F409084
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 328 | 166 | 328 | 316 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_10116997|Ga0070658_101169972 |
| Length | 326 |
| Sequence | MIILVALLAMMALGGVAFAFAGGDERTQKRVSALAKSKPNARNAAARMQSEAAQKRKSVATLLKDVEKNQAAMRARNKPTLRRRLEQAGFEDDDSVRKFWIASGVLGLVTALICLLTGQPILVVGLAAFVTAFGLPRWVLSFLFARRKKRFTKEFAGAIDVIVRSVRSGLPTNEALRIVARETPDPVGSEFTRLTDGLKVGVTLEQGLKKMHENMPTAEVGFFGIVMTIQAKSGGNLSEALSNLAAVLRDRKRLEGKIKAMSSEAKASAMIIGSLPPAVAGIVWLTTPAYINLLFSEKMGNLLLGGCAIWTGTGIFVMRKMINFKH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 43 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 44 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 45 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 110 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 111 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 112 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 113 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 114 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 115 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 116 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 117 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 118 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 119 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 120 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 121 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 122 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 123 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 124 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 125 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 126 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 127 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 128 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 129 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 130 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 131 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 132 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 133 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 134 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 148 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 149 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 153 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 154 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 164 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 165 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 166 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.35 |
| Nodule | 0 |
| Rhizoplane | 0.3 |
| Rhizosphere | 93.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1000080 | 3300003214 | Bacteria | 176649 |
| 2 | rootH2_10000706 | 3300003320 | Bacteria | 22047 |
| 3 | rootH2_10026210 | 3300003320 | Bacteria | 1353 |
| 4 | Ga0070658_10014729 | 3300005327 | Bacteria | 6271 |
| 5 | Ga0070658_10061267 | 3300005327 | Bacteria | 3065 |
| 6 | Ga0070658_10116997 | 3300005327 | Bacteria | 2213 |
| 7 | Ga0070683_100323471 | 3300005329 | Bacteria | 1468 |
| 8 | Ga0070690_100382934 | 3300005330 | Bacteria | 1029 |
| 9 | Ga0070670_100257921 | 3300005331 | Bacteria | 1519 |
| 10 | Ga0068869_100011842 | 3300005334 | Bacteria | 5737 |
| 11 | Ga0070666_10000793 | 3300005335 | Bacteria | 19164 |
| 12 | Ga0070666_10085614 | 3300005335 | Unclassified | 2159 |
| 13 | Ga0070680_100054857 | 3300005336 | Bacteria | 3255 |
| 14 | Ga0068868_100094285 | 3300005338 | Bacteria | 2414 |
| 15 | Ga0068868_100122579 | 3300005338 | Bacteria | 2121 |
| 16 | Ga0070660_100003852 | 3300005339 | Bacteria | 10363 |
| 17 | Ga0070691_10001501 | 3300005341 | Bacteria | 10014 |
| 18 | Ga0070691_10003126 | 3300005341 | Bacteria | 7417 |
| 19 | Ga0070661_100193444 | 3300005344 | Unclassified | 1552 |
| 20 | Ga0070671_100215953 | 3300005355 | Bacteria | 1627 |
| 21 | Ga0070673_100011937 | 3300005364 | Bacteria | 5947 |
| 22 | Ga0070659_100023192 | 3300005366 | Bacteria | 4746 |
| 23 | Ga0070667_100015457 | 3300005367 | Bacteria | 6312 |
| 24 | Ga0070709_10002917 | 3300005434 | Bacteria | 9222 |
| 25 | Ga0070714_100082431 | 3300005435 | Bacteria | 2802 |
| 26 | Ga0070714_100310225 | 3300005435 | Bacteria | 1473 |
| 27 | Ga0070713_100000006 | 3300005436 | Bacteria | 190565 |
| 28 | Ga0070701_10115085 | 3300005438 | Bacteria | 1508 |
| 29 | Ga0070711_100026563 | 3300005439 | Bacteria | 3794 |
| 30 | Ga0070711_100123341 | 3300005439 | Bacteria | 1919 |
| 31 | Ga0070711_100186250 | 3300005439 | Bacteria | 1592 |
| 32 | Ga0070705_100163615 | 3300005440 | Bacteria | 1490 |
| 33 | Ga0070678_100001382 | 3300005456 | Bacteria | 12937 |
| 34 | Ga0070681_10081181 | 3300005458 | Bacteria | 3199 |
| 35 | Ga0070681_10087651 | 3300005458 | Bacteria | 3065 |
| 36 | Ga0068867_100010139 | 3300005459 | Bacteria | 6644 |
| 37 | Ga0068867_100058953 | 3300005459 | Bacteria | 2845 |
| 38 | Ga0070679_100042833 | 3300005530 | Bacteria | 4509 |
| 39 | Ga0070679_100060027 | 3300005530 | Bacteria | 3790 |
| 40 | Ga0070679_100078471 | 3300005530 | Bacteria | 3291 |
| 41 | Ga0070684_100047353 | 3300005535 | Bacteria | 3726 |
| 42 | Ga0068853_100086897 | 3300005539 | Bacteria | 2743 |
| 43 | Ga0068853_100110356 | 3300005539 | Bacteria | 2443 |
| 44 | Ga0068853_100180004 | 3300005539 | Bacteria | 1917 |
| 45 | Ga0070693_100118662 | 3300005547 | Bacteria | 1638 |
| 46 | Ga0070665_100002423 | 3300005548 | Bacteria | 20562 |
| 47 | Ga0070665_100008064 | 3300005548 | Bacteria | 10661 |
| 48 | Ga0070665_100031215 | 3300005548 | Bacteria | 5363 |
| 49 | Ga0070665_100103996 | 3300005548 | Bacteria | 2842 |
| 50 | Ga0070665_100109077 | 3300005548 | Bacteria | 2770 |
| 51 | Ga0070665_100301931 | 3300005548 | Bacteria | 1604 |
