F409084

General Info

Members Datasets Scaffolds Average Seq Length
328 166 328 316

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10116997|Ga0070658_101169972
Length 326
Sequence MIILVALLAMMALGGVAFAFAGGDERTQKRVSALAKSKPNARNAAARMQSEAAQKRKSVATLLKDVEKNQAAMRARNKPTLRRRLEQAGFEDDDSVRKFWIASGVLGLVTALICLLTGQPILVVGLAAFVTAFGLPRWVLSFLFARRKKRFTKEFAGAIDVIVRSVRSGLPTNEALRIVARETPDPVGSEFTRLTDGLKVGVTLEQGLKKMHENMPTAEVGFFGIVMTIQAKSGGNLSEALSNLAAVLRDRKRLEGKIKAMSSEAKASAMIIGSLPPAVAGIVWLTTPAYINLLFSEKMGNLLLGGCAIWTGTGIFVMRKMINFKH

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
69 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
110 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
111 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
114 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
115 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
116 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
117 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
118 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
119 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
120 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
121 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
124 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
132 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
136 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
141 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
142 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
143 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
144 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
145 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
146 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
149 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
150 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
163 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
164 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
165 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
166 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.35
Nodule 0
Rhizoplane 0.3
Rhizosphere 93.9
Stem 0
Stem Tuber 0
Unclassified 2.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000080 3300003214 Bacteria 176649
2 rootH2_10000706 3300003320 Bacteria 22047
3 rootH2_10026210 3300003320 Bacteria 1353
4 Ga0070658_10014729 3300005327 Bacteria 6271
5 Ga0070658_10061267 3300005327 Bacteria 3065
6 Ga0070658_10116997 3300005327 Bacteria 2213
7 Ga0070683_100323471 3300005329 Bacteria 1468
8 Ga0070690_100382934 3300005330 Bacteria 1029
9 Ga0070670_100257921 3300005331 Bacteria 1519
10 Ga0068869_100011842 3300005334 Bacteria 5737
11 Ga0070666_10000793 3300005335 Bacteria 19164
12 Ga0070666_10085614 3300005335 Unclassified 2159
13 Ga0070680_100054857 3300005336 Bacteria 3255
14 Ga0068868_100094285 3300005338 Bacteria 2414
15 Ga0068868_100122579 3300005338 Bacteria 2121
16 Ga0070660_100003852 3300005339 Bacteria 10363
17 Ga0070691_10001501 3300005341 Bacteria 10014
18 Ga0070691_10003126 3300005341 Bacteria 7417
19 Ga0070661_100193444 3300005344 Unclassified 1552
20 Ga0070671_100215953 3300005355 Bacteria 1627
21 Ga0070673_100011937 3300005364 Bacteria 5947
22 Ga0070659_100023192 3300005366 Bacteria 4746
23 Ga0070667_100015457 3300005367 Bacteria 6312
24 Ga0070709_10002917 3300005434 Bacteria 9222
25 Ga0070714_100082431 3300005435 Bacteria 2802
26 Ga0070714_100310225 3300005435 Bacteria 1473
27 Ga0070713_100000006 3300005436 Bacteria 190565
28 Ga0070701_10115085 3300005438 Bacteria 1508
29 Ga0070711_100026563 3300005439 Bacteria 3794
30 Ga0070711_100123341 3300005439 Bacteria 1919
31 Ga0070711_100186250 3300005439 Bacteria 1592
32 Ga0070705_100163615 3300005440 Bacteria 1490
33 Ga0070678_100001382 3300005456 Bacteria 12937
34 Ga0070681_10081181 3300005458 Bacteria 3199
35 Ga0070681_10087651 3300005458 Bacteria 3065
36 Ga0068867_100010139 3300005459 Bacteria 6644
37 Ga0068867_100058953 3300005459 Bacteria 2845
38 Ga0070679_100042833 3300005530 Bacteria 4509
39 Ga0070679_100060027 3300005530 Bacteria 3790
40 Ga0070679_100078471 3300005530 Bacteria 3291
41 Ga0070684_100047353 3300005535 Bacteria 3726
42 Ga0068853_100086897 3300005539 Bacteria 2743
43 Ga0068853_100110356 3300005539 Bacteria 2443
44 Ga0068853_100180004 3300005539 Bacteria 1917
45 Ga0070693_100118662 3300005547 Bacteria 1638
46 Ga0070665_100002423 3300005548 Bacteria 20562
47 Ga0070665_100008064 3300005548 Bacteria 10661
48 Ga0070665_100031215 3300005548 Bacteria 5363
49 Ga0070665_100103996 3300005548 Bacteria 2842
50 Ga0070665_100109077 3300005548 Bacteria 2770
51 Ga0070665_100301931 3300005548 Bacteria 1604
52 Ga0070665_100384611 3300005548 Bacteria 1411
53 Ga0068855_100000529 3300005563 Bacteria 46748
