F409083

General Info

Members Datasets Scaffolds Average Seq Length
328 196 656 258

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10110935|Ga0070658_101109352
Length 279
Sequence MRSRLAAPSPESICHPSKETMPRFAANLTMLFTEFPFLDRFERAARAGFKGVEFLFPYAFQPADIRARLAQFDLQLVLHNLPAGDWDAGERGIACHPDRRAEFRAGVERAIDYAGALGVRQLNCLVGKTPADVPAARVHETLVENLYHASGRLKEAGIRLLVEPINRFDIPGFHLHRTDQALALIDEVGGDNLFLQYDVYHAQRSEGELAETLRTHLSRIAHVQVADNPGRNEPGTGEINFPFLFGHLDRIGYQGWIGCEYKPAVATEIGLDWIRRIAK

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
63 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
65 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
66 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
68 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
69 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
109 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
110 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
118 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
119 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
120 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
121 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
122 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
123 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
134 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
135 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
136 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
137 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
138 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
139 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
140 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
141 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
142 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
143 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
144 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
145 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
146 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
147 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
148 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
149 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
150 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
151 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
152 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
153 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
154 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
155 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
156 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
157 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
158 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
170 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
171 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
172 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
173 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
180 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
184 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
185 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
188 2547132374 Acidovorax radicis N35 Isolate Unclassified
189 2643221717 Acidovorax sp. Root267 Isolate Unclassified
190 2721755523 Delftia sp. HK171 Isolate Unclassified
191 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
192 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
193 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
194 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