| 52 | Ga0070665_100384611 | 3300005548 | Bacteria | 1411 |
| 53 | Ga0068855_100000529 | 3300005563 | Bacteria | 46748 |
| 54 | Ga0068855_100004964 | 3300005563 | Bacteria | 16229 |
| 55 | Ga0068855_100014947 | 3300005563 | Bacteria | 9352 |
| 56 | Ga0068855_100123784 | 3300005563 | Bacteria | 2958 |
| 57 | Ga0068855_100347492 | 3300005563 | Bacteria | 1634 |
| 58 | Ga0068857_100000387 | 3300005577 | Bacteria | 30877 |
| 59 | Ga0068857_100100720 | 3300005577 | Bacteria | 2592 |
| 60 | Ga0068857_100211750 | 3300005577 | Bacteria | 1769 |
| 61 | Ga0068856_100000280 | 3300005614 | Bacteria | 55488 |
| 62 | Ga0068856_100066445 | 3300005614 | Bacteria | 3563 |
| 63 | Ga0068856_100076260 | 3300005614 | Bacteria | 3322 |
| 64 | Ga0068856_100165931 | 3300005614 | Bacteria | 2219 |
| 65 | Ga0068856_100358953 | 3300005614 | Bacteria | 1476 |
| 66 | Ga0068856_100446338 | 3300005614 | Bacteria | 1314 |
| 67 | Ga0068852_100013727 | 3300005616 | Bacteria | 6209 |
| 68 | Ga0068852_100225825 | 3300005616 | Bacteria | 1783 |
| 69 | Ga0068864_100105179 | 3300005618 | Bacteria | 2508 |
| 70 | Ga0068866_10042862 | 3300005718 | Bacteria | 2255 |
| 71 | Ga0068866_10078609 | 3300005718 | Bacteria | 1765 |
| 72 | Ga0068858_100072648 | 3300005842 | Bacteria | 3192 |
| 73 | Ga0070716_100020933 | 3300006173 | Bacteria | 3441 |
| 74 | Ga0070712_100000184 | 3300006175 | Bacteria | 34651 |
| 75 | Ga0070712_100000907 | 3300006175 | Bacteria | 17736 |
| 76 | Ga0097621_100028078 | 3300006237 | Bacteria | 4432 |
| 77 | Ga0097621_100194799 | 3300006237 | Bacteria | 1757 |
| 78 | Ga0097621_100209176 | 3300006237 | Bacteria | 1697 |
| 79 | Ga0068871_100000875 | 3300006358 | Bacteria | 20076 |
| 80 | Ga0068871_100100018 | 3300006358 | Bacteria | 2428 |
| 81 | Ga0068871_100221982 | 3300006358 | Bacteria | 1637 |
| 82 | Ga0068871_100229513 | 3300006358 | Bacteria | 1611 |
| 83 | Ga0075434_100213709 | 3300006871 | Bacteria | 1949 |
| 84 | Ga0068865_100003481 | 3300006881 | Bacteria | 9434 |
| 85 | Ga0068865_100103647 | 3300006881 | Bacteria | 2087 |
| 86 | Ga0075436_100001960 | 3300006914 | Bacteria | 14189 |
| 87 | Ga0075436_100035786 | 3300006914 | Bacteria | 3425 |
| 88 | Ga0075436_100038227 | 3300006914 | Bacteria | 3312 |
| 89 | Ga0105240_10000055 | 3300009093 | Bacteria | 225380 |
| 90 | Ga0105240_10006323 | 3300009093 | Bacteria | 17434 |
| 91 | Ga0105240_10006992 | 3300009093 | Bacteria | 16479 |
| 92 | Ga0105240_10011873 | 3300009093 | Bacteria | 12086 |
| 93 | Ga0105240_10017901 | 3300009093 | Bacteria | 9531 |
| 94 | Ga0105240_10153135 | 3300009093 | Bacteria | 2744 |
| 95 | Ga0105240_10368989 | 3300009093 | Bacteria | 1624 |
| 96 | Ga0105240_10542971 | 3300009093 | Bacteria | 1287 |
| 97 | Ga0105245_10223986 | 3300009098 | Bacteria | 1816 |
| 98 | Ga0105243_10022693 | 3300009148 | Bacteria | 4773 |
| 99 | Ga0105241_10029880 | 3300009174 | Bacteria | 4069 |
| 100 | Ga0105241_10042687 | 3300009174 | Bacteria | 3433 |
| 101 | Ga0105241_10090352 | 3300009174 | Bacteria | 2415 |
| 102 | Ga0105241_10144122 | 3300009174 | Bacteria | 1943 |
| 103 | Ga0105241_10165225 | 3300009174 | Bacteria | 1823 |
| 104 | Ga0105241_10177822 | 3300009174 | Bacteria | 1762 |
| 105 | Ga0105241_10436113 | 3300009174 | Bacteria | 1156 |
| 106 | Ga0105242_10004849 | 3300009176 | Bacteria | 10417 |
| 107 | Ga0105242_10144201 | 3300009176 | Bacteria | 2070 |
| 108 | Ga0105242_10368405 | 3300009176 | Bacteria | 1332 |
| 109 | Ga0105248_10000001 | 3300009177 | Bacteria | 1881304 |
| 110 | Ga0105248_10368527 | 3300009177 | Bacteria | 1617 |
| 111 | Ga0105248_10390949 | 3300009177 | Bacteria | 1566 |
| 112 | Ga0105237_10031638 | 3300009545 | Bacteria | 5359 |
| 113 | Ga0105237_10038550 | 3300009545 | Bacteria | 4826 |
| 114 | Ga0105237_10054437 | 3300009545 | Bacteria | 4009 |
| 115 | Ga0105237_10057417 | 3300009545 | Bacteria | 3895 |
| 116 | Ga0105237_10074265 | 3300009545 | Bacteria | 3392 |
| 117 | Ga0105237_10344293 | 3300009545 | Bacteria | 1495 |
| 118 | Ga0105237_10518650 | 3300009545 | Bacteria | 1198 |
| 119 | Ga0105238_10001657 | 3300009551 | Bacteria | 22360 |
| 120 | Ga0105238_10025837 | 3300009551 | Bacteria | 5987 |
| 121 | Ga0105238_10028464 | 3300009551 | Bacteria | 5693 |
| 122 | Ga0105238_10033742 | 3300009551 | Bacteria | 5208 |
| 123 | Ga0105238_10069037 | 3300009551 | Bacteria | 3535 |
| 124 | Ga0105238_10231794 | 3300009551 | Bacteria | 1823 |
| 125 | Ga0105239_10001057 | 3300010375 | Bacteria | 38270 |
| 126 | Ga0105239_10186830 | 3300010375 | Bacteria | 2319 |
| 127 | Ga0105239_10232472 | 3300010375 | Bacteria | 2068 |
| 128 | Ga0105239_10256636 | 3300010375 | Bacteria | 1964 |
| 129 | Ga0105239_10330199 | 3300010375 | Bacteria | 1720 |
| 130 | Ga0105246_10010785 | 3300011119 | Bacteria | 5665 |
| 131 | Ga0157373_10094036 | 3300013100 | Bacteria | 2111 |
| 132 | Ga0157370_10000438 | 3300013104 | Bacteria | 51999 |
| 133 | Ga0157370_10001892 | 3300013104 | Bacteria | 25765 |
| 134 | Ga0157370_10232759 | 3300013104 | Bacteria | 1705 |
| 135 | Ga0157369_10003278 | 3300013105 | Bacteria | 19270 |
| 136 | Ga0157369_10016326 | 3300013105 | Bacteria | 8356 |
| 137 | Ga0157369_10169898 | 3300013105 | Bacteria | 2298 |
| 138 | Ga0157374_10023596 | 3300013296 | Bacteria | 5504 |
| 139 | Ga0157374_10103175 | 3300013296 | Bacteria | 2736 |
| 140 | Ga0157378_10132861 | 3300013297 | Bacteria | 2305 |
| 141 | Ga0163162_10002450 | 3300013306 | Bacteria | 17500 |
| 142 | Ga0163162_10207319 | 3300013306 | Bacteria | 2089 |
| 143 | Ga0157372_10006484 | 3300013307 | Bacteria | 12452 |
| 144 | Ga0163163_10000021 | 3300014325 | Bacteria | 191799 |
| 145 | Ga0163163_10181879 | 3300014325 | Bacteria | 2150 |
| 146 | Ga0157379_10002828 | 3300014968 | Bacteria | 14629 |