54 Ga0068855_100004964 3300005563 Bacteria 16229
55 Ga0068855_100014947 3300005563 Bacteria 9352
56 Ga0068855_100123784 3300005563 Bacteria 2958
57 Ga0068855_100347492 3300005563 Bacteria 1634
58 Ga0068857_100000387 3300005577 Bacteria 30877
59 Ga0068857_100100720 3300005577 Bacteria 2592
60 Ga0068857_100211750 3300005577 Bacteria 1769
61 Ga0068856_100000280 3300005614 Bacteria 55488
62 Ga0068856_100066445 3300005614 Bacteria 3563
63 Ga0068856_100076260 3300005614 Bacteria 3322
64 Ga0068856_100165931 3300005614 Bacteria 2219
65 Ga0068856_100358953 3300005614 Bacteria 1476
66 Ga0068856_100446338 3300005614 Bacteria 1314
67 Ga0068852_100013727 3300005616 Bacteria 6209
68 Ga0068852_100225825 3300005616 Bacteria 1783
69 Ga0068864_100105179 3300005618 Bacteria 2508
70 Ga0068866_10042862 3300005718 Bacteria 2255
71 Ga0068866_10078609 3300005718 Bacteria 1765
72 Ga0068858_100072648 3300005842 Bacteria 3192
73 Ga0070716_100020933 3300006173 Bacteria 3441
74 Ga0070712_100000184 3300006175 Bacteria 34651
75 Ga0070712_100000907 3300006175 Bacteria 17736
76 Ga0097621_100028078 3300006237 Bacteria 4432
77 Ga0097621_100194799 3300006237 Bacteria 1757
78 Ga0097621_100209176 3300006237 Bacteria 1697
79 Ga0068871_100000875 3300006358 Bacteria 20076
80 Ga0068871_100100018 3300006358 Bacteria 2428
81 Ga0068871_100221982 3300006358 Bacteria 1637
82 Ga0068871_100229513 3300006358 Bacteria 1611
83 Ga0075434_100213709 3300006871 Bacteria 1949
84 Ga0068865_100003481 3300006881 Bacteria 9434
85 Ga0068865_100103647 3300006881 Bacteria 2087
86 Ga0075436_100001960 3300006914 Bacteria 14189
87 Ga0075436_100035786 3300006914 Bacteria 3425
88 Ga0075436_100038227 3300006914 Bacteria 3312
89 Ga0105240_10000055 3300009093 Bacteria 225380
90 Ga0105240_10006323 3300009093 Bacteria 17434
91 Ga0105240_10006992 3300009093 Bacteria 16479
92 Ga0105240_10011873 3300009093 Bacteria 12086
93 Ga0105240_10017901 3300009093 Bacteria 9531
94 Ga0105240_10153135 3300009093 Bacteria 2744
95 Ga0105240_10368989 3300009093 Bacteria 1624
96 Ga0105240_10542971 3300009093 Bacteria 1287
97 Ga0105245_10223986 3300009098 Bacteria 1816
98 Ga0105243_10022693 3300009148 Bacteria 4773
99 Ga0105241_10029880 3300009174 Bacteria 4069
100 Ga0105241_10042687 3300009174 Bacteria 3433
101 Ga0105241_10090352 3300009174 Bacteria 2415
102 Ga0105241_10144122 3300009174 Bacteria 1943
103 Ga0105241_10165225 3300009174 Bacteria 1823
104 Ga0105241_10177822 3300009174 Bacteria 1762
105 Ga0105241_10436113 3300009174 Bacteria 1156
106 Ga0105242_10004849 3300009176 Bacteria 10417
107 Ga0105242_10144201 3300009176 Bacteria 2070
108 Ga0105242_10368405 3300009176 Bacteria 1332
109 Ga0105248_10000001 3300009177 Bacteria 1881304
110 Ga0105248_10368527 3300009177 Bacteria 1617
111 Ga0105248_10390949 3300009177 Bacteria 1566
112 Ga0105237_10031638 3300009545 Bacteria 5359
113 Ga0105237_10038550 3300009545 Bacteria 4826
114 Ga0105237_10054437 3300009545 Bacteria 4009
115 Ga0105237_10057417 3300009545 Bacteria 3895
116 Ga0105237_10074265 3300009545 Bacteria 3392
117 Ga0105237_10344293 3300009545 Bacteria 1495
118 Ga0105237_10518650 3300009545 Bacteria 1198
119 Ga0105238_10001657 3300009551 Bacteria 22360
120 Ga0105238_10025837 3300009551 Bacteria 5987
121 Ga0105238_10028464 3300009551 Bacteria 5693
122 Ga0105238_10033742 3300009551 Bacteria 5208
123 Ga0105238_10069037 3300009551 Bacteria 3535
124 Ga0105238_10231794 3300009551 Bacteria 1823
125 Ga0105239_10001057 3300010375 Bacteria 38270
126 Ga0105239_10186830 3300010375 Bacteria 2319
127 Ga0105239_10232472 3300010375 Bacteria 2068
128 Ga0105239_10256636 3300010375 Bacteria 1964
129 Ga0105239_10330199 3300010375 Bacteria 1720
130 Ga0105246_10010785 3300011119 Bacteria 5665
131 Ga0157373_10094036 3300013100 Bacteria 2111
132 Ga0157370_10000438 3300013104 Bacteria 51999
133 Ga0157370_10001892 3300013104 Bacteria 25765
134 Ga0157370_10232759 3300013104 Bacteria 1705
135 Ga0157369_10003278 3300013105 Bacteria 19270
136 Ga0157369_10016326 3300013105 Bacteria 8356
137 Ga0157369_10169898 3300013105 Bacteria 2298
138 Ga0157374_10023596 3300013296 Bacteria 5504
139 Ga0157374_10103175 3300013296 Bacteria 2736
140 Ga0157378_10132861 3300013297 Bacteria 2305
141 Ga0163162_10002450 3300013306 Bacteria 17500
142 Ga0163162_10207319 3300013306 Bacteria 2089
143 Ga0157372_10006484 3300013307 Bacteria 12452
144 Ga0163163_10000021 3300014325 Bacteria 191799
145 Ga0163163_10181879 3300014325 Bacteria 2150
146 Ga0157379_10002828 3300014968 Bacteria 14629
147 Ga0157379_10015015 3300014968 Bacteria 6794
148 Ga0157379_10046138 3300014968 Bacteria 3889
149 Ga0157379_10088366 3300014968 Bacteria 2779
150 Ga0157379_10165405 3300014968 Bacteria 1996
151 Ga0157376_10011691 3300014969 Bacteria 6480
