0501083_0005808
620 Ga0501241_003277
621 Ga0501264_000114
622 Ga0501268_014628
623 Ga0501279_015744
624 Ga0501035_0001296
625 Ga0501035_0036981
626 Ga0501044_0000916
627 Ga0501044_0012016
628 Ga0501044_0017292
629 Ga0501212_016700
630 nmdc:mga00v17_175352_c1
631 nmdc:mga00v17_4629_c1
632 nmdc:mga05p37_50737_c1
633 nmdc:mga09592_103103_c1
634 nmdc:mga0qj67_285615_c1
635 nmdc:mga08y16_10923_c1
636 nmdc:mga08y16_15724_c1
637 nmdc:mga08y16_324277_c1
638 Ga0500555_000754
639 Ga0500562_000271
640 Ga0500562_000334
641 Ga0500593_000777
642 Ga0500595_004220
643 Ga0500655_000194
644 Ga0500588_0000512
645 Ga0500604_0000157
646 Ga0500616_0000015
647 Ga0500616_0001885
648 Ga0500616_0011573
649 Ga0500622_0000056
650 Ga0500627_0002260
651 2739613349
652 2840678267
653 2881927808
654 2896086084
655 2910249016
656 2911139381

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

61

201

0.96

PF00892

EamA

EamA-like transporter family

215

352

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i20-assembly4.cif.gz_D crystal structure of protein 0.7102 6 291
5i20-assembly1.cif.gz_A crystal structure of protein 0.7057 4 290
7b0k-assembly1.cif.gz_A membrane protein structure 0.7014 7 291
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.7011 7 291
5i20-assembly5.cif.gz_E crystal structure of protein 0.6947 6 290
ID Description Score Start End Superfamily
af_A0A0P0WMA8_96_409_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8395 7 292 1.20.1740.10
af_Q8RY83_36_351_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7766 1 290 1.20.1740.10
af_G4S7C7_57_179_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7338 209 296 1.10.3730.20
af_Q8RY83_36_351_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7212 1 290 1.20.1740.10
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7068 5 291 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A345DAH7-F1-model_v4 EamA domain-containing protein 0.9797 2 293 GO:0005886
AF-A0A7W3UZT8-F1-model_v4 DMT family transporter 0.9778 2 293 GO:0005886
AF-A0A4R7UP23-F1-model_v4 deleted 0.9766 2 293
AF-A0A3N1QP99-F1-model_v4 deleted 0.976 2 293
AF-A0A2R5FAC1-F1-model_v4 Multidrug DMT transporter permease 0.9737 2 294 GO:0005886

Map