| 147 | Ga0157379_10015015 | 3300014968 | Bacteria | 6794 |
| 148 | Ga0157379_10046138 | 3300014968 | Bacteria | 3889 |
| 149 | Ga0157379_10088366 | 3300014968 | Bacteria | 2779 |
| 150 | Ga0157379_10165405 | 3300014968 | Bacteria | 1996 |
| 151 | Ga0157376_10011691 | 3300014969 | Bacteria | 6480 |
| 152 | Ga0157376_10269547 | 3300014969 | Unclassified | 1599 |
| 153 | Ga0163161_10107385 | 3300017792 | Bacteria | 2083 |
| 154 | Ga0207427_105555 | 3300025231 | Bacteria | 1755 |
| 155 | Ga0209233_1000006 | 3300025261 | Bacteria | 1473685 |
| 156 | Ga0209233_1001131 | 3300025261 | Bacteria | 10884 |
| 157 | Ga0209455_1009713 | 3300025272 | Bacteria | 2505 |
| 158 | Ga0209758_1000008 | 3300025297 | Bacteria | 1215263 |
| 159 | Ga0207642_10004601 | 3300025899 | Bacteria | 4456 |
| 160 | Ga0207642_10020904 | 3300025899 | Bacteria | 2566 |
| 161 | Ga0207680_10000273 | 3300025903 | Bacteria | 24719 |
| 162 | Ga0207680_10059059 | 3300025903 | Bacteria | 2328 |
| 163 | Ga0207645_10052043 | 3300025907 | Bacteria | 2616 |
| 164 | Ga0207643_10029726 | 3300025908 | Bacteria | 3040 |
| 165 | Ga0207705_10000039 | 3300025909 | Bacteria | 193592 |
| 166 | Ga0207705_10036009 | 3300025909 | Bacteria | 3543 |
| 167 | Ga0207654_10037377 | 3300025911 | Bacteria | 2718 |
| 168 | Ga0207654_10044648 | 3300025911 | Bacteria | 2518 |
| 169 | Ga0207654_10070047 | 3300025911 | Bacteria | 2081 |
| 170 | Ga0207707_10000769 | 3300025912 | Bacteria | 31536 |
| 171 | Ga0207707_10042360 | 3300025912 | Bacteria | 3974 |
| 172 | Ga0207695_10000012 | 3300025913 | Bacteria | 840961 |
| 173 | Ga0207695_10002080 | 3300025913 | Bacteria | 30492 |
| 174 | Ga0207695_10009572 | 3300025913 | Bacteria | 11974 |
| 175 | Ga0207695_10012896 | 3300025913 | Bacteria | 10003 |
| 176 | Ga0207695_10028476 | 3300025913 | Bacteria | 6195 |
| 177 | Ga0207695_10109966 | 3300025913 | Bacteria | 2737 |
| 178 | Ga0207671_10004743 | 3300025914 | Bacteria | 12828 |
| 179 | Ga0207671_10021912 | 3300025914 | Bacteria | 4840 |
| 180 | Ga0207671_10222771 | 3300025914 | Bacteria | 1478 |
| 181 | Ga0207693_10000127 | 3300025915 | Bacteria | 68379 |
| 182 | Ga0207663_10015741 | 3300025916 | Bacteria | 4181 |
| 183 | Ga0207660_10125599 | 3300025917 | Bacteria | 1948 |
| 184 | Ga0207657_10000635 | 3300025919 | Bacteria | 37241 |
| 185 | Ga0207657_10036878 | 3300025919 | Bacteria | 4373 |
| 186 | Ga0207657_10087044 | 3300025919 | Bacteria | 2614 |
| 187 | Ga0207649_10095022 | 3300025920 | Bacteria | 1960 |
| 188 | Ga0207649_10328419 | 3300025920 | Bacteria | 1126 |
| 189 | Ga0207649_10345577 | 3300025920 | Bacteria | 1100 |
| 190 | Ga0207652_10000646 | 3300025921 | Bacteria | 34342 |
| 191 | Ga0207652_10098169 | 3300025921 | Bacteria | 2583 |
| 192 | Ga0207652_10161251 | 3300025921 | Unclassified | 2010 |
| 193 | Ga0207694_10000006 | 3300025924 | Bacteria | 631109 |
| 194 | Ga0207694_10030929 | 3300025924 | Bacteria | 4088 |
| 195 | Ga0207694_10071913 | 3300025924 | Bacteria | 2703 |
| 196 | Ga0207694_10073023 | 3300025924 | Bacteria | 2683 |
| 197 | Ga0207659_10056998 | 3300025926 | Bacteria | 2800 |
| 198 | Ga0207687_10153922 | 3300025927 | Bacteria | 1757 |
| 199 | Ga0207664_10069212 | 3300025929 | Bacteria | 2838 |
| 200 | Ga0207664_10406457 | 3300025929 | Bacteria | 1211 |
| 201 | Ga0207690_10046663 | 3300025932 | Bacteria | 2871 |
| 202 | Ga0207709_10013433 | 3300025935 | Bacteria | 4519 |
| 203 | Ga0207704_10004897 | 3300025938 | Bacteria | 6151 |
| 204 | Ga0207704_10222125 | 3300025938 | Bacteria | 1399 |
| 205 | Ga0207711_10000001 | 3300025941 | Bacteria | 1325674 |
| 206 | Ga0207689_10118546 | 3300025942 | Bacteria | 2177 |
| 207 | Ga0207661_10128377 | 3300025944 | Bacteria | 2168 |
| 208 | Ga0207661_10149822 | 3300025944 | Bacteria | 2016 |
| 209 | Ga0207661_10275957 | 3300025944 | Bacteria | 1501 |
| 210 | Ga0207667_10000026 | 3300025949 | Bacteria | 343713 |
| 211 | Ga0207667_10012902 | 3300025949 | Bacteria | 9599 |
| 212 | Ga0207667_10016323 | 3300025949 | Bacteria | 8393 |
| 213 | Ga0207667_10025815 | 3300025949 | Bacteria | 6427 |
| 214 | Ga0207667_10055842 | 3300025949 | Bacteria | 4150 |
| 215 | Ga0207667_10139704 | 3300025949 | Bacteria | 2494 |
| 216 | Ga0207651_10002795 | 3300025960 | Bacteria | 8389 |
| 217 | Ga0207640_10330760 | 3300025981 | Unclassified | 1217 |
| 218 | Ga0207677_10030275 | 3300026023 | Bacteria | 3452 |
| 219 | Ga0207677_10436820 | 3300026023 | Bacteria | 1118 |
| 220 | Ga0207703_10048234 | 3300026035 | Bacteria | 3437 |
| 221 | Ga0207703_10055960 | 3300026035 | Bacteria | 3210 |
| 222 | Ga0207639_10034923 | 3300026041 | Bacteria | 3719 |
| 223 | Ga0207639_10075703 | 3300026041 | Bacteria | 2648 |
| 224 | Ga0207639_10194443 | 3300026041 | Bacteria | 1735 |
| 225 | Ga0207708_10053772 | 3300026075 | Bacteria | 3069 |
| 226 | Ga0207702_10009008 | 3300026078 | Bacteria | 8404 |
| 227 | Ga0207702_10106742 | 3300026078 | Bacteria | 2482 |
| 228 | Ga0207702_10109875 | 3300026078 | Bacteria | 2449 |
| 229 | Ga0207702_10284985 | 3300026078 | Bacteria | 1563 |
| 230 | Ga0207702_10319231 | 3300026078 | Bacteria | 1479 |
| 231 | Ga0207648_10005670 | 3300026089 | Bacteria | 12530 |
| 232 | Ga0207648_10085158 | 3300026089 | Bacteria | 2757 |
| 233 | Ga0207648_10263793 | 3300026089 | Bacteria | 1537 |
| 234 | Ga0207674_10000051 | 3300026116 | Bacteria | 116114 |
| 235 | Ga0207674_10103033 | 3300026116 | Bacteria | 2833 |
| 236 | Ga0207674_10219653 | 3300026116 | Bacteria | 1849 |
| 237 | Ga0207674_10227508 | 3300026116 | Bacteria | 1813 |
| 238 | Ga0207674_10244244 | 3300026116 | Bacteria | 1742 |
| 239 | Ga0207683_10004234 | 3300026121 | Bacteria | 12388 |
| 240 | Ga0207683_10021177 | 3300026121 | Bacteria | 5564 |
| 241 | Ga0207683_10188252 | 3300026121 | Bacteria | 1873 |
| 242 | Ga0207698_10006384 | 3300026142 | Bacteria | 7349 |