152 Ga0157376_10269547 3300014969 Unclassified 1599
153 Ga0163161_10107385 3300017792 Bacteria 2083
154 Ga0207427_105555 3300025231 Bacteria 1755
155 Ga0209233_1000006 3300025261 Bacteria 1473685
156 Ga0209233_1001131 3300025261 Bacteria 10884
157 Ga0209455_1009713 3300025272 Bacteria 2505
158 Ga0209758_1000008 3300025297 Bacteria 1215263
159 Ga0207642_10004601 3300025899 Bacteria 4456
160 Ga0207642_10020904 3300025899 Bacteria 2566
161 Ga0207680_10000273 3300025903 Bacteria 24719
162 Ga0207680_10059059 3300025903 Bacteria 2328
163 Ga0207645_10052043 3300025907 Bacteria 2616
164 Ga0207643_10029726 3300025908 Bacteria 3040
165 Ga0207705_10000039 3300025909 Bacteria 193592
166 Ga0207705_10036009 3300025909 Bacteria 3543
167 Ga0207654_10037377 3300025911 Bacteria 2718
168 Ga0207654_10044648 3300025911 Bacteria 2518
169 Ga0207654_10070047 3300025911 Bacteria 2081
170 Ga0207707_10000769 3300025912 Bacteria 31536
171 Ga0207707_10042360 3300025912 Bacteria 3974
172 Ga0207695_10000012 3300025913 Bacteria 840961
173 Ga0207695_10002080 3300025913 Bacteria 30492
174 Ga0207695_10009572 3300025913 Bacteria 11974
175 Ga0207695_10012896 3300025913 Bacteria 10003
176 Ga0207695_10028476 3300025913 Bacteria 6195
177 Ga0207695_10109966 3300025913 Bacteria 2737
178 Ga0207671_10004743 3300025914 Bacteria 12828
179 Ga0207671_10021912 3300025914 Bacteria 4840
180 Ga0207671_10222771 3300025914 Bacteria 1478
181 Ga0207693_10000127 3300025915 Bacteria 68379
182 Ga0207663_10015741 3300025916 Bacteria 4181
183 Ga0207660_10125599 3300025917 Bacteria 1948
184 Ga0207657_10000635 3300025919 Bacteria 37241
185 Ga0207657_10036878 3300025919 Bacteria 4373
186 Ga0207657_10087044 3300025919 Bacteria 2614
187 Ga0207649_10095022 3300025920 Bacteria 1960
188 Ga0207649_10328419 3300025920 Bacteria 1126
189 Ga0207649_10345577 3300025920 Bacteria 1100
190 Ga0207652_10000646 3300025921 Bacteria 34342
191 Ga0207652_10098169 3300025921 Bacteria 2583
192 Ga0207652_10161251 3300025921 Unclassified 2010
193 Ga0207694_10000006 3300025924 Bacteria 631109
194 Ga0207694_10030929 3300025924 Bacteria 4088
195 Ga0207694_10071913 3300025924 Bacteria 2703
196 Ga0207694_10073023 3300025924 Bacteria 2683
197 Ga0207659_10056998 3300025926 Bacteria 2800
198 Ga0207687_10153922 3300025927 Bacteria 1757
199 Ga0207664_10069212 3300025929 Bacteria 2838
200 Ga0207664_10406457 3300025929 Bacteria 1211
201 Ga0207690_10046663 3300025932 Bacteria 2871
202 Ga0207709_10013433 3300025935 Bacteria 4519
203 Ga0207704_10004897 3300025938 Bacteria 6151
204 Ga0207704_10222125 3300025938 Bacteria 1399
205 Ga0207711_10000001 3300025941 Bacteria 1325674
206 Ga0207689_10118546 3300025942 Bacteria 2177
207 Ga0207661_10128377 3300025944 Bacteria 2168
208 Ga0207661_10149822 3300025944 Bacteria 2016
209 Ga0207661_10275957 3300025944 Bacteria 1501
210 Ga0207667_10000026 3300025949 Bacteria 343713
211 Ga0207667_10012902 3300025949 Bacteria 9599
212 Ga0207667_10016323 3300025949 Bacteria 8393
213 Ga0207667_10025815 3300025949 Bacteria 6427
214 Ga0207667_10055842 3300025949 Bacteria 4150
215 Ga0207667_10139704 3300025949 Bacteria 2494
216 Ga0207651_10002795 3300025960 Bacteria 8389
217 Ga0207640_10330760 3300025981 Unclassified 1217
218 Ga0207677_10030275 3300026023 Bacteria 3452
219 Ga0207677_10436820 3300026023 Bacteria 1118
220 Ga0207703_10048234 3300026035 Bacteria 3437
221 Ga0207703_10055960 3300026035 Bacteria 3210
222 Ga0207639_10034923 3300026041 Bacteria 3719
223 Ga0207639_10075703 3300026041 Bacteria 2648
224 Ga0207639_10194443 3300026041 Bacteria 1735
225 Ga0207708_10053772 3300026075 Bacteria 3069
226 Ga0207702_10009008 3300026078 Bacteria 8404
227 Ga0207702_10106742 3300026078 Bacteria 2482
228 Ga0207702_10109875 3300026078 Bacteria 2449
229 Ga0207702_10284985 3300026078 Bacteria 1563
230 Ga0207702_10319231 3300026078 Bacteria 1479
231 Ga0207648_10005670 3300026089 Bacteria 12530
232 Ga0207648_10085158 3300026089 Bacteria 2757
233 Ga0207648_10263793 3300026089 Bacteria 1537
234 Ga0207674_10000051 3300026116 Bacteria 116114
235 Ga0207674_10103033 3300026116 Bacteria 2833
236 Ga0207674_10219653 3300026116 Bacteria 1849
237 Ga0207674_10227508 3300026116 Bacteria 1813
238 Ga0207674_10244244 3300026116 Bacteria 1742
239 Ga0207683_10004234 3300026121 Bacteria 12388
240 Ga0207683_10021177 3300026121 Bacteria 5564
241 Ga0207683_10188252 3300026121 Bacteria 1873
242 Ga0207698_10006384 3300026142 Bacteria 7349
243 Ga0207698_10195535 3300026142 Bacteria 1806
244 Ga0207698_10238146 3300026142 Bacteria 1656
245 Ga0268266_10023000 3300028379 Bacteria 5304
246 Ga0268266_10078017 3300028379 Bacteria 2881
247 Ga0268266_10152472 3300028379 Bacteria 2084
248 Ga0265334_10001489 3300028573 Bacteria 11297