195 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
196 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.04
Metatranscriptomes 1.22
Isolates 2.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.15
Nodule 0
Rhizoplane 4.27
Rhizosphere 78.05
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10110935 3300005327 Bacteria 2272
2 JGI25156J39149_1000247 3300002705 Bacteria 37338
3 JGI25156J39149_1000284 3300002705 Bacteria 34180
4 JGI25156J39149_1010260 3300002705 Bacteria 2213
5 JGI25154J39366_1003100 3300002738 Bacteria 3721
6 JGI25157J39369_1000280 3300002741 Bacteria 37332
7 JGI25153J46596_10001149 3300003215 Bacteria 16015
8 rootH1_10056405 3300003316 Bacteria 2230
9 rootH1_10092908 3300003323 Bacteria 2320
10 Ga0055539_1000197 3300003752 Bacteria 49212
11 Ga0055533_1000040 3300003756 Bacteria 242927
12 Ga0055525_1000069 3300003759 Bacteria 186286
13 Ga0055525_1001543 3300003759 Bacteria 3838
14 Ga0055540_1004132 3300003792 Bacteria 6709
15 Ga0055540_1005200 3300003792 Bacteria 5569
16 Ga0055531_10001511 3300003794 Bacteria 17074
17 Ga0065165_1018665 3300005262 Bacteria 2503
18 Ga0065704_10210827 3300005289 Bacteria 1109
19 Ga0070658_10034827 3300005327 Bacteria 4052
20 Ga0070658_10058420 3300005327 Bacteria 3139
21 Ga0070658_10181997 3300005327 Bacteria 1768
22 Ga0070658_10243877 3300005327 Bacteria 1523
23 Ga0070676_10109358 3300005328 Bacteria 1719
24 Ga0070683_100105076 3300005329 Bacteria 2662
25 Ga0070670_100003799 3300005331 Bacteria 12582
26 Ga0070677_10035359 3300005333 Bacteria 1936
27 Ga0070677_10174082 3300005333 Bacteria 1020
28 Ga0068868_100036721 3300005338 Bacteria 3795
29 Ga0070660_100146744 3300005339 Bacteria 1895
30 Ga0070675_100000137 3300005354 Bacteria 44007
31 Ga0070671_100003402 3300005355 Bacteria 12409
32 Ga0070674_100066840 3300005356 Bacteria 2527
33 Ga0070674_100071362 3300005356 Bacteria 2456
34 Ga0070673_100012265 3300005364 Bacteria 5878
35 Ga0070673_100225321 3300005364 Bacteria 1624
36 Ga0070659_100022943 3300005366 Bacteria 4770
37 Ga0070659_100024138 3300005366 Bacteria 4660
38 Ga0070659_100111610 3300005366 Bacteria 2207
39 Ga0070659_100662542 3300005366 Bacteria 900
40 Ga0070667_100023821 3300005367 Bacteria 5082
41 Ga0070678_100015658 3300005456 Bacteria 4827
42 Ga0070678_100027258 3300005456 Bacteria 3878
43 Ga0068867_100000075 3300005459 Bacteria 60780
44 Ga0068867_100201455 3300005459 Bacteria 1593
45 Ga0070707_100005918 3300005468 Bacteria 11411
46 Ga0070699_100028974 3300005518 Bacteria 4773
47 Ga0068853_100091833 3300005539 Bacteria 2671
48 Ga0068853_100118763 3300005539 Bacteria 2356
49 Ga0068855_100044121 3300005563 Bacteria 5278
50 Ga0068855_100086396 3300005563 Bacteria 3627
51 Ga0068855_100719509 3300005563 Bacteria 1067
52 Ga0068855_100776787 3300005563 Bacteria 1020
53 Ga0070664_100056971 3300005564 Bacteria 3321
54 Ga0070664_100104145 3300005564 Bacteria 2471
55 Ga0068857_100008758 3300005577 Bacteria 8765
56 Ga0068854_100040660 3300005578 Bacteria 3282
57 Ga0068854_100232508 3300005578 Bacteria 1464
58 Ga0068856_100001658 3300005614 Bacteria 23333
59 Ga0068856_100065069 3300005614 Bacteria 3602
60 Ga0068856_100365443 3300005614 Bacteria 1462
61 Ga0068852_100114080 3300005616 Bacteria 2461
62 Ga0068852_100128220 3300005616 Bacteria 2333
63 Ga0068864_100327029 3300005618 Bacteria 1441
64 Ga0068870_10104718 3300005840 Bacteria 1605
65 Ga0068862_100013504 3300005844 Bacteria 6764
66 Ga0075366_10000654 3300006195 Bacteria 16309
67 Ga0075370_10070158 3300006353 Bacteria 2004
68 Ga0075370_10077055 3300006353 Bacteria 1913
69 Ga0068871_100028305 3300006358 Bacteria 4393
70 Ga0068865_100050563 3300006881 Bacteria 2872
71 Ga0068865_100074081 3300006881 Bacteria 2424
72 Ga0105244_10064625 3300009036 Bacteria 1835
73 Ga0105240_10118178 3300009093 Bacteria 3195
74 Ga0105240_10207614 3300009093 Bacteria 2291
75 Ga0105240_10217288 3300009093 Bacteria 2229
76 Ga0105243_10108883 3300009148 Bacteria 2314
77 Ga0105243_10194997 3300009148 Bacteria 1772
78 Ga0105241_10037825 3300009174 Bacteria 3636
79 Ga0105242_10079614 3300009176 Bacteria 2737
80 Ga0105237_10000942 3300009545 Bacteria 39101
81 Ga0105238_10054749 3300009551 Bacteria 4006
82 Ga0105238_10138183 3300009551 Bacteria 2414
83 Ga0105239_10022455 3300010375 Bacteria 6956
84 Ga0105239_10387441 3300010375 Bacteria 1581
85 Ga0157374_10345100 3300013296 Bacteria 1479
86 Ga0157372_10364120 3300013307 Bacteria 1685
87 Ga0157375_10316215 3300013308 Bacteria 1726
88 Ga0157375_10798456 3300013308 Bacteria 1093
89 Ga0157377_10000047 3300014745 Bacteria 94451
90 Ga0157377_10197073 3300014745 Bacteria 1276
91 Ga0157376_10188998 3300014969 Bacteria 1887
92 Ga0157376_10675615 3300014969 Bacteria 1036
93 Ga0163161_10036726 3300017792 Bacteria 3509
94 Ga0206353_10684035 3300020082 Bacteria 888
95 Ga0209674_100066 3300025226 Bacteria 256739
96 Ga0209563_100007 3300025230 Bacteria 1579402
97 Ga0209563_100129 3300025230 Bacteria 99977
98 Ga0207427_100314 3300025231 Bacteria 33014
99 Ga0209258_100419 3300025242 Bacteria 50513
100 Ga0209646_1000249 3300025246 Bacteria 54511
101 Ga0209026_1000011 3300025250 Bacteria 507291
102 Ga0209677_100157 3300025253 Bacteria 62213
103 Ga0209677_100160 3300025253 Bacteria 60301
104 Ga0209677_106685 3300025253 Bacteria 2662
105 Ga0209759_1000034 3300025256 Bacteria 271209
106 Ga0209759_1001301 3300025256 Bacteria 14759
107 Ga0209759_1037868 3300025256 Bacteria 862
108 Ga0209129_1011915 3300025258 Bacteria 2040
109 Ga0209673_1020600 3300025273 Bacteria 2332
110 Ga0209025_1000256 3300025294 Bacteria 125758
111 Ga0209758_1000262 3300025297 Bacteria 104339
112 Ga0209051_1000025 3300025303 Bacteria 415397
113 Ga0209051_1042389 3300025303 Bacteria 1609
114 Ga0209257_1000039 3300025304 Bacteria 591694
115 Ga0207682_10021073 3300025893 Bacteria 2563
116 Ga0207680_10114987 3300025903 Bacteria 1751
117 Ga0207645_10151286 3300025907 Bacteria 1515
118 Ga0207705_10018962 3300025909 Bacteria 4919
119 Ga0207705_10240758 3300025909 Bacteria 1378
120 Ga0207684_10114144 3300025910 Bacteria 2313
121 Ga0207654_10506871 3300025911 Bacteria 853
122 Ga0207707_10275650 3300025912 Bacteria 1457
123 Ga0207695_10010652 3300025913 Bacteria 11233
124 Ga0207695_10020956 3300025913 Bacteria 7470
125 Ga0207695_10077737 3300025913 Bacteria 3369
126 Ga0207671_10009182 3300025914 Bacteria 8293
127 Ga0207657_10007356 3300025919 Bacteria 11298
128 Ga0207657_10055909 3300025919 Bacteria 3407
129 Ga0207657_10105477 3300025919 Bacteria 2333
130 Ga0207657_10220356 3300025919 Bacteria 1520
131 Ga0207646_10028674 3300025922 Bacteria 5065
132 Ga0207681_10324376 3300025923 Bacteria 1225
133 Ga0207694_10053443 3300025924 Bacteria 3132
134 Ga0207694_10146696 3300025924 Bacteria 1899
135 Ga0207650_10000265 3300025925 Bacteria 55786
136 Ga0207659_10000148 3300025926 Bacteria 41151
137 Ga0207644_10001312 3300025931 Bacteria 15974
138 Ga0207690_10027230 3300025932 Bacteria 3611
139 Ga0207690_10119677 3300025932 Bacteria 1911
140 Ga0207686_10012845 3300025934 Bacteria 4615
141 Ga0207709_10000032 3300025935 Bacteria 324478
142 Ga0207709_10132263 3300025935 Bacteria 1702
143 Ga0207669_10004454 3300025937 Bacteria 6167
144 Ga0207704_10187060 3300025938 Bacteria 1503
145 Ga0207689_10383232 3300025942 Bacteria 1171
146 Ga0207661_10542396 3300025944 Bacteria 1065
147 Ga0207667_10004608 3300025949 Bacteria 16907
148 Ga0207667_10356636 3300025949 Bacteria 1491
149 Ga0207667_10658906 3300025949 Bacteria 1052
150 Ga0207651_10004257 3300025960 Bacteria 7182
151 Ga0207651_10029800 3300025960 Bacteria 3464
152 Ga0207640_10006994 3300025981 Bacteria 6208
153 Ga0207677_10012108 3300026023 Bacteria 4945
154 Ga0207639_10244766 3300026041 Bacteria 1561
155 Ga0207639_10295534 3300026041 Bacteria 1430
156 Ga0207639_10481630 3300026041 Bacteria 1131
157 Ga0207702_10006172 3300026078 Bacteria 10364
158 Ga0207702_10052916 3300026078 Bacteria 3437
159 Ga0207648_10001842 3300026089 Bacteria 23196
160 Ga0207648_10165338 3300026089 Bacteria 1955
161 Ga0207648_10283871 3300026089 Bacteria 1481
162 Ga0207676_10053335 3300026095 Bacteria 3165
163 Ga0207674_10187649 3300026116 Bacteria 2018
164 Ga0207683_10006990 3300026121 Bacteria 9675
165 Ga0207683_10020790 3300026121 Bacteria 5616
166 Ga0268265_10104113 3300028380 Bacteria 2299
167 Ga0307509_10037945 3300031507 Bacteria 5261
168 Ga0373938_0036114 3300034957 Bacteria 1080
169 Ga0373934_0034577 3300035086 Bacteria 1986
170 Ga0395899_0008017 3300037312 Bacteria 8132
171 Ga0395899_0015765 3300037312 Bacteria 5762
172 Ga0395899_0053286 3300037312 Bacteria 2995
173 Ga0395899_0068526 3300037312 Bacteria 2601
174 Ga0395899_0101162 3300037312 Bacteria 2080
175 Ga0395899_0175829 3300037312 Bacteria 1505
176 Ga0395899_0220905 3300037312 Bacteria 1312
177 Ga0395900_0000162 3300037418 Bacteria 109616
178 Ga0395900_0005338 3300037418 Bacteria 13464
179 Ga0395900_0009681 3300037418 Bacteria 9874
180 Ga0395900_0026411 3300037418 Bacteria 5945
181 Ga0395900_0072460 3300037418 Bacteria 3541
182 Ga0395900_0132257 3300037418 Bacteria 2556
183 Ga0395900_0181802 3300037418 Bacteria 2136
184 Ga0395900_0256591 3300037418 Bacteria 1747
185 Ga0395900_0293004 3300037418 Bacteria 1615
186 Ga0395898_0017962 3300037466 Bacteria 7216
187 Ga0395898_0019325 3300037466 Bacteria 6937
188 Ga0395898_0098506 3300037466 Bacteria 2807
189 Ga0395898_0185389 3300037466 Bacteria 1988
190 Ga0395898_0212437 3300037466 Bacteria 1845
191 Ga0395898_0323342 3300037466 Bacteria 1471
192 Ga0395898_0527366 3300037466 Bacteria 1122
193 Ga0395898_0674776 3300037466 Bacteria 975
194 Ga0395905_0045008 3300037471 Bacteria 4140
195 Ga0395905_0067820 3300037471 Bacteria 3341
196 Ga0395905_0138309 3300037471 Bacteria 2291
197 Ga0395905_0243877 3300037471 Bacteria 1678
198 Ga0395905_0244508 3300037471 Bacteria 1676
199 Ga0436364_0716801 3300037853 Bacteria 4139
200 Ga0395901_0000091 3300038443 Bacteria 123334
201 Ga0395901_0000672 3300038443 Bacteria 39335
202 Ga0395901_0008929 3300038443 Bacteria 10151
203 Ga0395901_0111228 3300038443 Bacteria 2876
204 Ga0436361_0158674 3300039447 Bacteria 1324
205 Ga0436361_0180834 3300039447 Bacteria 6445
206 Ga0436361_0920730 3300039447 Bacteria 3404
207 Ga0436362_0480677 3300039453 Bacteria 1689
208 Ga0439450_052893 3300042008 Bacteria 968
209 Ga0450914_002382 3300042118 Bacteria 1335
210 Ga0466972_0031576 3300044658 Bacteria 2603
211 Ga0466965_0098336 3300044683 Bacteria 1494
212 Ga0466965_0180127 3300044683 Bacteria 1114
213 Ga0466966_0024669 3300044684 Bacteria 3932
214 Ga0466966_0026882 3300044684 Bacteria 3753
215 Ga0466966_0142082 3300044684 Bacteria 1466
216 Ga0466966_0238582 3300044684 Bacteria 1096
217 Ga0466963_0119450 3300044694 Bacteria 1813
218 Ga0466964_0001120 3300044706 Bacteria 9011
219 Ga0453684_0016137 3300044712 Bacteria 11715
220 Ga0453684_0027927 3300044712 Bacteria 8072
221 Ga0453684_0157657 3300044712 Bacteria 2689
222 Ga0453684_0167618 3300044712 Bacteria 2592
223 Ga0466968_0029967 3300044735 Bacteria 2252
224 Ga0466970_0105455 3300044765 Bacteria 1537
225 Ga0466957_0000335 3300044842 Bacteria 22997
226 Ga0466957_0262879 3300044842 Bacteria 1150
227 Ga0466959_0018579 3300045049 Bacteria 5105
228 Ga0466959_0097834 3300045049 Bacteria 2102
229 Ga0466959_0430209 3300045049 Bacteria 895
230 Ga0451576_0089439 3300045051 Bacteria 3202
231 Ga0451576_0301797 3300045051 Bacteria 1675
232 Ga0451576_0676744 3300045051 Bacteria 1084
233 Ga0466958_0080541 3300045836 Bacteria 2003
234 Ga0466958_0186578 3300045836 Bacteria 1317
235 Ga0495605_0000051 3300046474 Bacteria 163067
236 Ga0495584_0000058 3300046491 Bacteria 81148
237 Ga0495584_0102055 3300046491 Bacteria 1450
238 Ga0495607_0000485 3300046501 Bacteria 39753
239 Ga0495607_0040862 3300046501 Bacteria 2757
240 Ga0495606_0012547 3300046507 Bacteria 6787
241 Ga0495616_0000492 3300046513 Bacteria 30078
242 Ga0495616_0029056 3300046513 Bacteria 2922
243 Ga0495616_0044265 3300046513 Bacteria 2258
244 Ga0495643_0017605 3300046522 Bacteria 4172
245 Ga0495643_0049522 3300046522 Bacteria 2265
246 Ga0495643_0069936 3300046522 Bacteria 1844
247 Ga0495643_0078547 3300046522 Bacteria 1722
248 Ga0495648_0037086 3300046524 Bacteria 3137
249 Ga0495663_0005033 3300046525 Bacteria 3692
250 Ga0495642_0002150 3300046528 Bacteria 8124
251 Ga0495609_0000019 3300046538 Bacteria 297777
252 Ga0495621_0082019 3300046539 Bacteria 1204
253 Ga0495597_0064950 3300046542 Bacteria 1584
254 Ga0495645_0216793 3300046543 Bacteria 1289
255 Ga0495656_0006473 3300046615 Bacteria 4112
256 Ga0495661_0000012 3300046665 Bacteria 276804
257 Ga0495661_0000362 3300046665 Bacteria 49179
258 Ga0495661_0043919 3300046665 Bacteria 2743
259 Ga0495661_0049183 3300046665 Bacteria 2557
260 Ga0495661_0074606 3300046665 Bacteria 1973
261 Ga0495588_0000050 3300046674 Bacteria 335314
262 Ga0495589_0000007 3300046794 Bacteria 276444
263 Ga0495589_0054624 3300046794 Bacteria 1969
264 Ga0495660_0000100 3300046810 Bacteria 92354
265 Ga0495660_0036091 3300046810 Bacteria 2758
266 Ga0495636_0107873 3300047318 Bacteria 1223
267 Ga0495672_0031889 3300047320 Bacteria 3285
268 Ga0495683_0055833 3300047323 Bacteria 1965
269 Ga0495687_000003 3300047443 Bacteria 859509
270 Ga0495687_000016 3300047443 Bacteria 359237
271 Ga0495687_000028 3300047443 Bacteria 293356
272 Ga0495677_0000005 3300047445 Bacteria 243336
273 Ga0495677_0034068 3300047445 Bacteria 1857
274 Ga0495686_0009768 3300047472 Bacteria 6886
275 Ga0495686_0130171 3300047472 Bacteria 1493
276 Ga0495615_0001687 3300048090 Bacteria 3353
277 Ga0495626_0000322 3300048091 Bacteria 50407
278 Ga0495626_0006531 3300048091 Bacteria 6624
279 Ga0496100_0084488 3300048903 Bacteria 2152
280 Ga0496101_0112057 3300048904 Bacteria 2055
281 Ga0496102_0397767 3300048905 Bacteria 1295
282 Ga0496102_0674843 3300048905 Bacteria 956
283 Ga0496104_0211460 3300048907 Bacteria 1851
284 Ga0496105_0211127 3300048908 Bacteria 1582
285 Ga0496106_0099828 3300048909 Bacteria 2250
286 Ga0496110_0570032 3300048913 Bacteria 1028
287 Ga0496110_0782211 3300048913 Bacteria 858
288 Ga0496112_0209445 3300048915 Bacteria 1907
289 Ga0496112_0211224 3300048915 Bacteria 1898
290 Ga0496113_0001305 3300048916 Bacteria 13776
291 Ga0496113_0005484 3300048916 Bacteria 7916
292 Ga0496114_0295745 3300048917 Bacteria 1429
293 Ga0496122_0000971 3300048925 Bacteria 51480
294 Ga0496122_0027754 3300048925 Bacteria 4828
295 Ga0496122_0132583 3300048925 Bacteria 1579
296 Ga0496123_0000786 3300048926 Bacteria 51250
297 Ga0496123_0005021 3300048926 Bacteria 13544
298 Ga0496124_0048831 3300048927 Bacteria 3613
299 Ga0496124_0218788 3300048927 Bacteria 1434
300 Ga0496125_0007001 3300048928 Bacteria 12068
301 Ga0496125_0039693 3300048928 Bacteria 4049
302 Ga0496125_0327463 3300048928 Bacteria 925
303 Ga0501315_000332 3300049531 Bacteria 3103
304 Ga0501317_001936 3300049533 Bacteria 1881
305 Ga0501321_002710 3300049537 Bacteria 1561
306 Ga0501031_0301840 3300049568 Bacteria 1038
307 Ga0501041_0155504 3300049577 Bacteria 1429
308 Ga0501042_0255692 3300049578 Bacteria 1264
309 Ga0501073_0482625 3300049589 Bacteria 857
310 Ga0501076_0104812 3300049592 Unclassified 2282
311 Ga0501035_0008678 3300049822 Bacteria 9461
312 Ga0501044_0281862 3300049823 Bacteria 1595
313 Ga0501044_0639934 3300049823 Bacteria 953
314 Ga0501045_0003177 3300049824 Bacteria 11231
315 nmdc:mga0k408_111129_c1 3300050493 Bacteria 1620
316 nmdc:mga0k408_8467_c1 3300050493 Bacteria 5524
317 nmdc:mga07m45_57709_c1 3300050496 Bacteria 2195
318 nmdc:mga08y16_411755_c1 3300050511 Bacteria 1382
319 Ga0466962_0111425 3300061719 Bacteria 1317
320 2548498866 2547132374 Bacteria 5530232
321 2644648327 2643221717 Bacteria 5676132
322 2722885187 2721755523 Bacteria 6430384
323 2839141830 2839138175 Bacteria 6549354
324 2904547453 2904541872 Bacteria 8915136
325 2929165045 2929160207 Bacteria 9075316
326 2932423844 2932422444 Bacteria 4678430
327 2954768664 2954767861 Bacteria 5535784
328 8047677565 8047673197 Bacteria 7395230
329 Ga0070658_10110935
330 JGI25156J39149_1000247
331 JGI25156J39149_1000284
332 JGI25156J39149_1010260
333 JGI25154J39366_1003100
334 JGI25157J39369_1000280
335 JGI25153J46596_10001149
336 rootH1_10056405
337 rootH1_10092908
338 Ga0055539_1000197
339 Ga0055533_1000040
340 Ga0055525_1000069
341 Ga0055525_1001543
342 Ga0055540_1004132
343 Ga0055540_1005200
344 Ga0055531_10001511
345 Ga0065165_1018665
346 Ga0065704_10210827
347 Ga0070658_10034827
348 Ga0070658_10058420
349 Ga0070658_10181997
350 Ga0070658_10243877
351 Ga0070676_10109358
352 Ga0070683_100105076
353 Ga0070670_100003799
354 Ga0070677_10035359
355 Ga0070677_10174082
356 Ga0068868_100036721
357 Ga0070660_100146744
358 Ga0070675_100000137
359 Ga0070671_100003402
360 Ga0070674_100066840
361 Ga0070674_100071362
362 Ga0070673_100012265
363 Ga0070673_100225321
364 Ga0070659_100022943
365 Ga0070659_100024138
366 Ga0070659_100111610
367 Ga0070659_100662542
368 Ga0070667_100023821
369 Ga0070678_100015658
370 Ga0070678_100027258
371 Ga0068867_100000075
372 Ga0068867_100201455
373 Ga0070707_100005918
374 Ga0070699_100028974
375 Ga0068853_100091833
376 Ga0068853_100118763
377 Ga0068855_100044121
378 Ga0068855_100086396
379 Ga0068855_100719509
380 Ga0068855_100776787
381 Ga0070664_100056971
382 Ga0070664_100104145
383 Ga0068857_100008758
384 Ga0068854_100040660
385 Ga0068854_100232508
386 Ga0068856_100001658
387 Ga0068856_100065069
388 Ga0068856_100365443
389 Ga0068852_100114080
390 Ga0068852_100128220
391 Ga0068864_100327029
392 Ga0068870_10104718
393 Ga0068862_100013504
394 Ga0075366_10000654
395 Ga0075370_10070158
396 Ga0075370_10077055
397 Ga0068871_100028305
398 Ga0068865_100050563
399 Ga0068865_100074081
400 Ga0105244_10064625
401 Ga0105240_10118178
402 Ga0105240_10207614
403 Ga0105240_10217288
404 Ga0105243_10108883
405 Ga0105243_10194997
406 Ga0105241_10037825
407 Ga0105242_10079614