| 243 | Ga0207698_10195535 | 3300026142 | Bacteria | 1806 |
| 244 | Ga0207698_10238146 | 3300026142 | Bacteria | 1656 |
| 245 | Ga0268266_10023000 | 3300028379 | Bacteria | 5304 |
| 246 | Ga0268266_10078017 | 3300028379 | Bacteria | 2881 |
| 247 | Ga0268266_10152472 | 3300028379 | Bacteria | 2084 |
| 248 | Ga0265334_10001489 | 3300028573 | Bacteria | 11297 |
| 249 | Ga0265318_10000149 | 3300028577 | Bacteria | 63245 |
| 250 | Ga0307517_10084697 | 3300028786 | Unclassified | 2665 |
| 251 | Ga0265316_10055869 | 3300031344 | Bacteria | 3086 |
| 252 | Ga0265314_10007012 | 3300031711 | Bacteria | 9848 |
| 253 | Ga0265314_10011616 | 3300031711 | Bacteria | 7249 |
| 254 | Ga0265314_10065437 | 3300031711 | Bacteria | 2455 |
| 255 | Ga0265314_10097070 | 3300031711 | Bacteria | 1905 |
| 256 | Ga0265342_10087455 | 3300031712 | Bacteria | 1790 |
| 257 | Ga0265342_10126099 | 3300031712 | Bacteria | 1437 |
| 258 | Ga0307516_10014219 | 3300031730 | Bacteria | 8431 |
| 259 | Ga0307516_10016398 | 3300031730 | Bacteria | 7750 |
| 260 | Ga0307516_10018729 | 3300031730 | Bacteria | 7189 |
| 261 | Ga0373932_0019827 | 3300035112 | Bacteria | 1757 |
| 262 | Ga0373945_0031505 | 3300035116 | Bacteria | 1874 |
| 263 | Ga0373956_0017930 | 3300035119 | Bacteria | 2993 |
| 264 | Ga0373943_0005105 | 3300035170 | Bacteria | 5911 |
| 265 | Ga0373946_0010752 | 3300035171 | Bacteria | 3398 |
| 266 | Ga0373955_0002835 | 3300035172 | Bacteria | 7609 |
| 267 | Ga0373927_0244696 | 3300035695 | Unclassified | 1179 |
| 268 | Ga0373933_0004214 | 3300035724 | Bacteria | 7931 |
| 269 | Ga0373947_0053596 | 3300035725 | Bacteria | 2432 |
| 270 | Ga0373937_0000338 | 3300036401 | Bacteria | 44355 |
| 271 | Ga0373937_0009680 | 3300036401 | Bacteria | 8395 |
| 272 | Ga0373937_0337905 | 3300036401 | Bacteria | 1426 |
| 273 | Ga0373925_0063002 | 3300037068 | Bacteria | 2789 |
| 274 | Ga0373925_0129245 | 3300037068 | Bacteria | 1968 |
| 275 | Ga0395900_0354054 | 3300037418 | Bacteria | 1441 |
| 276 | Ga0395898_0036238 | 3300037466 | Bacteria | 4899 |
| 277 | Ga0395901_0127703 | 3300038443 | Bacteria | 2672 |
| 278 | Ga0436365_0623649 | 3300039437 | Bacteria | 7202 |
| 279 | Ga0466964_0145422 | 3300044706 | Unclassified | 1094 |
| 280 | Ga0466957_0104400 | 3300044842 | Bacteria | 1790 |
| 281 | Ga0466967_0082551 | 3300045976 | Bacteria | 2905 |
| 282 | Ga0495580_0040004 | 3300046472 | Bacteria | 3353 |
| 283 | Ga0495664_0046418 | 3300046477 | Bacteria | 2577 |
| 284 | Ga0495585_0177219 | 3300046492 | Bacteria | 1098 |
| 285 | Ga0495652_0188538 | 3300046529 | Bacteria | 1576 |
| 286 | Ga0495587_0071155 | 3300046536 | Bacteria | 2023 |
| 287 | Ga0495645_0006666 | 3300046543 | Bacteria | 8021 |
| 288 | Ga0495622_0008465 | 3300046557 | Bacteria | 4762 |
| 289 | Ga0495667_0063831 | 3300046559 | Bacteria | 2410 |
| 290 | Ga0495661_0098531 | 3300046665 | Unclassified | 1650 |
| 291 | Ga0495623_0041397 | 3300046679 | Bacteria | 2938 |
| 292 | Ga0495669_0090109 | 3300046684 | Unclassified | 1415 |
| 293 | Ga0495589_0034083 | 3300046794 | Bacteria | 2556 |
| 294 | Ga0495602_0086190 | 3300048088 | Bacteria | 2622 |
| 295 | Ga0496107_0174372 | 3300048910 | Bacteria | 1596 |
| 296 | Ga0496121_0004108 | 3300048924 | Bacteria | 19960 |
| 297 | Ga0495682_0004965 | 3300049460 | Bacteria | 5597 |
| 298 | Ga0501031_0064017 | 3300049568 | Bacteria | 2395 |
| 299 | Ga0501032_0105216 | 3300049569 | Bacteria | 1869 |
| 300 | Ga0501033_0005022 | 3300049570 | Bacteria | 10534 |
| 301 | Ga0501036_0094866 | 3300049572 | Bacteria | 2522 |
| 302 | Ga0501036_0238582 | 3300049572 | Bacteria | 1525 |
| 303 | Ga0501037_0176187 | 3300049573 | Bacteria | 1519 |
| 304 | Ga0501043_0105097 | 3300049579 | Bacteria | 2219 |
| 305 | Ga0501043_0145409 | 3300049579 | Bacteria | 1857 |
| 306 | Ga0501047_0025878 | 3300049581 | Bacteria | 5642 |
| 307 | Ga0501047_0120764 | 3300049581 | Bacteria | 2503 |
| 308 | Ga0501047_0186837 | 3300049581 | Bacteria | 1937 |
| 309 | Ga0501047_0327555 | 3300049581 | Bacteria | 1370 |
| 310 | Ga0501070_0000248 | 3300049586 | Bacteria | 50746 |
| 311 | Ga0501070_0145821 | 3300049586 | Bacteria | 1954 |
| 312 | Ga0501070_0246557 | 3300049586 | Bacteria | 1462 |
| 313 | Ga0501080_0000117 | 3300049742 | Bacteria | 55452 |
| 314 | Ga0501080_0112221 | 3300049742 | Bacteria | 2527 |
| 315 | Ga0501080_0125616 | 3300049742 | Bacteria | 2376 |
| 316 | Ga0501035_0007689 | 3300049822 | Bacteria | 10072 |
| 317 | Ga0501035_0034788 | 3300049822 | Bacteria | 4577 |
| 318 | Ga0501035_0049961 | 3300049822 | Bacteria | 3749 |
| 319 | Ga0501044_0007630 | 3300049823 | Bacteria | 11899 |
| 320 | Ga0501044_0040341 | 3300049823 | Bacteria | 4865 |
| 321 | Ga0501044_0159275 | 3300049823 | Bacteria | 2235 |
| 322 | nmdc:mga0n895_106545_c1 | 3300050512 | Bacteria | 2816 |
| 323 | nmdc:mga08x19_26540_c1 | 3300050514 | Bacteria | 3615 |
| 324 | Ga0500635_0007146 | 3300053080 | Bacteria | 3017 |
| 325 | Ga0500595_000533 | 3300053119 | Bacteria | 22936 |
| 326 | Ga0500595_018940 | 3300053119 | Bacteria | 2507 |
| 327 | Ga0500573_0000032 | 3300053140 | Bacteria | 131098 |
| 328 | Ga0500645_030635 | 3300053730 | Bacteria | 1618 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005577 | Ga0068857_100211750 | Ga0068857_1002117502 | 250 |
| 2 | 3300025924 | Ga0207694_10071913 | Ga0207694_100719132 | 250 |
| 3 | 3300026116 | Ga0207674_10227508 | Ga0207674_102275082 | 250 |
| 4 | 3300009545 | Ga0105237_10057417 | Ga0105237_100574171 | 257 |
| 5 | 3300049569 | Ga0501032_0105216 | Ga0501032_0105216_963_1814 | 258 |
| 6 | 3300009174 | Ga0105241_10029880 | Ga0105241_100298804 | 267 |
| 7 | 3300009177 | Ga0105248_10000001 | Ga0105248_100000011780 | 267 |
| 8 | 3300025913 | Ga0207695_10028476 | Ga0207695_100284765 | 267 |