249 Ga0265318_10000149 3300028577 Bacteria 63245
250 Ga0307517_10084697 3300028786 Unclassified 2665
251 Ga0265316_10055869 3300031344 Bacteria 3086
252 Ga0265314_10007012 3300031711 Bacteria 9848
253 Ga0265314_10011616 3300031711 Bacteria 7249
254 Ga0265314_10065437 3300031711 Bacteria 2455
255 Ga0265314_10097070 3300031711 Bacteria 1905
256 Ga0265342_10087455 3300031712 Bacteria 1790
257 Ga0265342_10126099 3300031712 Bacteria 1437
258 Ga0307516_10014219 3300031730 Bacteria 8431
259 Ga0307516_10016398 3300031730 Bacteria 7750
260 Ga0307516_10018729 3300031730 Bacteria 7189
261 Ga0373932_0019827 3300035112 Bacteria 1757
262 Ga0373945_0031505 3300035116 Bacteria 1874
263 Ga0373956_0017930 3300035119 Bacteria 2993
264 Ga0373943_0005105 3300035170 Bacteria 5911
265 Ga0373946_0010752 3300035171 Bacteria 3398
266 Ga0373955_0002835 3300035172 Bacteria 7609
267 Ga0373927_0244696 3300035695 Unclassified 1179
268 Ga0373933_0004214 3300035724 Bacteria 7931
269 Ga0373947_0053596 3300035725 Bacteria 2432
270 Ga0373937_0000338 3300036401 Bacteria 44355
271 Ga0373937_0009680 3300036401 Bacteria 8395
272 Ga0373937_0337905 3300036401 Bacteria 1426
273 Ga0373925_0063002 3300037068 Bacteria 2789
274 Ga0373925_0129245 3300037068 Bacteria 1968
275 Ga0395900_0354054 3300037418 Bacteria 1441
276 Ga0395898_0036238 3300037466 Bacteria 4899
277 Ga0395901_0127703 3300038443 Bacteria 2672
278 Ga0436365_0623649 3300039437 Bacteria 7202
279 Ga0466964_0145422 3300044706 Unclassified 1094
280 Ga0466957_0104400 3300044842 Bacteria 1790
281 Ga0466967_0082551 3300045976 Bacteria 2905
282 Ga0495580_0040004 3300046472 Bacteria 3353
283 Ga0495664_0046418 3300046477 Bacteria 2577
284 Ga0495585_0177219 3300046492 Bacteria 1098
285 Ga0495652_0188538 3300046529 Bacteria 1576
286 Ga0495587_0071155 3300046536 Bacteria 2023
287 Ga0495645_0006666 3300046543 Bacteria 8021
288 Ga0495622_0008465 3300046557 Bacteria 4762
289 Ga0495667_0063831 3300046559 Bacteria 2410
290 Ga0495661_0098531 3300046665 Unclassified 1650
291 Ga0495623_0041397 3300046679 Bacteria 2938
292 Ga0495669_0090109 3300046684 Unclassified 1415
293 Ga0495589_0034083 3300046794 Bacteria 2556
294 Ga0495602_0086190 3300048088 Bacteria 2622
295 Ga0496107_0174372 3300048910 Bacteria 1596
296 Ga0496121_0004108 3300048924 Bacteria 19960
297 Ga0495682_0004965 3300049460 Bacteria 5597
298 Ga0501031_0064017 3300049568 Bacteria 2395
299 Ga0501032_0105216 3300049569 Bacteria 1869
300 Ga0501033_0005022 3300049570 Bacteria 10534
301 Ga0501036_0094866 3300049572 Bacteria 2522
302 Ga0501036_0238582 3300049572 Bacteria 1525
303 Ga0501037_0176187 3300049573 Bacteria 1519
304 Ga0501043_0105097 3300049579 Bacteria 2219
305 Ga0501043_0145409 3300049579 Bacteria 1857
306 Ga0501047_0025878 3300049581 Bacteria 5642
307 Ga0501047_0120764 3300049581 Bacteria 2503
308 Ga0501047_0186837 3300049581 Bacteria 1937
309 Ga0501047_0327555 3300049581 Bacteria 1370
310 Ga0501070_0000248 3300049586 Bacteria 50746
311 Ga0501070_0145821 3300049586 Bacteria 1954
312 Ga0501070_0246557 3300049586 Bacteria 1462
313 Ga0501080_0000117 3300049742 Bacteria 55452
314 Ga0501080_0112221 3300049742 Bacteria 2527
315 Ga0501080_0125616 3300049742 Bacteria 2376
316 Ga0501035_0007689 3300049822 Bacteria 10072
317 Ga0501035_0034788 3300049822 Bacteria 4577
318 Ga0501035_0049961 3300049822 Bacteria 3749
319 Ga0501044_0007630 3300049823 Bacteria 11899
320 Ga0501044_0040341 3300049823 Bacteria 4865
321 Ga0501044_0159275 3300049823 Bacteria 2235
322 nmdc:mga0n895_106545_c1 3300050512 Bacteria 2816
323 nmdc:mga08x19_26540_c1 3300050514 Bacteria 3615
324 Ga0500635_0007146 3300053080 Bacteria 3017
325 Ga0500595_000533 3300053119 Bacteria 22936
326 Ga0500595_018940 3300053119 Bacteria 2507
327 Ga0500573_0000032 3300053140 Bacteria 131098
328 Ga0500645_030635 3300053730 Bacteria 1618

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005577 Ga0068857_100211750 Ga0068857_1002117502 250
2 3300025924 Ga0207694_10071913 Ga0207694_100719132 250
3 3300026116 Ga0207674_10227508 Ga0207674_102275082 250
4 3300009545 Ga0105237_10057417 Ga0105237_100574171 257
5 3300049569 Ga0501032_0105216 Ga0501032_0105216_963_1814 258
6 3300009174 Ga0105241_10029880 Ga0105241_100298804 267
7 3300009177 Ga0105248_10000001 Ga0105248_100000011780 267
8 3300025913 Ga0207695_10028476 Ga0207695_100284765 267
9 3300025941 Ga0207711_10000001 Ga0207711_1000000192 267
10 3300005616 Ga0068852_100013727 Ga0068852_1000137275 268
11 3300013296 Ga0157374_10103175 Ga0157374_101031753 268
12 3300039437 Ga0436365_0623649 Ga0436365_0623649_644_1609 268
13 3300003320 rootH2_10000706 rootH2_100007062 271
14 3300049581 Ga0501047_0120764 Ga0501047_0120764_1103_2074 273
15 3300049586 Ga0501070_0246557 Ga0501070_0246557_368_1312 273