408 Ga0105237_10000942
409 Ga0105238_10054749
410 Ga0105238_10138183
411 Ga0105239_10022455
412 Ga0105239_10387441
413 Ga0157374_10345100
414 Ga0157372_10364120
415 Ga0157375_10316215
416 Ga0157375_10798456
417 Ga0157377_10000047
418 Ga0157377_10197073
419 Ga0157376_10188998
420 Ga0157376_10675615
421 Ga0163161_10036726
422 Ga0206353_10684035
423 Ga0209674_100066
424 Ga0209563_100007
425 Ga0209563_100129
426 Ga0207427_100314
427 Ga0209258_100419
428 Ga0209646_1000249
429 Ga0209026_1000011
430 Ga0209677_100157
431 Ga0209677_100160
432 Ga0209677_106685
433 Ga0209759_1000034
434 Ga0209759_1001301
435 Ga0209759_1037868
436 Ga0209129_1011915
437 Ga0209673_1020600
438 Ga0209025_1000256
439 Ga0209758_1000262
440 Ga0209051_1000025
441 Ga0209051_1042389
442 Ga0209257_1000039
443 Ga0207682_10021073
444 Ga0207680_10114987
445 Ga0207645_10151286
446 Ga0207705_10018962
447 Ga0207705_10240758
448 Ga0207684_10114144
449 Ga0207654_10506871
450 Ga0207707_10275650
451 Ga0207695_10010652
452 Ga0207695_10020956
453 Ga0207695_10077737
454 Ga0207671_10009182
455 Ga0207657_10007356
456 Ga0207657_10055909
457 Ga0207657_10105477
458 Ga0207657_10220356
459 Ga0207646_10028674
460 Ga0207681_10324376
461 Ga0207694_10053443
462 Ga0207694_10146696
463 Ga0207650_10000265
464 Ga0207659_10000148
465 Ga0207644_10001312
466 Ga0207690_10027230
467 Ga0207690_10119677
468 Ga0207686_10012845
469 Ga0207709_10000032
470 Ga0207709_10132263
471 Ga0207669_10004454
472 Ga0207704_10187060
473 Ga0207689_10383232
474 Ga0207661_10542396
475 Ga0207667_10004608
476 Ga0207667_10356636
477 Ga0207667_10658906
478 Ga0207651_10004257
479 Ga0207651_10029800
480 Ga0207640_10006994
481 Ga0207677_10012108
482 Ga0207639_10244766
483 Ga0207639_10295534
484 Ga0207639_10481630
485 Ga0207702_10006172
486 Ga0207702_10052916
487 Ga0207648_10001842
488 Ga0207648_10165338
489 Ga0207648_10283871
490 Ga0207676_10053335
491 Ga0207674_10187649
492 Ga0207683_10006990
493 Ga0207683_10020790
494 Ga0268265_10104113
495 Ga0307509_10037945
496 Ga0373938_0036114
497 Ga0373934_0034577
498 Ga0395899_0008017
499 Ga0395899_0015765
500 Ga0395899_0053286
501 Ga0395899_0068526
502 Ga0395899_0101162
503 Ga0395899_0175829
504 Ga0395899_0220905
505 Ga0395900_0000162
506 Ga0395900_0005338
507 Ga0395900_0009681
508 Ga0395900_0026411
509 Ga0395900_0072460
510 Ga0395900_0132257
511 Ga0395900_0181802
512 Ga0395900_0256591
513 Ga0395900_0293004
514 Ga0395898_0017962
515 Ga0395898_0019325
516 Ga0395898_0098506
517 Ga0395898_0185389
518 Ga0395898_0212437
519 Ga0395898_0323342
520 Ga0395898_0527366
521 Ga0395898_0674776
522 Ga0395905_0045008
523 Ga0395905_0067820
524 Ga0395905_0138309
525 Ga0395905_0243877
526 Ga0395905_0244508
527 Ga0436364_0716801
528 Ga0395901_0000091
529 Ga0395901_0000672
530 Ga0395901_0008929
531 Ga0395901_0111228
532 Ga0436361_0158674
533 Ga0436361_0180834
534 Ga0436361_0920730
535 Ga0436362_0480677
536 Ga0439450_052893
537 Ga0450914_002382
538 Ga0466972_0031576
539 Ga0466965_0098336
540 Ga0466965_0180127
541 Ga0466966_0024669
542 Ga0466966_0026882
543 Ga0466966_0142082
544 Ga0466966_0238582
545 Ga0466963_0119450
546 Ga0466964_0001120
547 Ga0453684_0016137
548 Ga0453684_0027927
549 Ga0453684_0157657
550 Ga0453684_0167618
551 Ga0466968_0029967
552 Ga0466970_0105455
553 Ga0466957_0000335
554 Ga0466957_0262879
555 Ga0466959_0018579
556 Ga0466959_0097834
557 Ga0466959_0430209
558 Ga0451576_0089439
559 Ga0451576_0301797
560 Ga0451576_0676744
561 Ga0466958_0080541
562 Ga0466958_0186578
563 Ga0495605_0000051
564 Ga0495584_0000058
565 Ga0495584_0102055
566 Ga0495607_0000485
567 Ga0495607_0040862
568 Ga0495606_0012547
569 Ga0495616_0000492
570 Ga0495616_0029056
571 Ga0495616_0044265
572 Ga0495643_0017605
573 Ga0495643_0049522
574 Ga0495643_0069936
575 Ga0495643_0078547
576 Ga0495648_0037086
577 Ga0495663_0005033
578 Ga0495642_0002150
579 Ga0495609_0000019
580 Ga0495621_0082019
581 Ga0495597_0064950
582 Ga0495645_0216793
583 Ga0495656_0006473
584 Ga0495661_0000012
585 Ga0495661_0000362
586 Ga0495661_0043919
587 Ga0495661_0049183
588 Ga0495661_0074606
589 Ga0495588_0000050
590 Ga0495589_0000007
591 Ga0495589_0054624
592 Ga0495660_0000100
593 Ga0495660_0036091
594 Ga0495636_0107873
595 Ga0495672_0031889
596 Ga0495683_0055833
597 Ga0495687_000003
598 Ga0495687_000016
599 Ga0495687_000028
600 Ga0495677_0000005
601 Ga0495677_0034068
602 Ga0495686_0009768
603 Ga0495686_0130171
604 Ga0495615_0001687
605 Ga0495626_0000322
606 Ga0495626_0006531
607 Ga0496100_0084488
608 Ga0496101_0112057
609 Ga0496102_0397767
610 Ga0496102_0674843
611 Ga0496104_0211460
612 Ga0496105_0211127
613 Ga0496106_0099828
614 Ga0496110_0570032
615 Ga0496110_0782211
616 Ga0496112_0209445
617 Ga0496112_0211224
618 Ga0496113_0001305
619 Ga0496113_0005484
620 Ga0496114_0295745
621 Ga0496122_0000971
622 Ga0496122_0027754
623 Ga0496122_0132583
624 Ga0496123_0000786
625 Ga0496123_0005021
626 Ga0496124_0048831
627 Ga0496124_0218788
628 Ga0496125_0007001
629 Ga0496125_0039693
630 Ga0496125_0327463
631 Ga0501315_000332
632 Ga0501317_001936
633 Ga0501321_002710
634 Ga0501031_0301840
635 Ga0501041_0155504
636 Ga0501042_0255692
637 Ga0501073_0482625
638 Ga0501076_0104812
639 Ga0501035_0008678
640 Ga0501044_0281862
641 Ga0501044_0639934
642 Ga0501045_0003177
643 nmdc:mga0k408_111129_c1
644 nmdc:mga0k408_8467_c1
645 nmdc:mga07m45_57709_c1
646 nmdc:mga08y16_411755_c1
647 Ga0466962_0111425
648 2548498866
649 2644648327
650 2722885187
651 2839141830
652 2904547453
653 2929165045
654 2932423844
655 2954768664
656 8047677565

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

41

277

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ngf-assembly1.cif.gz_A crystal structure of ap endonuclease, family 2 from brucella melitensis 0.9628 1 256
1k77-assembly1.cif.gz_A crystal structure of ec1530, a putative oxygenase from escherichia coli 0.9603 1 258
1k77-assembly1.cif.gz_A crystal structure of ec1530, a putative oxygenase from escherichia coli 0.9531 1 258
3ngf-assembly1.cif.gz_A crystal structure of ap endonuclease, family 2 from brucella melitensis 0.9483 1 256
4hhm-assembly1.cif.gz_A crystal structure of a mutant, g219a, of glucose isomerase from streptomyces sp. sk 0.8376 2 256
ID Description Score Start End Superfamily
af_P30147_1_258_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9749 1 257 3.20.20.150
af_P30147_1_258_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9675 1 257 3.20.20.150
1k77A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9588 2 258 3.20.20.150
af_Q7T3H9_4_269_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9544 3 258 3.20.20.150
af_Q11185_2_259_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9487 1 257 3.20.20.150
ID Description Score Start End GO Terms
AF-M1SGA4-F1-model_v4 Hydroxypyruvate isomerase 0.9929 1 183 GO:0008903
GO:0046487
AF-A0A4V2A6E6-F1-model_v4 deleted 0.9911 1 205
AF-A0A6B2X0S1-F1-model_v4 deleted 0.99 19 154
AF-A0A3N5YJ07-F1-model_v4 Hydroxypyruvate isomerase 0.9898 1 184 GO:0008903
GO:0046487
AF-X1GH88-F1-model_v4 Xylose isomerase-like TIM barrel domain-containing protein 0.9887 1 159 GO:0008903
GO:0046487

Map