| 9 | 3300025941 | Ga0207711_10000001 | Ga0207711_1000000192 | 267 |
| 10 | 3300005616 | Ga0068852_100013727 | Ga0068852_1000137275 | 268 |
| 11 | 3300013296 | Ga0157374_10103175 | Ga0157374_101031753 | 268 |
| 12 | 3300039437 | Ga0436365_0623649 | Ga0436365_0623649_644_1609 | 268 |
| 13 | 3300003320 | rootH2_10000706 | rootH2_100007062 | 271 |
| 14 | 3300049581 | Ga0501047_0120764 | Ga0501047_0120764_1103_2074 | 273 |
| 15 | 3300049586 | Ga0501070_0246557 | Ga0501070_0246557_368_1312 | 273 |
| 16 | 3300028573 | Ga0265334_10001489 | Ga0265334_100014893 | 274 |
| 17 | 3300031344 | Ga0265316_10055869 | Ga0265316_100558693 | 274 |
| 18 | 3300031711 | Ga0265314_10065437 | Ga0265314_100654372 | 274 |
| 19 | 3300005335 | Ga0070666_10000793 | Ga0070666_1000079318 | 276 |
| 20 | 3300005367 | Ga0070667_100015457 | Ga0070667_1000154575 | 276 |
| 21 | 3300005548 | Ga0070665_100301931 | Ga0070665_1003019312 | 276 |
| 22 | 3300005563 | Ga0068855_100014947 | Ga0068855_1000149479 | 276 |
| 23 | 3300025903 | Ga0207680_10000273 | Ga0207680_100002734 | 276 |
| 24 | 3300025949 | Ga0207667_10025815 | Ga0207667_100258152 | 276 |
| 25 | 3300031712 | Ga0265342_10087455 | Ga0265342_100874552 | 276 |
| 26 | 3300005434 | Ga0070709_10002917 | Ga0070709_100029175 | 279 |
| 27 | 3300005436 | Ga0070713_100000006 | Ga0070713_100000006153 | 279 |
| 28 | 3300005439 | Ga0070711_100123341 | Ga0070711_1001233412 | 279 |
| 29 | 3300005440 | Ga0070705_100163615 | Ga0070705_1001636152 | 279 |
| 30 | 3300005614 | Ga0068856_100000280 | Ga0068856_10000028051 | 279 |
| 31 | 3300006173 | Ga0070716_100020933 | Ga0070716_1000209334 | 279 |
| 32 | 3300006175 | Ga0070712_100000184 | Ga0070712_10000018417 | 279 |
| 33 | 3300006871 | Ga0075434_100213709 | Ga0075434_1002137092 | 279 |
| 34 | 3300006914 | Ga0075436_100001960 | Ga0075436_1000019601 | 279 |
| 35 | 3300006914 | Ga0075436_100035786 | Ga0075436_1000357862 | 279 |
| 36 | 3300013105 | Ga0157369_10016326 | Ga0157369_100163266 | 279 |
| 37 | 3300014325 | Ga0163163_10181879 | Ga0163163_101818792 | 279 |
| 38 | 3300014968 | Ga0157379_10046138 | Ga0157379_100461382 | 279 |
| 39 | 3300035112 | Ga0373932_0019827 | Ga0373932_0019827_39_1007 | 279 |
| 40 | 3300037068 | Ga0373925_0129245 | Ga0373925_0129245_407_1375 | 279 |
| 41 | 3300050512 | nmdc:mga0n895_106545_c1 | nmdc:mga0n895_106545_c1_1462_2430 | 279 |
| 42 | 3300031711 | Ga0265314_10007012 | Ga0265314_100070129 | 282 |
| 43 | 3300046472 | Ga0495580_0040004 | Ga0495580_0040004_1201_2169 | 284 |
| 44 | 3300035119 | Ga0373956_0017930 | Ga0373956_0017930_883_1851 | 285 |
| 45 | 3300035172 | Ga0373955_0002835 | Ga0373955_0002835_522_1490 | 285 |
| 46 | 3300035724 | Ga0373933_0004214 | Ga0373933_0004214_2237_3205 | 285 |
| 47 | 3300036401 | Ga0373937_0009680 | Ga0373937_0009680_3580_4548 | 285 |
| 48 | 3300046679 | Ga0495623_0041397 | Ga0495623_0041397_1722_2690 | 285 |
| 49 | 3300049572 | Ga0501036_0238582 | Ga0501036_0238582_524_1489 | 287 |
| 50 | 3300005614 | Ga0068856_100358953 | Ga0068856_1003589532 | 288 |
| 51 | 3300014968 | Ga0157379_10015015 | Ga0157379_100150156 | 288 |
| 52 | 3300036401 | Ga0373937_0000338 | Ga0373937_0000338_5875_6843 | 288 |
| 53 | 3300037068 | Ga0373925_0063002 | Ga0373925_0063002_961_1929 | 288 |
| 54 | 3300048910 | Ga0496107_0174372 | Ga0496107_0174372_134_1102 | 288 |
| 55 | 3300005439 | Ga0070711_100026563 | Ga0070711_1000265632 | 290 |
| 56 | 3300005456 | Ga0070678_100001382 | Ga0070678_1000013822 | 290 |
| 57 | 3300005459 | Ga0068867_100058953 | Ga0068867_1000589532 | 290 |
| 58 | 3300005718 | Ga0068866_10042862 | Ga0068866_100428622 | 290 |
| 59 | 3300006175 | Ga0070712_100000907 | Ga0070712_10000090714 | 290 |
| 60 | 3300006237 | Ga0097621_100028078 | Ga0097621_1000280783 | 290 |
| 61 | 3300006358 | Ga0068871_100100018 | Ga0068871_1001000182 | 290 |
| 62 | 3300006881 | Ga0068865_100003481 | Ga0068865_1000034818 | 290 |
| 63 | 3300009176 | Ga0105242_10004849 | Ga0105242_100048492 | 290 |
| 64 | 3300013306 | Ga0163162_10207319 | Ga0163162_102073192 | 290 |
| 65 | 3300014969 | Ga0157376_10011691 | Ga0157376_100116915 | 290 |
| 66 | 3300017792 | Ga0163161_10107385 | Ga0163161_101073851 | 290 |
| 67 | 3300025899 | Ga0207642_10004601 | Ga0207642_100046013 | 290 |
| 68 | 3300025915 | Ga0207693_10000127 | Ga0207693_1000012712 | 290 |
| 69 | 3300025916 | Ga0207663_10015741 | Ga0207663_100157412 | 290 |
| 70 | 3300025938 | Ga0207704_10004897 | Ga0207704_100048973 | 290 |
| 71 | 3300026089 | Ga0207648_10085158 | Ga0207648_100851582 | 290 |
| 72 | 3300026121 | Ga0207683_10004234 | Ga0207683_100042343 | 290 |
| 73 | 3300036401 | Ga0373937_0337905 | Ga0373937_0337905_268_1215 | 290 |
| 74 | 3300005327 | Ga0070658_10014729 | Ga0070658_100147292 | 293 |
| 75 | 3300005335 | Ga0070666_10085614 | Ga0070666_100856142 | 293 |
| 76 | 3300005338 | Ga0068868_100094285 | Ga0068868_1000942852 | 293 |
| 77 | 3300005344 | Ga0070661_100193444 | Ga0070661_1001934442 | 293 |
| 78 | 3300005530 | Ga0070679_100078471 | Ga0070679_1000784712 | 293 |
| 79 | 3300005548 | Ga0070665_100002423 | Ga0070665_1000024234 | 293 |
| 80 | 3300025903 | Ga0207680_10059059 | Ga0207680_100590592 | 293 |
| 81 | 3300025919 | Ga0207657_10087044 | Ga0207657_100870443 | 293 |
| 82 | 3300025921 | Ga0207652_10161251 | Ga0207652_101612512 | 293 |
| 83 | 3300025981 | Ga0207640_10330760 | Ga0207640_103307602 | 293 |
| 84 | 3300026023 | Ga0207677_10436820 | Ga0207677_104368201 | 293 |
| 85 | 3300028379 | Ga0268266_10023000 | Ga0268266_100230002 | 293 |
| 86 | 3300005329 | Ga0070683_100323471 | Ga0070683_1003234712 | 294 |
| 87 | 3300005435 | Ga0070714_100082431 | Ga0070714_1000824312 | 294 |
| 88 | 3300005530 | Ga0070679_100042833 | Ga0070679_1000428335 | 294 |
| 89 | 3300005614 | Ga0068856_100446338 | Ga0068856_1004463381 | 294 |