16 3300028573 Ga0265334_10001489 Ga0265334_100014893 274
17 3300031344 Ga0265316_10055869 Ga0265316_100558693 274
18 3300031711 Ga0265314_10065437 Ga0265314_100654372 274
19 3300005335 Ga0070666_10000793 Ga0070666_1000079318 276
20 3300005367 Ga0070667_100015457 Ga0070667_1000154575 276
21 3300005548 Ga0070665_100301931 Ga0070665_1003019312 276
22 3300005563 Ga0068855_100014947 Ga0068855_1000149479 276
23 3300025903 Ga0207680_10000273 Ga0207680_100002734 276
24 3300025949 Ga0207667_10025815 Ga0207667_100258152 276
25 3300031712 Ga0265342_10087455 Ga0265342_100874552 276
26 3300005434 Ga0070709_10002917 Ga0070709_100029175 279
27 3300005436 Ga0070713_100000006 Ga0070713_100000006153 279
28 3300005439 Ga0070711_100123341 Ga0070711_1001233412 279
29 3300005440 Ga0070705_100163615 Ga0070705_1001636152 279
30 3300005614 Ga0068856_100000280 Ga0068856_10000028051 279
31 3300006173 Ga0070716_100020933 Ga0070716_1000209334 279
32 3300006175 Ga0070712_100000184 Ga0070712_10000018417 279
33 3300006871 Ga0075434_100213709 Ga0075434_1002137092 279
34 3300006914 Ga0075436_100001960 Ga0075436_1000019601 279
35 3300006914 Ga0075436_100035786 Ga0075436_1000357862 279
36 3300013105 Ga0157369_10016326 Ga0157369_100163266 279
37 3300014325 Ga0163163_10181879 Ga0163163_101818792 279
38 3300014968 Ga0157379_10046138 Ga0157379_100461382 279
39 3300035112 Ga0373932_0019827 Ga0373932_0019827_39_1007 279
40 3300037068 Ga0373925_0129245 Ga0373925_0129245_407_1375 279
41 3300050512 nmdc:mga0n895_106545_c1 nmdc:mga0n895_106545_c1_1462_2430 279
42 3300031711 Ga0265314_10007012 Ga0265314_100070129 282
43 3300046472 Ga0495580_0040004 Ga0495580_0040004_1201_2169 284
44 3300035119 Ga0373956_0017930 Ga0373956_0017930_883_1851 285
45 3300035172 Ga0373955_0002835 Ga0373955_0002835_522_1490 285
46 3300035724 Ga0373933_0004214 Ga0373933_0004214_2237_3205 285
47 3300036401 Ga0373937_0009680 Ga0373937_0009680_3580_4548 285
48 3300046679 Ga0495623_0041397 Ga0495623_0041397_1722_2690 285
49 3300049572 Ga0501036_0238582 Ga0501036_0238582_524_1489 287
50 3300005614 Ga0068856_100358953 Ga0068856_1003589532 288
51 3300014968 Ga0157379_10015015 Ga0157379_100150156 288
52 3300036401 Ga0373937_0000338 Ga0373937_0000338_5875_6843 288
53 3300037068 Ga0373925_0063002 Ga0373925_0063002_961_1929 288
54 3300048910 Ga0496107_0174372 Ga0496107_0174372_134_1102 288
55 3300005439 Ga0070711_100026563 Ga0070711_1000265632 290
56 3300005456 Ga0070678_100001382 Ga0070678_1000013822 290
57 3300005459 Ga0068867_100058953 Ga0068867_1000589532 290
58 3300005718 Ga0068866_10042862 Ga0068866_100428622 290
59 3300006175 Ga0070712_100000907 Ga0070712_10000090714 290
60 3300006237 Ga0097621_100028078 Ga0097621_1000280783 290
61 3300006358 Ga0068871_100100018 Ga0068871_1001000182 290
62 3300006881 Ga0068865_100003481 Ga0068865_1000034818 290
63 3300009176 Ga0105242_10004849 Ga0105242_100048492 290
64 3300013306 Ga0163162_10207319 Ga0163162_102073192 290
65 3300014969 Ga0157376_10011691 Ga0157376_100116915 290
66 3300017792 Ga0163161_10107385 Ga0163161_101073851 290
67 3300025899 Ga0207642_10004601 Ga0207642_100046013 290
68 3300025915 Ga0207693_10000127 Ga0207693_1000012712 290
69 3300025916 Ga0207663_10015741 Ga0207663_100157412 290
70 3300025938 Ga0207704_10004897 Ga0207704_100048973 290
71 3300026089 Ga0207648_10085158 Ga0207648_100851582 290
72 3300026121 Ga0207683_10004234 Ga0207683_100042343 290
73 3300036401 Ga0373937_0337905 Ga0373937_0337905_268_1215 290
74 3300005327 Ga0070658_10014729 Ga0070658_100147292 293
75 3300005335 Ga0070666_10085614 Ga0070666_100856142 293
76 3300005338 Ga0068868_100094285 Ga0068868_1000942852 293
77 3300005344 Ga0070661_100193444 Ga0070661_1001934442 293
78 3300005530 Ga0070679_100078471 Ga0070679_1000784712 293
79 3300005548 Ga0070665_100002423 Ga0070665_1000024234 293
80 3300025903 Ga0207680_10059059 Ga0207680_100590592 293
81 3300025919 Ga0207657_10087044 Ga0207657_100870443 293
82 3300025921 Ga0207652_10161251 Ga0207652_101612512 293
83 3300025981 Ga0207640_10330760 Ga0207640_103307602 293
84 3300026023 Ga0207677_10436820 Ga0207677_104368201 293
85 3300028379 Ga0268266_10023000 Ga0268266_100230002 293
86 3300005329 Ga0070683_100323471 Ga0070683_1003234712 294
87 3300005435 Ga0070714_100082431 Ga0070714_1000824312 294
88 3300005530 Ga0070679_100042833 Ga0070679_1000428335 294
89 3300005614 Ga0068856_100446338 Ga0068856_1004463381 294
90 3300013307 Ga0157372_10006484 Ga0157372_100064846 294
91 3300025917 Ga0207660_10125599 Ga0207660_101255992 294
92 3300025921 Ga0207652_10098169 Ga0207652_100981692 294
93 3300025929 Ga0207664_10069212 Ga0207664_100692122 294
94 3300025944 Ga0207661_10275957 Ga0207661_102759571 294
95 3300026078 Ga0207702_10284985 Ga0207702_102849852 294
96 3300031711 Ga0265314_10097070 Ga0265314_100970702 294
97 3300031712 Ga0265342_10126099 Ga0265342_101260992 294
98 3300046536 Ga0495587_0071155 Ga0495587_0071155_620_1585 294
99 3300048088 Ga0495602_0086190 Ga0495602_0086190_550_1515 294
100 3300049573 Ga0501037_0176187 Ga0501037_0176187_276_1235 294
101 3300049579 Ga0501043_0145409 Ga0501043_0145409_280_1239 294
102 3300049586 Ga0501070_0145821 Ga0501070_0145821_560_1519 294
103 3300049742 Ga0501080_0112221 Ga0501080_0112221_352_1311 294
104 3300049823 Ga0501044_0159275 Ga0501044_0159275_215_1174 294
105 3300003320 rootH2_10026210 rootH2_100262102 295
106 3300005327 Ga0070658_10061267 Ga0070658_100612673 295
107 3300005330 Ga0070690_100382934 Ga0070690_1003829341 295
108 3300005336 Ga0070680_100054857 Ga0070680_1000548573 295
109 3300005339 Ga0070660_100003852 Ga0070660_1000038525 295
110 3300005341 Ga0070691_10003126 Ga0070691_100031264 295
111 3300005366 Ga0070659_100023192 Ga0070659_1000231922 295
112 3300005458 Ga0070681_10087651 Ga0070681_100876513 295
113 3300005539 Ga0068853_100086897 Ga0068853_1000868973 295
114 3300005539 Ga0068853_100110356 Ga0068853_1001103562 295
115 3300005548 Ga0070665_100031215 Ga0070665_1000312153 295
116 3300005563 Ga0068855_100000529 Ga0068855_10000052921 295
117 3300005842 Ga0068858_100072648 Ga0068858_1000726481 295
118 3300009093 Ga0105240_10000055 Ga0105240_10000055213 295
119 3300009093 Ga0105240_10011873 Ga0105240_1001187310 295
120 3300009093 Ga0105240_10368989 Ga0105240_103689892 295
121 3300009093 Ga0105240_10542971 Ga0105240_105429712 295
122 3300009174 Ga0105241_10090352 Ga0105241_100903522 295
123 3300009174 Ga0105241_10177822 Ga0105241_101778222 295
124 3300009176 Ga0105242_10144201 Ga0105242_101442012 295
125 3300009551 Ga0105238_10001657 Ga0105238_100016572 295
126 3300009551 Ga0105238_10025837 Ga0105238_100258372 295
127 3300009551 Ga0105238_10069037 Ga0105238_100690373 295
128 3300010375 Ga0105239_10001057 Ga0105239_100010574 295
129 3300013104 Ga0157370_10001892 Ga0157370_1000189223 295
130 3300013104 Ga0157370_10232759 Ga0157370_102327592 295
131 3300013105 Ga0157369_10003278 Ga0157369_100032785 295
132 3300013306 Ga0163162_10002450 Ga0163162_1000245014 295
133 3300014325 Ga0163163_10000021 Ga0163163_10000021152 295
134 3300014968 Ga0157379_10002828 Ga0157379_1000282813 295
135 3300014969 Ga0157376_10269547 Ga0157376_102695472 295
136 3300025909 Ga0207705_10000039 Ga0207705_1000003989 295
137 3300025911 Ga0207654_10037377 Ga0207654_100373772 295
138 3300025912 Ga0207707_10000769 Ga0207707_100007694 295
139 3300025913 Ga0207695_10000012 Ga0207695_10000012124 295
140 3300025919 Ga0207657_10000635 Ga0207657_100006358 295
141 3300025920 Ga0207649_10328419 Ga0207649_103284191 295
142 3300025920 Ga0207649_10345577 Ga0207649_103455771 295
143 3300025921 Ga0207652_10000646 Ga0207652_1000064631 295
144 3300025924 Ga0207694_10000006 Ga0207694_10000006541 295
145 3300025924 Ga0207694_10030929 Ga0207694_100309292 295
146 3300025932 Ga0207690_10046663 Ga0207690_100466633 295
147 3300025944 Ga0207661_10149822 Ga0207661_101498222 295
148 3300025949 Ga0207667_10000026 Ga0207667_10000026270 295
149 3300025949 Ga0207667_10016323 Ga0207667_100163234 295
150 3300026035 Ga0207703_10048234 Ga0207703_100482342 295
151 3300026041 Ga0207639_10075703 Ga0207639_100757033 295
152 3300026142 Ga0207698_10006384 Ga0207698_100063845 295
153 3300026142 Ga0207698_10195535 Ga0207698_101955352 295
154 3300028577 Ga0265318_10000149 Ga0265318_1000014952 295
155 3300031711 Ga0265314_10011616 Ga0265314_100116162 295
156 3300031730 Ga0307516_10016398 Ga0307516_100163982 295
157 3300048924 Ga0496121_0004108 Ga0496121_0004108_12374_13339 295
158 3300049460 Ga0495682_0004965 Ga0495682_0004965_846_1814 295
159 3300049568 Ga0501031_0064017 Ga0501031_0064017_265_1230 295
160 3300049572 Ga0501036_0094866 Ga0501036_0094866_151_1116 295
161 3300049581 Ga0501047_0186837 Ga0501047_0186837_471_1439 295
162 3300049586 Ga0501070_0000248 Ga0501070_0000248_13717_14682 295
163 3300049742 Ga0501080_0000117 Ga0501080_0000117_932_1897 295
164 3300049822 Ga0501035_0007689 Ga0501035_0007689_8707_9672 295
165 3300049822 Ga0501035_0049961 Ga0501035_0049961_2639_3604 295
166 3300049823 Ga0501044_0040341 Ga0501044_0040341_780_1745 295
167 3300053119 Ga0500595_000533 Ga0500595_000533_6255_7217 295
168 3300053730 Ga0500645_030635 Ga0500645_030635_487_1449 295
169 3300005341 Ga0070691_10001501 Ga0070691_100015016 296
170 3300005435 Ga0070714_100310225 Ga0070714_1003102251 296
171 3300005548 Ga0070665_100109077 Ga0070665_1001090772 296
172 3300005563 Ga0068855_100123784 Ga0068855_1001237843 296
173 3300005563 Ga0068855_100347492 Ga0068855_1003474922 296
174 3300005577 Ga0068857_100000387 Ga0068857_10000038711 296