| 90 | 3300013307 | Ga0157372_10006484 | Ga0157372_100064846 | 294 |
| 91 | 3300025917 | Ga0207660_10125599 | Ga0207660_101255992 | 294 |
| 92 | 3300025921 | Ga0207652_10098169 | Ga0207652_100981692 | 294 |
| 93 | 3300025929 | Ga0207664_10069212 | Ga0207664_100692122 | 294 |
| 94 | 3300025944 | Ga0207661_10275957 | Ga0207661_102759571 | 294 |
| 95 | 3300026078 | Ga0207702_10284985 | Ga0207702_102849852 | 294 |
| 96 | 3300031711 | Ga0265314_10097070 | Ga0265314_100970702 | 294 |
| 97 | 3300031712 | Ga0265342_10126099 | Ga0265342_101260992 | 294 |
| 98 | 3300046536 | Ga0495587_0071155 | Ga0495587_0071155_620_1585 | 294 |
| 99 | 3300048088 | Ga0495602_0086190 | Ga0495602_0086190_550_1515 | 294 |
| 100 | 3300049573 | Ga0501037_0176187 | Ga0501037_0176187_276_1235 | 294 |
| 101 | 3300049579 | Ga0501043_0145409 | Ga0501043_0145409_280_1239 | 294 |
| 102 | 3300049586 | Ga0501070_0145821 | Ga0501070_0145821_560_1519 | 294 |
| 103 | 3300049742 | Ga0501080_0112221 | Ga0501080_0112221_352_1311 | 294 |
| 104 | 3300049823 | Ga0501044_0159275 | Ga0501044_0159275_215_1174 | 294 |
| 105 | 3300003320 | rootH2_10026210 | rootH2_100262102 | 295 |
| 106 | 3300005327 | Ga0070658_10061267 | Ga0070658_100612673 | 295 |
| 107 | 3300005330 | Ga0070690_100382934 | Ga0070690_1003829341 | 295 |
| 108 | 3300005336 | Ga0070680_100054857 | Ga0070680_1000548573 | 295 |
| 109 | 3300005339 | Ga0070660_100003852 | Ga0070660_1000038525 | 295 |
| 110 | 3300005341 | Ga0070691_10003126 | Ga0070691_100031264 | 295 |
| 111 | 3300005366 | Ga0070659_100023192 | Ga0070659_1000231922 | 295 |
| 112 | 3300005458 | Ga0070681_10087651 | Ga0070681_100876513 | 295 |
| 113 | 3300005539 | Ga0068853_100086897 | Ga0068853_1000868973 | 295 |
| 114 | 3300005539 | Ga0068853_100110356 | Ga0068853_1001103562 | 295 |
| 115 | 3300005548 | Ga0070665_100031215 | Ga0070665_1000312153 | 295 |
| 116 | 3300005563 | Ga0068855_100000529 | Ga0068855_10000052921 | 295 |
| 117 | 3300005842 | Ga0068858_100072648 | Ga0068858_1000726481 | 295 |
| 118 | 3300009093 | Ga0105240_10000055 | Ga0105240_10000055213 | 295 |
| 119 | 3300009093 | Ga0105240_10011873 | Ga0105240_1001187310 | 295 |
| 120 | 3300009093 | Ga0105240_10368989 | Ga0105240_103689892 | 295 |
| 121 | 3300009093 | Ga0105240_10542971 | Ga0105240_105429712 | 295 |
| 122 | 3300009174 | Ga0105241_10090352 | Ga0105241_100903522 | 295 |
| 123 | 3300009174 | Ga0105241_10177822 | Ga0105241_101778222 | 295 |
| 124 | 3300009176 | Ga0105242_10144201 | Ga0105242_101442012 | 295 |
| 125 | 3300009551 | Ga0105238_10001657 | Ga0105238_100016572 | 295 |
| 126 | 3300009551 | Ga0105238_10025837 | Ga0105238_100258372 | 295 |
| 127 | 3300009551 | Ga0105238_10069037 | Ga0105238_100690373 | 295 |
| 128 | 3300010375 | Ga0105239_10001057 | Ga0105239_100010574 | 295 |
| 129 | 3300013104 | Ga0157370_10001892 | Ga0157370_1000189223 | 295 |
| 130 | 3300013104 | Ga0157370_10232759 | Ga0157370_102327592 | 295 |
| 131 | 3300013105 | Ga0157369_10003278 | Ga0157369_100032785 | 295 |
| 132 | 3300013306 | Ga0163162_10002450 | Ga0163162_1000245014 | 295 |
| 133 | 3300014325 | Ga0163163_10000021 | Ga0163163_10000021152 | 295 |
| 134 | 3300014968 | Ga0157379_10002828 | Ga0157379_1000282813 | 295 |
| 135 | 3300014969 | Ga0157376_10269547 | Ga0157376_102695472 | 295 |
| 136 | 3300025909 | Ga0207705_10000039 | Ga0207705_1000003989 | 295 |
| 137 | 3300025911 | Ga0207654_10037377 | Ga0207654_100373772 | 295 |
| 138 | 3300025912 | Ga0207707_10000769 | Ga0207707_100007694 | 295 |
| 139 | 3300025913 | Ga0207695_10000012 | Ga0207695_10000012124 | 295 |
| 140 | 3300025919 | Ga0207657_10000635 | Ga0207657_100006358 | 295 |
| 141 | 3300025920 | Ga0207649_10328419 | Ga0207649_103284191 | 295 |
| 142 | 3300025920 | Ga0207649_10345577 | Ga0207649_103455771 | 295 |
| 143 | 3300025921 | Ga0207652_10000646 | Ga0207652_1000064631 | 295 |
| 144 | 3300025924 | Ga0207694_10000006 | Ga0207694_10000006541 | 295 |
| 145 | 3300025924 | Ga0207694_10030929 | Ga0207694_100309292 | 295 |
| 146 | 3300025932 | Ga0207690_10046663 | Ga0207690_100466633 | 295 |
| 147 | 3300025944 | Ga0207661_10149822 | Ga0207661_101498222 | 295 |
| 148 | 3300025949 | Ga0207667_10000026 | Ga0207667_10000026270 | 295 |
| 149 | 3300025949 | Ga0207667_10016323 | Ga0207667_100163234 | 295 |
| 150 | 3300026035 | Ga0207703_10048234 | Ga0207703_100482342 | 295 |
| 151 | 3300026041 | Ga0207639_10075703 | Ga0207639_100757033 | 295 |
| 152 | 3300026142 | Ga0207698_10006384 | Ga0207698_100063845 | 295 |
| 153 | 3300026142 | Ga0207698_10195535 | Ga0207698_101955352 | 295 |
| 154 | 3300028577 | Ga0265318_10000149 | Ga0265318_1000014952 | 295 |
| 155 | 3300031711 | Ga0265314_10011616 | Ga0265314_100116162 | 295 |
| 156 | 3300031730 | Ga0307516_10016398 | Ga0307516_100163982 | 295 |
| 157 | 3300048924 | Ga0496121_0004108 | Ga0496121_0004108_12374_13339 | 295 |
| 158 | 3300049460 | Ga0495682_0004965 | Ga0495682_0004965_846_1814 | 295 |
| 159 | 3300049568 | Ga0501031_0064017 | Ga0501031_0064017_265_1230 | 295 |
| 160 | 3300049572 | Ga0501036_0094866 | Ga0501036_0094866_151_1116 | 295 |
| 161 | 3300049581 | Ga0501047_0186837 | Ga0501047_0186837_471_1439 | 295 |
| 162 | 3300049586 | Ga0501070_0000248 | Ga0501070_0000248_13717_14682 | 295 |
| 163 | 3300049742 | Ga0501080_0000117 | Ga0501080_0000117_932_1897 | 295 |
| 164 | 3300049822 | Ga0501035_0007689 | Ga0501035_0007689_8707_9672 | 295 |
| 165 | 3300049822 | Ga0501035_0049961 | Ga0501035_0049961_2639_3604 | 295 |
| 166 | 3300049823 | Ga0501044_0040341 | Ga0501044_0040341_780_1745 | 295 |
| 167 | 3300053119 | Ga0500595_000533 | Ga0500595_000533_6255_7217 | 295 |
| 168 | 3300053730 | Ga0500645_030635 | Ga0500645_030635_487_1449 | 295 |
| 169 | 3300005341 | Ga0070691_10001501 | Ga0070691_100015016 | 296 |