175 3300005614 Ga0068856_100076260 Ga0068856_1000762602 296
176 3300005614 Ga0068856_100165931 Ga0068856_1001659312 296
177 3300005616 Ga0068852_100225825 Ga0068852_1002258252 296
178 3300006358 Ga0068871_100229513 Ga0068871_1002295132 296
179 3300006881 Ga0068865_100103647 Ga0068865_1001036472 296
180 3300006914 Ga0075436_100038227 Ga0075436_1000382271 296
181 3300009093 Ga0105240_10006992 Ga0105240_1000699216 296
182 3300009093 Ga0105240_10017901 Ga0105240_100179014 296
183 3300009093 Ga0105240_10153135 Ga0105240_101531352 296
184 3300009174 Ga0105241_10144122 Ga0105241_101441222 296
185 3300009545 Ga0105237_10031638 Ga0105237_100316383 296
186 3300009545 Ga0105237_10344293 Ga0105237_103442932 296
187 3300009551 Ga0105238_10231794 Ga0105238_102317942 296
188 3300010375 Ga0105239_10186830 Ga0105239_101868302 296
189 3300010375 Ga0105239_10330199 Ga0105239_103301992 296
190 3300013100 Ga0157373_10094036 Ga0157373_100940362 296
191 3300013104 Ga0157370_10000438 Ga0157370_1000043826 296
192 3300014968 Ga0157379_10165405 Ga0157379_101654052 296
193 3300025911 Ga0207654_10044648 Ga0207654_100446482 296
194 3300025911 Ga0207654_10070047 Ga0207654_100700471 296
195 3300025913 Ga0207695_10002080 Ga0207695_1000208016 296
196 3300025913 Ga0207695_10012896 Ga0207695_100128969 296
197 3300025913 Ga0207695_10109966 Ga0207695_101099662 296
198 3300025914 Ga0207671_10004743 Ga0207671_100047435 296
199 3300025914 Ga0207671_10222771 Ga0207671_102227712 296
200 3300025924 Ga0207694_10073023 Ga0207694_100730232 296
201 3300025929 Ga0207664_10406457 Ga0207664_104064572 296
202 3300025938 Ga0207704_10222125 Ga0207704_102221251 296
203 3300025949 Ga0207667_10012902 Ga0207667_100129022 296
204 3300025949 Ga0207667_10139704 Ga0207667_101397042 296
205 3300026041 Ga0207639_10034923 Ga0207639_100349233 296
206 3300026078 Ga0207702_10009008 Ga0207702_100090085 296
207 3300026078 Ga0207702_10109875 Ga0207702_101098752 296
208 3300026116 Ga0207674_10000051 Ga0207674_1000005165 296
209 3300026142 Ga0207698_10238146 Ga0207698_102381462 296
210 3300035116 Ga0373945_0031505 Ga0373945_0031505_98_1078 296
211 3300035170 Ga0373943_0005105 Ga0373943_0005105_1858_2838 296
212 3300035171 Ga0373946_0010752 Ga0373946_0010752_1684_2664 296
213 3300035695 Ga0373927_0244696 Ga0373927_0244696_152_1132 296
214 3300035725 Ga0373947_0053596 Ga0373947_0053596_1115_2095 296
215 3300046477 Ga0495664_0046418 Ga0495664_0046418_750_1721 296
216 3300046529 Ga0495652_0188538 Ga0495652_0188538_407_1378 296
217 3300046543 Ga0495645_0006666 Ga0495645_0006666_1717_2688 296
218 3300046559 Ga0495667_0063831 Ga0495667_0063831_954_1925 296
219 3300049570 Ga0501033_0005022 Ga0501033_0005022_6292_7263 296
220 3300049579 Ga0501043_0105097 Ga0501043_0105097_879_1850 296
221 3300049581 Ga0501047_0025878 Ga0501047_0025878_109_1080 296
222 3300049581 Ga0501047_0327555 Ga0501047_0327555_170_1135 296
223 3300049742 Ga0501080_0125616 Ga0501080_0125616_918_1889 296
224 3300049822 Ga0501035_0034788 Ga0501035_0034788_881_1852 296
225 3300049823 Ga0501044_0007630 Ga0501044_0007630_6407_7378 296
226 3300050514 nmdc:mga08x19_26540_c1 nmdc:mga08x19_26540_c1_1606_2574 296
227 3300005334 Ga0068869_100011842 Ga0068869_1000118422 297
228 3300005355 Ga0070671_100215953 Ga0070671_1002159532 297
229 3300005364 Ga0070673_100011937 Ga0070673_1000119376 297
230 3300005438 Ga0070701_10115085 Ga0070701_101150852 297
231 3300005439 Ga0070711_100186250 Ga0070711_1001862502 297
232 3300005458 Ga0070681_10081181 Ga0070681_100811813 297
233 3300005459 Ga0068867_100010139 Ga0068867_1000101392 297
234 3300005530 Ga0070679_100060027 Ga0070679_1000600273 297
235 3300005548 Ga0070665_100008064 Ga0070665_1000080649 297
236 3300005718 Ga0068866_10078609 Ga0068866_100786092 297
237 3300006237 Ga0097621_100209176 Ga0097621_1002091762 297
238 3300009098 Ga0105245_10223986 Ga0105245_102239862 297
239 3300009148 Ga0105243_10022693 Ga0105243_100226935 297
240 3300013297 Ga0157378_10132861 Ga0157378_101328612 297
241 3300025899 Ga0207642_10020904 Ga0207642_100209042 297
242 3300025907 Ga0207645_10052043 Ga0207645_100520432 297
243 3300025908 Ga0207643_10029726 Ga0207643_100297262 297
244 3300025912 Ga0207707_10042360 Ga0207707_100423603 297
245 3300025919 Ga0207657_10036878 Ga0207657_100368783 297
246 3300025926 Ga0207659_10056998 Ga0207659_100569982 297
247 3300025927 Ga0207687_10153922 Ga0207687_101539222 297
248 3300025935 Ga0207709_10013433 Ga0207709_100134335 297
249 3300025942 Ga0207689_10118546 Ga0207689_101185462 297
250 3300025960 Ga0207651_10002795 Ga0207651_100027952 297
251 3300026075 Ga0207708_10053772 Ga0207708_100537722 297
252 3300026078 Ga0207702_10319231 Ga0207702_103192312 297
253 3300026089 Ga0207648_10005670 Ga0207648_1000567013 297
254 3300028379 Ga0268266_10152472 Ga0268266_101524722 297
255 3300037418 Ga0395900_0354054 Ga0395900_0354054_263_1240 297
256 3300037466 Ga0395898_0036238 Ga0395898_0036238_1348_2325 297
257 3300038443 Ga0395901_0127703 Ga0395901_0127703_464_1441 297
258 3300046665 Ga0495661_0098531 Ga0495661_0098531_509_1477 297
259 3300046684 Ga0495669_0090109 Ga0495669_0090109_138_1106 297
260 3300003214 JGI25165J46597_1000080 JGI25165J46597_100008016 298
261 3300005327 Ga0070658_10116997 Ga0070658_101169972 298
262 3300005331 Ga0070670_100257921 Ga0070670_1002579211 298
263 3300005338 Ga0068868_100122579 Ga0068868_1001225792 298
264 3300005535 Ga0070684_100047353 Ga0070684_1000473533 298
265 3300005539 Ga0068853_100180004 Ga0068853_1001800042 298
266 3300005547 Ga0070693_100118662 Ga0070693_1001186622 298
267 3300005548 Ga0070665_100103996 Ga0070665_1001039962 298
268 3300005548 Ga0070665_100384611 Ga0070665_1003846112 298
269 3300005563 Ga0068855_100004964 Ga0068855_10000496414 298
270 3300005577 Ga0068857_100100720 Ga0068857_1001007202 298
271 3300005614 Ga0068856_100066445 Ga0068856_1000664453 298
272 3300005618 Ga0068864_100105179 Ga0068864_1001051793 298
273 3300006237 Ga0097621_100194799 Ga0097621_1001947992 298
274 3300006358 Ga0068871_100000875 Ga0068871_1000008752 298
275 3300006358 Ga0068871_100221982 Ga0068871_1002219822 298
276 3300009093 Ga0105240_10006323 Ga0105240_100063234 298
277 3300009174 Ga0105241_10042687 Ga0105241_100426872 298
278 3300009174 Ga0105241_10165225 Ga0105241_101652252 298
279 3300009174 Ga0105241_10436113 Ga0105241_104361131 298
280 3300009176 Ga0105242_10368405 Ga0105242_103684052 298
281 3300009177 Ga0105248_10368527 Ga0105248_103685272 298
282 3300009177 Ga0105248_10390949 Ga0105248_103909491 298
283 3300009545 Ga0105237_10038550 Ga0105237_100385505 298
284 3300009545 Ga0105237_10054437 Ga0105237_100544373 298
285 3300009545 Ga0105237_10074265 Ga0105237_100742651 298
286 3300009545 Ga0105237_10518650 Ga0105237_105186501 298
287 3300009551 Ga0105238_10028464 Ga0105238_100284645 298
288 3300009551 Ga0105238_10033742 Ga0105238_100337424 298
289 3300010375 Ga0105239_10232472 Ga0105239_102324722 298
290 3300010375 Ga0105239_10256636 Ga0105239_102566362 298
291 3300011119 Ga0105246_10010785 Ga0105246_100107854 298
292 3300013105 Ga0157369_10169898 Ga0157369_101698982 298
293 3300013296 Ga0157374_10023596 Ga0157374_100235962 298
294 3300014968 Ga0157379_10088366 Ga0157379_100883662 298
295 3300025231 Ga0207427_105555 Ga0207427_1055552 298
296 3300025261 Ga0209233_1000006 Ga0209233_1000006811 298
297 3300025261 Ga0209233_1001131 Ga0209233_10011312 298
298 3300025272 Ga0209455_1009713 Ga0209455_10097132 298
299 3300025297 Ga0209758_1000008 Ga0209758_1000008134 298
300 3300025909 Ga0207705_10036009 Ga0207705_100360092 298
301 3300025913 Ga0207695_10009572 Ga0207695_100095724 298
302 3300025914 Ga0207671_10021912 Ga0207671_100219122 298
303 3300025920 Ga0207649_10095022 Ga0207649_100950222 298
304 3300025944 Ga0207661_10128377 Ga0207661_101283772 298
305 3300025949 Ga0207667_10055842 Ga0207667_100558423 298
306 3300026023 Ga0207677_10030275 Ga0207677_100302752 298
307 3300026035 Ga0207703_10055960 Ga0207703_100559604 298
308 3300026041 Ga0207639_10194443 Ga0207639_101944432 298
309 3300026078 Ga0207702_10106742 Ga0207702_101067422 298
310 3300026089 Ga0207648_10263793 Ga0207648_102637932 298
311 3300026116 Ga0207674_10103033 Ga0207674_101030332 298
312 3300026116 Ga0207674_10219653 Ga0207674_102196532 298
313 3300026116 Ga0207674_10244244 Ga0207674_102442442 298
314 3300026121 Ga0207683_10021177 Ga0207683_100211772 298
315 3300026121 Ga0207683_10188252 Ga0207683_101882522 298
316 3300028379 Ga0268266_10078017 Ga0268266_100780172 298
317 3300028786 Ga0307517_10084697 Ga0307517_100846971 298
318 3300031730 Ga0307516_10014219 Ga0307516_100142193 298
319 3300031730 Ga0307516_10018729 Ga0307516_100187296 298
320 3300044706 Ga0466964_0145422 Ga0466964_0145422_112_1083 298
321 3300044842 Ga0466957_0104400 Ga0466957_0104400_511_1482 298
322 3300045976 Ga0466967_0082551 Ga0466967_0082551_291_1262 298
323 3300046492 Ga0495585_0177219 Ga0495585_0177219_74_1045 298
324 3300046557 Ga0495622_0008465 Ga0495622_0008465_1436_2407 298
325 3300046794 Ga0495589_0034083 Ga0495589_0034083_1206_2177 298
326 3300053080 Ga0500635_0007146 Ga0500635_0007146_28_999 298
327 3300053119 Ga0500595_018940 Ga0500595_018940_890_1861 298
328 3300053140 Ga0500573_0000032 Ga0500573_0000032_104534_105505 298

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00482

T2SSF

Type II secretion system (T2SS), protein F

158

285

0.97

Feature Viewer

pLDDT pTM Quality
57.8 0.37 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map