| 170 | 3300005435 | Ga0070714_100310225 | Ga0070714_1003102251 | 296 |
| 171 | 3300005548 | Ga0070665_100109077 | Ga0070665_1001090772 | 296 |
| 172 | 3300005563 | Ga0068855_100123784 | Ga0068855_1001237843 | 296 |
| 173 | 3300005563 | Ga0068855_100347492 | Ga0068855_1003474922 | 296 |
| 174 | 3300005577 | Ga0068857_100000387 | Ga0068857_10000038711 | 296 |
| 175 | 3300005614 | Ga0068856_100076260 | Ga0068856_1000762602 | 296 |
| 176 | 3300005614 | Ga0068856_100165931 | Ga0068856_1001659312 | 296 |
| 177 | 3300005616 | Ga0068852_100225825 | Ga0068852_1002258252 | 296 |
| 178 | 3300006358 | Ga0068871_100229513 | Ga0068871_1002295132 | 296 |
| 179 | 3300006881 | Ga0068865_100103647 | Ga0068865_1001036472 | 296 |
| 180 | 3300006914 | Ga0075436_100038227 | Ga0075436_1000382271 | 296 |
| 181 | 3300009093 | Ga0105240_10006992 | Ga0105240_1000699216 | 296 |
| 182 | 3300009093 | Ga0105240_10017901 | Ga0105240_100179014 | 296 |
| 183 | 3300009093 | Ga0105240_10153135 | Ga0105240_101531352 | 296 |
| 184 | 3300009174 | Ga0105241_10144122 | Ga0105241_101441222 | 296 |
| 185 | 3300009545 | Ga0105237_10031638 | Ga0105237_100316383 | 296 |
| 186 | 3300009545 | Ga0105237_10344293 | Ga0105237_103442932 | 296 |
| 187 | 3300009551 | Ga0105238_10231794 | Ga0105238_102317942 | 296 |
| 188 | 3300010375 | Ga0105239_10186830 | Ga0105239_101868302 | 296 |
| 189 | 3300010375 | Ga0105239_10330199 | Ga0105239_103301992 | 296 |
| 190 | 3300013100 | Ga0157373_10094036 | Ga0157373_100940362 | 296 |
| 191 | 3300013104 | Ga0157370_10000438 | Ga0157370_1000043826 | 296 |
| 192 | 3300014968 | Ga0157379_10165405 | Ga0157379_101654052 | 296 |
| 193 | 3300025911 | Ga0207654_10044648 | Ga0207654_100446482 | 296 |
| 194 | 3300025911 | Ga0207654_10070047 | Ga0207654_100700471 | 296 |
| 195 | 3300025913 | Ga0207695_10002080 | Ga0207695_1000208016 | 296 |
| 196 | 3300025913 | Ga0207695_10012896 | Ga0207695_100128969 | 296 |
| 197 | 3300025913 | Ga0207695_10109966 | Ga0207695_101099662 | 296 |
| 198 | 3300025914 | Ga0207671_10004743 | Ga0207671_100047435 | 296 |
| 199 | 3300025914 | Ga0207671_10222771 | Ga0207671_102227712 | 296 |
| 200 | 3300025924 | Ga0207694_10073023 | Ga0207694_100730232 | 296 |
| 201 | 3300025929 | Ga0207664_10406457 | Ga0207664_104064572 | 296 |
| 202 | 3300025938 | Ga0207704_10222125 | Ga0207704_102221251 | 296 |
| 203 | 3300025949 | Ga0207667_10012902 | Ga0207667_100129022 | 296 |
| 204 | 3300025949 | Ga0207667_10139704 | Ga0207667_101397042 | 296 |
| 205 | 3300026041 | Ga0207639_10034923 | Ga0207639_100349233 | 296 |
| 206 | 3300026078 | Ga0207702_10009008 | Ga0207702_100090085 | 296 |
| 207 | 3300026078 | Ga0207702_10109875 | Ga0207702_101098752 | 296 |
| 208 | 3300026116 | Ga0207674_10000051 | Ga0207674_1000005165 | 296 |
| 209 | 3300026142 | Ga0207698_10238146 | Ga0207698_102381462 | 296 |
| 210 | 3300035116 | Ga0373945_0031505 | Ga0373945_0031505_98_1078 | 296 |
| 211 | 3300035170 | Ga0373943_0005105 | Ga0373943_0005105_1858_2838 | 296 |
| 212 | 3300035171 | Ga0373946_0010752 | Ga0373946_0010752_1684_2664 | 296 |
| 213 | 3300035695 | Ga0373927_0244696 | Ga0373927_0244696_152_1132 | 296 |
| 214 | 3300035725 | Ga0373947_0053596 | Ga0373947_0053596_1115_2095 | 296 |
| 215 | 3300046477 | Ga0495664_0046418 | Ga0495664_0046418_750_1721 | 296 |
| 216 | 3300046529 | Ga0495652_0188538 | Ga0495652_0188538_407_1378 | 296 |
| 217 | 3300046543 | Ga0495645_0006666 | Ga0495645_0006666_1717_2688 | 296 |
| 218 | 3300046559 | Ga0495667_0063831 | Ga0495667_0063831_954_1925 | 296 |
| 219 | 3300049570 | Ga0501033_0005022 | Ga0501033_0005022_6292_7263 | 296 |
| 220 | 3300049579 | Ga0501043_0105097 | Ga0501043_0105097_879_1850 | 296 |
| 221 | 3300049581 | Ga0501047_0025878 | Ga0501047_0025878_109_1080 | 296 |
| 222 | 3300049581 | Ga0501047_0327555 | Ga0501047_0327555_170_1135 | 296 |
| 223 | 3300049742 | Ga0501080_0125616 | Ga0501080_0125616_918_1889 | 296 |
| 224 | 3300049822 | Ga0501035_0034788 | Ga0501035_0034788_881_1852 | 296 |
| 225 | 3300049823 | Ga0501044_0007630 | Ga0501044_0007630_6407_7378 | 296 |
| 226 | 3300050514 | nmdc:mga08x19_26540_c1 | nmdc:mga08x19_26540_c1_1606_2574 | 296 |
| 227 | 3300005334 | Ga0068869_100011842 | Ga0068869_1000118422 | 297 |
| 228 | 3300005355 | Ga0070671_100215953 | Ga0070671_1002159532 | 297 |
| 229 | 3300005364 | Ga0070673_100011937 | Ga0070673_1000119376 | 297 |
| 230 | 3300005438 | Ga0070701_10115085 | Ga0070701_101150852 | 297 |
| 231 | 3300005439 | Ga0070711_100186250 | Ga0070711_1001862502 | 297 |
| 232 | 3300005458 | Ga0070681_10081181 | Ga0070681_100811813 | 297 |
| 233 | 3300005459 | Ga0068867_100010139 | Ga0068867_1000101392 | 297 |
| 234 | 3300005530 | Ga0070679_100060027 | Ga0070679_1000600273 | 297 |
| 235 | 3300005548 | Ga0070665_100008064 | Ga0070665_1000080649 | 297 |
| 236 | 3300005718 | Ga0068866_10078609 | Ga0068866_100786092 | 297 |
| 237 | 3300006237 | Ga0097621_100209176 | Ga0097621_1002091762 | 297 |
| 238 | 3300009098 | Ga0105245_10223986 | Ga0105245_102239862 | 297 |
| 239 | 3300009148 | Ga0105243_10022693 | Ga0105243_100226935 | 297 |
| 240 | 3300013297 | Ga0157378_10132861 | Ga0157378_101328612 | 297 |
| 241 | 3300025899 | Ga0207642_10020904 | Ga0207642_100209042 | 297 |
| 242 | 3300025907 | Ga0207645_10052043 | Ga0207645_100520432 | 297 |
| 243 | 3300025908 | Ga0207643_10029726 | Ga0207643_100297262 | 297 |
| 244 | 3300025912 | Ga0207707_10042360 | Ga0207707_100423603 | 297 |
| 245 | 3300025919 | Ga0207657_10036878 | Ga0207657_100368783 | 297 |
| 246 | 3300025926 | Ga0207659_10056998 | Ga0207659_100569982 | 297 |
| 247 | 3300025927 | Ga0207687_10153922 | Ga0207687_101539222 | 297 |
| 248 | 3300025935 | Ga0207709_10013433 | Ga0207709_100134335 | 297 |
| 249 | 3300025942 | Ga0207689_10118546 | Ga0207689_101185462 | 297 |
| 250 | 3300025960 | Ga0207651_10002795 | Ga0207651_100027952 | 297 |
| 251 | 3300026075 | Ga0207708_10053772 | Ga0207708_100537722 | 297 |
| 252 | 3300026078 | Ga0207702_10319231 | Ga0207702_103192312 | 297 |
| 253 | 3300026089 | Ga0207648_10005670 | Ga0207648_1000567013 | 297 |
| 254 | 3300028379 | Ga0268266_10152472 | Ga0268266_101524722 | 297 |
| 255 | 3300037418 | Ga0395900_0354054 | Ga0395900_0354054_263_1240 | 297 |
| 256 | 3300037466 | Ga0395898_0036238 | Ga0395898_0036238_1348_2325 | 297 |
| 257 | 3300038443 | Ga0395901_0127703 | Ga0395901_0127703_464_1441 | 297 |
| 258 | 3300046665 | Ga0495661_0098531 | Ga0495661_0098531_509_1477 | 297 |
| 259 | 3300046684 | Ga0495669_0090109 | Ga0495669_0090109_138_1106 | 297 |
| 260 | 3300003214 | JGI25165J46597_1000080 | JGI25165J46597_100008016 | 298 |
| 261 | 3300005327 | Ga0070658_10116997 | Ga0070658_101169972 | 298 |
| 262 | 3300005331 | Ga0070670_100257921 | Ga0070670_1002579211 | 298 |
| 263 | 3300005338 | Ga0068868_100122579 | Ga0068868_1001225792 | 298 |
| 264 | 3300005535 | Ga0070684_100047353 | Ga0070684_1000473533 | 298 |
| 265 | 3300005539 | Ga0068853_100180004 | Ga0068853_1001800042 | 298 |
| 266 | 3300005547 | Ga0070693_100118662 | Ga0070693_1001186622 | 298 |
| 267 | 3300005548 | Ga0070665_100103996 | Ga0070665_1001039962 | 298 |
| 268 | 3300005548 | Ga0070665_100384611 | Ga0070665_1003846112 | 298 |
| 269 | 3300005563 | Ga0068855_100004964 | Ga0068855_10000496414 | 298 |
| 270 | 3300005577 | Ga0068857_100100720 | Ga0068857_1001007202 | 298 |
| 271 | 3300005614 | Ga0068856_100066445 | Ga0068856_1000664453 | 298 |
| 272 | 3300005618 | Ga0068864_100105179 | Ga0068864_1001051793 | 298 |
| 273 | 3300006237 | Ga0097621_100194799 | Ga0097621_1001947992 | 298 |
| 274 | 3300006358 | Ga0068871_100000875 | Ga0068871_1000008752 | 298 |
| 275 | 3300006358 | Ga0068871_100221982 | Ga0068871_1002219822 | 298 |
| 276 | 3300009093 | Ga0105240_10006323 | Ga0105240_100063234 | 298 |
| 277 | 3300009174 | Ga0105241_10042687 | Ga0105241_100426872 | 298 |
| 278 | 3300009174 | Ga0105241_10165225 | Ga0105241_101652252 | 298 |
| 279 | 3300009174 | Ga0105241_10436113 | Ga0105241_104361131 | 298 |
| 280 | 3300009176 | Ga0105242_10368405 | Ga0105242_103684052 | 298 |
| 281 | 3300009177 | Ga0105248_10368527 | Ga0105248_103685272 | 298 |
| 282 | 3300009177 | Ga0105248_10390949 | Ga0105248_103909491 | 298 |
| 283 | 3300009545 | Ga0105237_10038550 | Ga0105237_100385505 | 298 |
| 284 | 3300009545 | Ga0105237_10054437 | Ga0105237_100544373 | 298 |
| 285 | 3300009545 | Ga0105237_10074265 | Ga0105237_100742651 | 298 |
| 286 | 3300009545 | Ga0105237_10518650 | Ga0105237_105186501 | 298 |
| 287 | 3300009551 | Ga0105238_10028464 | Ga0105238_100284645 | 298 |
| 288 | 3300009551 | Ga0105238_10033742 | Ga0105238_100337424 | 298 |
| 289 | 3300010375 | Ga0105239_10232472 | Ga0105239_102324722 | 298 |
| 290 | 3300010375 | Ga0105239_10256636 | Ga0105239_102566362 | 298 |
| 291 | 3300011119 | Ga0105246_10010785 | Ga0105246_100107854 | 298 |
| 292 | 3300013105 | Ga0157369_10169898 | Ga0157369_101698982 | 298 |
| 293 | 3300013296 | Ga0157374_10023596 | Ga0157374_100235962 | 298 |
| 294 | 3300014968 | Ga0157379_10088366 | Ga0157379_100883662 | 298 |
| 295 | 3300025231 | Ga0207427_105555 | Ga0207427_1055552 | 298 |
| 296 | 3300025261 | Ga0209233_1000006 | Ga0209233_1000006811 | 298 |
| 297 | 3300025261 | Ga0209233_1001131 | Ga0209233_10011312 | 298 |
| 298 | 3300025272 | Ga0209455_1009713 | Ga0209455_10097132 | 298 |
| 299 | 3300025297 | Ga0209758_1000008 | Ga0209758_1000008134 | 298 |
| 300 | 3300025909 | Ga0207705_10036009 | Ga0207705_100360092 | 298 |
| 301 | 3300025913 | Ga0207695_10009572 | Ga0207695_100095724 | 298 |
| 302 | 3300025914 | Ga0207671_10021912 | Ga0207671_100219122 | 298 |
| 303 | 3300025920 | Ga0207649_10095022 | Ga0207649_100950222 | 298 |
| 304 | 3300025944 | Ga0207661_10128377 | Ga0207661_101283772 | 298 |
| 305 | 3300025949 | Ga0207667_10055842 | Ga0207667_100558423 | 298 |
| 306 | 3300026023 | Ga0207677_10030275 | Ga0207677_100302752 | 298 |
| 307 | 3300026035 | Ga0207703_10055960 | Ga0207703_100559604 | 298 |
| 308 | 3300026041 | Ga0207639_10194443 | Ga0207639_101944432 | 298 |
| 309 | 3300026078 | Ga0207702_10106742 | Ga0207702_101067422 | 298 |
| 310 | 3300026089 | Ga0207648_10263793 | Ga0207648_102637932 | 298 |
| 311 | 3300026116 | Ga0207674_10103033 | Ga0207674_101030332 | 298 |
| 312 | 3300026116 | Ga0207674_10219653 | Ga0207674_102196532 | 298 |
| 313 | 3300026116 | Ga0207674_10244244 | Ga0207674_102442442 | 298 |
| 314 | 3300026121 | Ga0207683_10021177 | Ga0207683_100211772 | 298 |
| 315 | 3300026121 | Ga0207683_10188252 | Ga0207683_101882522 | 298 |
| 316 | 3300028379 | Ga0268266_10078017 | Ga0268266_100780172 | 298 |
| 317 | 3300028786 | Ga0307517_10084697 | Ga0307517_100846971 | 298 |
| 318 | 3300031730 | Ga0307516_10014219 | Ga0307516_100142193 | 298 |
| 319 | 3300031730 | Ga0307516_10018729 | Ga0307516_100187296 | 298 |
| 320 | 3300044706 | Ga0466964_0145422 | Ga0466964_0145422_112_1083 | 298 |
| 321 | 3300044842 | Ga0466957_0104400 | Ga0466957_0104400_511_1482 | 298 |
| 322 | 3300045976 | Ga0466967_0082551 | Ga0466967_0082551_291_1262 | 298 |
| 323 | 3300046492 | Ga0495585_0177219 | Ga0495585_0177219_74_1045 | 298 |
| 324 | 3300046557 | Ga0495622_0008465 | Ga0495622_0008465_1436_2407 | 298 |
| 325 | 3300046794 | Ga0495589_0034083 | Ga0495589_0034083_1206_2177 | 298 |
| 326 | 3300053080 | Ga0500635_0007146 | Ga0500635_0007146_28_999 | 298 |
| 327 | 3300053119 | Ga0500595_018940 | Ga0500595_018940_890_1861 | 298 |
| 328 | 3300053140 | Ga0500573_0000032 | Ga0500573_0000032_104534_105505 | 298 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar