F409162

General Info

Members Datasets Scaffolds Average Seq Length
328 210 656 417

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_100021140|Ga0068852_1000211402
Length 477
Sequence MVGKPNFKLPILPSMPDTSPTRAIAITEPPVADSQPRWFQRGGLWSFFGPAFIASIAYMDPGNFATNILAGSKFGYRLLWVLLWSNAMAILIQYLSAKLGIVTGLTLPQNCRRHFSRATTLWLWAAAEIGAIATDLAEFLGAAIGLDLLCGPFLYAHGYSPRGALIFAAVVTAVXXXXILALELAGYQWLERGIMGFVGIIGLCYGFEVFLVHPDWKLASLHTLLPMLDHSSAAATRESIYVAVGMLGATVMPHVVYLHSALVQPRLKELTAAGISSVQPEALRPIEVPRRTILARFLHFERIDVLVAMNGAWLINSGMVVVAACAFIRAPEASPSIQEAYQTLGPLFGHAAAVVFAVALLCSGLSSSTVGVMAGQVIIEGFLNIQFPVFVRRLITIIPALVVIASGMDPLRILVLSQVVLSFALPFALIPLLLLTNRSDVMQSFVSRRPIRIAGWLCVIVILTLNAILLIQTALGS

Samples

Sample ID Description Type Environment
1 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
106 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
111 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
112 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
113 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
114 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
115 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
116 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
117 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
118 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
119 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
127 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
130 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
131 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
132 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
133 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
134 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
135 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
140 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
152 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
165 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
166 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
169 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
170 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
171 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
174 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
175 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
176 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
197 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
198 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
199 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
203 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
204 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
205 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
206 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
207 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
208 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
209 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
210 2904504865 Serratia marcescens 1822 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.09
Metatranscriptomes 0.3
Isolates 0.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.91
Nodule 0
Rhizoplane 10.98
Rhizosphere 84.76
Stem 0
Stem Tuber 0
Unclassified 1.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068852_100021140 3300005616 Bacteria 5187
2 LJNas_1000033 3300000546 Bacteria 18473
3 JGI25162J39368_1000006 3300002737 Bacteria 405267
4 rootL2_10112858 3300003322 Bacteria 1935
5 Ga0070658_10002637 3300005327 Bacteria 14938
6 Ga0070658_10009479 3300005327 Bacteria 7824
7 Ga0070683_100026694 3300005329 Bacteria 5204
8 Ga0070683_100102023 3300005329 Bacteria 2702
9 Ga0070690_100057946 3300005330 Bacteria 2486
10 Ga0070670_100144580 3300005331 Bacteria 2057
11 Ga0070680_100000376 3300005336 Bacteria 30125
12 Ga0070682_100007327 3300005337 Bacteria 6222
13 Ga0070682_100061591 3300005337 Bacteria 2375
14 Ga0068868_100002651 3300005338 Bacteria 12425
15 Ga0070691_10029916 3300005341 Bacteria 2550
16 Ga0070675_100091918 3300005354 Bacteria 2543
17 Ga0070674_100056016 3300005356 Bacteria 2733
18 Ga0070688_100042584 3300005365 Bacteria 2794
19 Ga0070659_100006596 3300005366 Bacteria 8383
20 Ga0070659_100033273 3300005366 Bacteria 4003
21 Ga0070709_10016038 3300005434 Unclassified 4269
22 Ga0070709_10037508 3300005434 Bacteria 2960
23 Ga0070714_100049182 3300005435 Bacteria 3588
24 Ga0070711_100194635 3300005439 Bacteria 1560
25 Ga0070663_100068541 3300005455 Bacteria 2576
26 Ga0070678_100025853 3300005456 Bacteria 3958
27 Ga0070681_10000877 3300005458 Bacteria 25356
28 Ga0070681_10161213 3300005458 Bacteria 2167
29 Ga0070679_100000292 3300005530 Bacteria 42564
30 Ga0070679_100000387 3300005530 Bacteria 37548
31 Ga0070679_100029657 3300005530 Bacteria 5397
32 Ga0070684_100002145 3300005535 Bacteria 14555
33 Ga0070684_100020372 3300005535 Bacteria 5503
34 Ga0070684_100169966 3300005535 Bacteria 1980
35 Ga0068853_100003031 3300005539 Bacteria 12827
36 Ga0068853_100007905 3300005539 Bacteria 8529
37 Ga0070696_100024503 3300005546 Bacteria 4102
38 Ga0070693_100012405 3300005547 Bacteria 4312
39 Ga0068855_100004785 3300005563 Bacteria 16523
40 Ga0068855_100010324 3300005563 Bacteria 11262
41 Ga0068855_100056374 3300005563 Bacteria 4611
42 Ga0068855_100147564 3300005563 Bacteria 2676
43 Ga0070664_100039320 3300005564 Bacteria 3986
44 Ga0068857_100002973 3300005577 Bacteria 13966
45 Ga0068857_100090813 3300005577 Bacteria 2733
46 Ga0068857_100250353 3300005577 Bacteria 1624
47 Ga0068854_100050962 3300005578 Bacteria 2964
48 Ga0068854_100089962 3300005578 Bacteria 2282
49 Ga0068854_100090122 3300005578 Bacteria 2280
50 Ga0068856_100004356 3300005614 Bacteria 14103
51 Ga0070702_100014765 3300005615 Bacteria 3970
52 Ga0068852_100013585 3300005616 Bacteria 6234
53 Ga0068852_100020667 3300005616 Bacteria 5237
54 Ga0068852_100084741 3300005616 Bacteria 2821
55 Ga0068852_100121493 3300005616 Bacteria 2392
56 Ga0068866_10080026 3300005718 Bacteria 1752
57 Ga0081538_10070162 3300005981 Bacteria 1936
58 Ga0081540_1023158 3300005983 Bacteria 3643
59 Ga0070717_10110197 3300006028 Bacteria 2347
60 Ga0070717_10119061 3300006028 Bacteria 2260
61 Ga0097621_100063324 3300006237 Bacteria 3039
62 Ga0068871_100127663 3300006358 Bacteria 2154
63 Ga0075433_10197885 3300006852 Bacteria 1787
64 Ga0075434_100000702 3300006871 Bacteria 26156
65 Ga0075436_100014916 3300006914 Bacteria 5324
66 Ga0075436_100043164 3300006914 Bacteria 3109
67 Ga0075435_100002769 3300007076 Bacteria 11712
68 Ga0105250_10000002 3300009092 Bacteria 566949
69 Ga0105240_10000001 3300009093 Bacteria 2887840
70 Ga0105240_10001955 3300009093 Bacteria 34127
71 Ga0105240_10095142 3300009093 Bacteria 3632
72 Ga0105240_10142103 3300009093 Bacteria 2869
73 Ga0105240_10197535 3300009093 Bacteria 2360
74 Ga0105240_10362124 3300009093 Bacteria 1642
75 Ga0111539_10233813 3300009094 Bacteria 2140
76 Ga0105245_10009712 3300009098 Bacteria 8393
77 Ga0105245_10018485 3300009098 Bacteria 6095
78 Ga0105245_10023868 3300009098 Bacteria 5367
79 Ga0105241_10040236 3300009174 Bacteria 3528
80 Ga0105241_10052845 3300009174 Bacteria 3104
81 Ga0105241_10095968 3300009174 Bacteria 2348
82 Ga0105241_10123967 3300009174 Bacteria 2084
83 Ga0105237_10044106 3300009545 Bacteria 4491
84 Ga0105238_10007578 3300009551 Bacteria 10872
85 Ga0105238_10015765 3300009551 Bacteria 7651
86 Ga0105238_10038116 3300009551 Bacteria 4882
87 Ga0105238_10168087 3300009551 Bacteria 2169
88 Ga0105249_10006743 3300009553 Bacteria 10006
89 Ga0105239_10079640 3300010375 Bacteria 3605
90 Ga0105246_10006024 3300011119 Bacteria 7404
91 Ga0105246_10063048 3300011119 Bacteria 2584
92 Ga0157373_10023734 3300013100 Bacteria 4444
93 Ga0157370_10029085 3300013104 Bacteria 5429
94 Ga0157370_10117200 3300013104 Bacteria 2487
95 Ga0157370_10118249 3300013104 Bacteria 2476
96 Ga0157369_10005862 3300013105 Bacteria 14272
97 Ga0157369_10066533 3300013105 Bacteria 3876
98 Ga0157369_10069531 3300013105 Bacteria 3782
99 Ga0157369_10073328 3300013105 Bacteria 3673
100 Ga0157369_10153116 3300013105 Unclassified 2437
101 Ga0157369_10182761 3300013105 Bacteria 2206
102 Ga0157374_10024511 3300013296 Bacteria 5410
103 Ga0157378_10132665 3300013297 Bacteria 2307
104 Ga0163162_10175560 3300013306 Bacteria 2268
105 Ga0157372_10101318 3300013307 Bacteria 3287
106 Ga0157372_10148243 3300013307 Bacteria 2706
107 Ga0157372_10172641 3300013307 Bacteria 2501
108 Ga0157372_10183063 3300013307 Bacteria 2425
109 Ga0157372_10283255 3300013307 Bacteria 1927
110 Ga0157375_10039489 3300013308 Bacteria 4543
111 Ga0163163_10008081 3300014325 Bacteria 9321
112 Ga0163163_10090010 3300014325 Bacteria 3082
113 Ga0157377_10024686 3300014745 Bacteria 3197
114 Ga0157379_10022937 3300014968 Bacteria 5532
115 Ga0157376_10042783 3300014969 Bacteria 3714
116 Ga0157376_10059488 3300014969 Bacteria 3204
117 Ga0157376_10059949 3300014969 Bacteria 3193
118 Ga0157376_10119407 3300014969 Bacteria 2334
119 Ga0213875_10000001 3300021388 Bacteria 2793540
120 Ga0213875_10007767 3300021388 Bacteria 5512
121 Ga0209233_1007862 3300025261 Bacteria 3344
122 Ga0207696_1000021 3300025711 Bacteria 432606
123 Ga0207692_10027045 3300025898 Bacteria 2697
124 Ga0207688_10051233 3300025901 Bacteria 2312
125 Ga0207688_10076151 3300025901 Bacteria 1910
126 Ga0207647_10012985 3300025904 Bacteria 5785
127 Ga0207647_10018570 3300025904 Bacteria 4698
128 Ga0207699_10018530 3300025906 Bacteria 3690
129 Ga0207699_10106270 3300025906 Bacteria 1791
130 Ga0207705_10109415 3300025909 Bacteria 2040
131 Ga0207707_10000666 3300025912 Bacteria 34106
132 Ga0207695_10000001 3300025913 Bacteria 2888630
133 Ga0207695_10000106 3300025913 Bacteria 253001
134 Ga0207671_10026739 3300025914 Bacteria 4320
135 Ga0207693_10054159 3300025915 Bacteria 3147
136 Ga0207693_10060582 3300025915 Bacteria 2965
137 Ga0207663_10087291 3300025916 Bacteria 2059
138 Ga0207660_10000626 3300025917 Bacteria 23769
139 Ga0207660_10047786 3300025917 Bacteria 3028
140 Ga0207657_10051159 3300025919 Bacteria 3591
141 Ga0207652_10001774 3300025921 Bacteria 18784
142 Ga0207652_10002729 3300025921 Bacteria 14814
143 Ga0207652_10020967 3300025921 Bacteria 5390
144 Ga0207652_10061654 3300025921 Bacteria 3239
145 Ga0207694_10043707 3300025924 Bacteria 3458
146 Ga0207694_10051144 3300025924 Bacteria 3202
147 Ga0207694_10125098 3300025924 Bacteria 2056
148 Ga0207694_10149466 3300025924 Bacteria 1881
149 Ga0207687_10004701 3300025927 Bacteria 9082
150 Ga0207687_10026540 3300025927 Bacteria 3879
151 Ga0207687_10068492 3300025927 Bacteria 2528
152 Ga0207700_10042940 3300025928 Bacteria 3318
153 Ga0207664_10040844 3300025929 Bacteria 3611
154 Ga0207664_10265031 3300025929 Bacteria 1503
155 Ga0207690_10017446 3300025932 Bacteria 4382
156 Ga0207690_10120913 3300025932 Bacteria 1902
157 Ga0207706_10163938 3300025933 Bacteria 1953
158 Ga0207665_10043534 3300025939 Bacteria 3002
159 Ga0207661_10008615 3300025944 Bacteria 7288
160 Ga0207661_10118205 3300025944 Bacteria 2253
161 Ga0207679_10026508 3300025945 Bacteria 3997
162 Ga0207679_10118372 3300025945 Bacteria 2104
163 Ga0207667_10001259 3300025949 Bacteria 31763
164 Ga0207667_10005805 3300025949 Bacteria 15054
165 Ga0207667_10067655 3300025949 Bacteria 3720
166 Ga0207668_10121869 3300025972 Bacteria 1976
167 Ga0207640_10042929 3300025981 Bacteria 2886
168 Ga0207703_10026977 3300026035 Bacteria 4524
169 Ga0207678_10052314 3300026067 Bacteria 3524
170 Ga0207678_10107109 3300026067 Bacteria 2384
171 Ga0207708_10060593 3300026075 Bacteria 2889
172 Ga0207702_10004191 3300026078 Bacteria 12890
173 Ga0207641_10213215 3300026088 Bacteria 1787
174 Ga0207674_10192051 3300026116 Bacteria 1992
175 Ga0207683_10006894 3300026121 Bacteria 9727
176 Ga0207698_10028640 3300026142 Bacteria 3976
177 Ga0207698_10073984 3300026142 Bacteria 2715
178 Ga0207698_10089948 3300026142 Bacteria 2509
179 Ga0268266_10144479 3300028379 Unclassified 2137
180 Ga0265338_10028967 3300028800 Bacteria 5505
181 Ga0265338_10038165 3300028800 Bacteria 4556
182 Ga0265760_10000008 3300031090 Bacteria 114959
183 Ga0265325_10006552 3300031241 Bacteria 7061
184 Ga0265327_10011659 3300031251 Bacteria 6026
185 Ga0307416_100167875 3300032002 Bacteria 2038
186 Ga0307411_10074569 3300032005 Bacteria 2313
187 Ga0307415_100066151 3300032126 Bacteria 2521
188 Ga0307510_10023391 3300033180 Bacteria 7163
189 Ga0373926_0001647 3300035083 Bacteria 6901
190 Ga0373945_0001876 3300035116 Bacteria 6514
191 Ga0373953_0049510 3300035117 Bacteria 1695
192 Ga0373953_0052696 3300035117 Bacteria 1647
193 Ga0373954_0026975 3300035118 Bacteria 2635
194 Ga0373957_0033021 3300035120 Bacteria 1910
195 Ga0373943_0006419 3300035170 Bacteria 5279
196 Ga0373943_0019336 3300035170 Bacteria 3131
197 Ga0373946_0013146 3300035171 Bacteria 3107
198 Ga0373955_0002372 3300035172 Bacteria 8200
199 Ga0373924_0000195 3300035410 Bacteria 18214
200 Ga0373935_0019372 3300035692 Bacteria 4149
201 Ga0373933_0086100 3300035724 Bacteria 1933
202 Ga0373947_0012921 3300035725 Bacteria 4787
203 Ga0373937_0000215 3300036401 Bacteria 55874
204 Ga0373937_0034134 3300036401 Bacteria 4626
205 Ga0373925_0008912 3300037068 Bacteria 7308
206 Ga0373925_0026033 3300037068 Bacteria 4277
207 Ga0395898_0064421 3300037466 Bacteria 3555
208 Ga0436364_0273345 3300037853 Bacteria 2794207
209 Ga0436364_0454315 3300037853 Bacteria 26452
210 Ga0436363_1138133 3300039450 Bacteria 1673
211 Ga0451577_0012327 3300042876 Bacteria 8029
212 Ga0466969_0008794 3300044656 Bacteria 5353
213 Ga0466972_0000315 3300044658 Bacteria 27891
214 Ga0466978_0026677 3300044671 Bacteria 3479
215 Ga0466982_0029811 3300044672 Bacteria 3220
216 Ga0466965_0001300 3300044683 Bacteria 9953
217 Ga0466966_0030269 3300044684 Bacteria 3515
218 Ga0466966_0046521 3300044684 Bacteria 2770
219 Ga0466961_0000077 3300044693 Bacteria 60661
220 Ga0466963_0000072 3300044694 Bacteria 35309
221 Ga0466963_0091509 3300044694 Bacteria 2072
222 Ga0466964_0015250 3300044706 Bacteria 2924
223 Ga0453684_0002683 3300044712 Bacteria 42359
224 Ga0453684_0041777 3300044712 Bacteria 6193
225 Ga0453684_0283887 3300044712 Bacteria 1887
226 Ga0466971_0032819 3300044719 Bacteria 2326
227 Ga0466968_0008185 3300044735 Bacteria 3999
228 Ga0466970_0000966 3300044765 Bacteria 13833
229 Ga0466957_0000593 3300044842 Bacteria 18407
230 Ga0466960_0001333 3300044901 Bacteria 8972
231 Ga0466959_0001159 3300045049 Bacteria 15885
232 Ga0451576_0000273 3300045051 Bacteria 126460
233 Ga0451576_0061467 3300045051 Bacteria 3916
234 Ga0466967_0015565 3300045976 Bacteria 5965
235 Ga0466967_0015876 3300045976 Bacteria 5918
236 Ga0495629_0093853 3300046459 Bacteria 2094
237 Ga0495641_0009036 3300046461 Bacteria 5980
238 Ga0495651_0060803 3300046462 Bacteria 2892
239 Ga0495580_0098115 3300046472 Unclassified 2038
240 Ga0495582_0033414 3300046473 Bacteria 2828
241 Ga0495662_0009093 3300046476 Bacteria 4875
242 Ga0495606_0000498 3300046507 Bacteria 64198
243 Ga0495608_0066037 3300046511 Bacteria 2369
244 Ga0495618_0032808 3300046514 Bacteria 3253
245 Ga0495630_0018570 3300046517 Bacteria 5110
246 Ga0495637_0102308 3300046520 Bacteria 1118
247 Ga0495652_0097975 3300046529 Bacteria 2384
248 Ga0495640_0004689 3300046533 Bacteria 10894
249 Ga0495645_0018385 3300046543 Bacteria 5018
250 Ga0495667_0001824 3300046559 Bacteria 14130
251 Ga0495634_0001345 3300046642 Bacteria 22385
252 Ga0495635_0009600 3300046663 Bacteria 6764
253 Ga0495588_0005101 3300046674 Bacteria 5836
254 Ga0495657_0003737 3300046675 Bacteria 12321
255 Ga0495657_0081809 3300046675 Bacteria 2088
256 Ga0495647_0004105 3300046681 Bacteria 4708
257 Ga0495613_0023349 3300046689 Bacteria 4607
258 Ga0495624_0002452 3300046690 Bacteria 14066
259 Ga0495624_0083314 3300046690 Bacteria 1978
260 Ga0495649_0005229 3300046694 Bacteria 8305
261 Ga0495600_0000636 3300046809 Bacteria 18128
262 Ga0495581_0001753 3300047315 Bacteria 12105
263 Ga0495674_0177190 3300047319 Bacteria 1776
264 Ga0495676_0063662 3300047321 Bacteria 2873
265 Ga0495680_0028183 3300047322 Bacteria 4606
266 Ga0495683_0028563 3300047323 Bacteria 2851
267 Ga0495675_0069035 3300047444 Bacteria 2232
268 Ga0495684_0005307 3300047471 Bacteria 10034
269 Ga0495686_0000009 3300047472 Bacteria 661643
270 Ga0495686_0001032 3300047472 Bacteria 33463
271 Ga0495593_0005821 3300047673 Bacteria 7267
272 Ga0495602_0151393 3300048088 Bacteria 1823
273 Ga0496101_0229919 3300048904 Bacteria 1441
274 Ga0496102_0012950 3300048905 Bacteria 7222
275 Ga0496102_0052187 3300048905 Bacteria 3725
276 Ga0496102_0063290 3300048905 Bacteria 3387
277 Ga0496102_0069977 3300048905 Bacteria 3221
278 Ga0496103_0004755 3300048906 Bacteria 8210
279 Ga0496103_0009103 3300048906 Bacteria 5881
280 Ga0496103_0028605 3300048906 Bacteria 3384
281 Ga0496104_0000019 3300048907 Bacteria 249440
282 Ga0496104_0012808 3300048907 Bacteria 7553
283 Ga0496104_0214295 3300048907 Bacteria 1837
284 Ga0496105_0001195 3300048908 Bacteria 18070
285 Ga0496105_0058903 3300048908 Bacteria 3169
286 Ga0496106_0003038 3300048909 Bacteria 12495
287 Ga0496107_0038017 3300048910 Bacteria 3455
288 Ga0496108_0003800 3300048911 Bacteria 12089
289 Ga0496108_0029821 3300048911 Bacteria 4520
290 Ga0496108_0075308 3300048911 Bacteria 2851
291 Ga0496109_0003637 3300048912 Bacteria 12883
292 Ga0496109_0083737 3300048912 Bacteria 2941
293 Ga0496109_0159186 3300048912 Bacteria 2115
294 Ga0496109_0345178 3300048912 Bacteria 1406
295 Ga0496110_0001771 3300048913 Bacteria 15908
296 Ga0496110_0048123 3300048913 Bacteria 3737
297 Ga0496111_0017180 3300048914 Bacteria 4998
298 Ga0496111_0019964 3300048914 Bacteria 4661
299 Ga0496111_0093903 3300048914 Unclassified 2200
300 Ga0496112_0072465 3300048915 Bacteria 3405
301 Ga0496113_0001452 3300048916 Bacteria 13181
302 Ga0496113_0035405 3300048916 Bacteria 3650
303 Ga0496113_0043370 3300048916 Bacteria 3328
304 Ga0496114_0192683 3300048917 Bacteria 1784
305 Ga0496115_0001298 3300048918 Bacteria 17841
306 Ga0496115_0008574 3300048918 Bacteria 7568
307 Ga0496115_0113508 3300048918 Bacteria 2226
308 Ga0496115_0119378 3300048918 Unclassified 2169
309 Ga0496126_0002239 3300048929 Bacteria 26699
310 Ga0501067_0000031 3300049583 Bacteria 87732
311 Ga0501068_0000030 3300049584 Bacteria 52668
312 Ga0501069_0000032 3300049585 Bacteria 96425
313 nmdc:mga08y16_117794_c1 3300050511 Bacteria 2764
314 nmdc:mga0n895_13546_c1 3300050512 Bacteria 7365
315 nmdc:mga0n895_3336_c1 3300050512 Bacteria 12902
316 nmdc:mga0rr50_6585_c1 3300050513 Bacteria 7094
317 nmdc:mga08x19_12476_c1 3300050514 Bacteria 5121
318 nmdc:mga08x19_94719_c1 3300050514 Bacteria 1974
319 nmdc:mga0a205_51718_c1 3300050515 Bacteria 3163
320 Ga0495601_0013470 3300053077 Bacteria 4919
321 Ga0495601_0090281 3300053077 Bacteria 1971
322 Ga0495601_0100795 3300053077 Bacteria 1865
323 Ga0495595_0010698 3300053084 Bacteria 3820
324 Ga0495595_0022449 3300053084 Bacteria 2771
325 Ga0500618_004075 3300053125 Bacteria 4788
326 Ga0466962_0001483 3300061719 Bacteria 10943
327 2857358055 2857357740 Bacteria 9937880
328 2904508763 2904504865 Bacteria 5152820
329 Ga0068852_100021140
330 LJNas_1000033
331 JGI25162J39368_1000006
332 rootL2_10112858
333 Ga0070658_10002637
334 Ga0070658_10009479
335 Ga0070683_100026694
336 Ga0070683_100102023
337 Ga0070690_100057946
338 Ga0070670_100144580
339 Ga0070680_100000376
340 Ga0070682_100007327
341 Ga0070682_100061591
342 Ga0068868_100002651
343 Ga0070691_10029916
344 Ga0070675_100091918
345 Ga0070674_100056016
346 Ga0070688_100042584
347 Ga0070659_100006596
348 Ga0070659_100033273
349 Ga0070709_10016038
350 Ga0070709_10037508
351 Ga0070714_100049182
352 Ga0070711_100194635
353 Ga0070663_100068541
354 Ga0070678_100025853
355 Ga0070681_10000877
356 Ga0070681_10161213
357 Ga0070679_100000292
358 Ga0070679_100000387
359 Ga0070679_100029657
360 Ga0070684_100002145
361 Ga0070684_100020372
362 Ga0070684_100169966
363 Ga0068853_100003031
364 Ga0068853_100007905
365 Ga0070696_100024503
366 Ga0070693_100012405
367 Ga0068855_100004785
368 Ga0068855_100010324
369 Ga0068855_100056374
370 Ga0068855_100147564
371 Ga0070664_100039320
372 Ga0068857_100002973
373 Ga0068857_100090813
374 Ga0068857_100250353
375 Ga0068854_100050962
376 Ga0068854_100089962
377 Ga0068854_100090122
378 Ga0068856_100004356
379 Ga0070702_100014765
380 Ga0068852_100013585
381 Ga0068852_100020667
382 Ga0068852_100084741
383 Ga0068852_100121493
384 Ga0068866_10080026
385 Ga0081538_10070162
386 Ga0081540_1023158
387 Ga0070717_10110197
388 Ga0070717_10119061
389 Ga0097621_100063324
390 Ga0068871_100127663
391 Ga0075433_10197885
392 Ga0075434_100000702
393 Ga0075436_100014916
394 Ga0075436_100043164
395 Ga0075435_100002769
396 Ga0105250_10000002
397 Ga0105240_10000001
398 Ga0105240_10001955
399 Ga0105240_10095142
400 Ga0105240_10142103
401 Ga0105240_10197535
402 Ga0105240_10362124
403 Ga0111539_10233813
404 Ga0105245_10009712
405 Ga0105245_10018485
406 Ga0105245_10023868
407 Ga0105241_10040236
408 Ga0105241_10052845
409 Ga0105241_10095968
410 Ga0105241_10123967
411 Ga0105237_10044106
412 Ga0105238_10007578
413 Ga0105238_10015765
414 Ga0105238_10038116
415 Ga0105238_10168087
416 Ga0105249_10006743
417 Ga0105239_10079640
418 Ga0105246_10006024
419 Ga0105246_10063048
420 Ga0157373_10023734
421 Ga0157370_10029085
422 Ga0157370_10117200
423 Ga0157370_10118249
424 Ga0157369_10005862
425 Ga0157369_10066533
426 Ga0157369_10069531
427 Ga0157369_10073328
428 Ga0157369_10153116
429 Ga0157369_10182761
430 Ga0157374_10024511
431 Ga0157378_10132665
432 Ga0163162_10175560
433 Ga0157372_10101318
434 Ga0157372_10148243
435 Ga0157372_10172641
436 Ga0157372_10183063
437 Ga0157372_10283255
438 Ga0157375_10039489
439 Ga0163163_10008081
440 Ga0163163_10090010
441 Ga0157377_10024686
442 Ga0157379_10022937
443 Ga0157376_10042783
444 Ga0157376_10059488
445 Ga0157376_10059949
446 Ga0157376_10119407
447 Ga0213875_10000001
448 Ga0213875_10007767
449 Ga0209233_1007862
450 Ga0207696_1000021
451 Ga0207692_10027045
452 Ga0207688_10051233
453 Ga0207688_10076151
454 Ga0207647_10012985
455 Ga0207647_10018570
456 Ga0207699_10018530
457 Ga0207699_10106270
458 Ga0207705_10109415
459 Ga0207707_10000666
460 Ga0207695_10000001
461 Ga0207695_10000106
462 Ga0207671_10026739
463 Ga0207693_10054159
464 Ga0207693_10060582
465 Ga0207663_10087291
466 Ga0207660_10000626
467 Ga0207660_10047786
468 Ga0207657_10051159
469 Ga0207652_10001774
470 Ga0207652_10002729
471 Ga0207652_10020967
472 Ga0207652_10061654
473 Ga0207694_10043707
474 Ga0207694_10051144
475 Ga0207694_10125098
476 Ga0207694_10149466
477 Ga0207687_10004701
478 Ga0207687_10026540
479 Ga0207687_10068492
480 Ga0207700_10042940
481 Ga0207664_10040844
482 Ga0207664_10265031
483 Ga0207690_10017446
484 Ga0207690_10120913
485 Ga0207706_10163938
486 Ga0207665_10043534
487 Ga0207661_10008615
488 Ga0207661_10118205
489 Ga0207679_10026508
490 Ga0207679_10118372
491 Ga0207667_10001259
492 Ga0207667_10005805
493 Ga0207667_10067655
494 Ga0207668_10121869
495 Ga0207640_10042929
496 Ga0207703_10026977
497 Ga0207678_10052314
498 Ga0207678_10107109
499 Ga0207708_10060593
500 Ga0207702_10004191
501 Ga0207641_10213215
502 Ga0207674_10192051
503 Ga0207683_10006894
504 Ga0207698_10028640
505 Ga0207698_10073984
506 Ga0207698_10089948
507 Ga0268266_10144479
508 Ga0265338_10028967
509 Ga0265338_10038165
510 Ga0265760_10000008
511 Ga0265325_10006552
512 Ga0265327_10011659
513 Ga0307416_100167875
514 Ga0307411_10074569
515 Ga0307415_100066151
516 Ga0307510_10023391
517 Ga0373926_0001647
518 Ga0373945_0001876
519 Ga0373953_0049510
520 Ga0373953_0052696
521 Ga0373954_0026975
522 Ga0373957_0033021
523 Ga0373943_0006419
524 Ga0373943_0019336
525 Ga0373946_0013146
526 Ga0373955_0002372
527 Ga0373924_0000195
528 Ga0373935_0019372
529 Ga0373933_0086100
530 Ga0373947_0012921
531 Ga0373937_0000215
532 Ga0373937_0034134
533 Ga0373925_0008912
534 Ga0373925_0026033
535 Ga0395898_0064421
536 Ga0436364_0273345
537 Ga0436364_0454315
538 Ga0436363_1138133
539 Ga0451577_0012327
540 Ga0466969_0008794
541 Ga0466972_0000315
542 Ga0466978_0026677
543 Ga0466982_0029811
544 Ga0466965_0001300
545 Ga0466966_0030269
546 Ga0466966_0046521
547 Ga0466961_0000077
548 Ga0466963_0000072
549 Ga0466963_0091509
550 Ga0466964_0015250
551 Ga0453684_0002683
552 Ga0453684_0041777
553 Ga0453684_0283887
554 Ga0466971_0032819
555 Ga0466968_0008185
556 Ga0466970_0000966
557 Ga0466957_0000593
558 Ga0466960_0001333
559 Ga0466959_0001159
560 Ga0451576_0000273
561 Ga0451576_0061467
562 Ga0466967_0015565
563 Ga0466967_0015876
564 Ga0495629_0093853
565 Ga0495641_0009036
566 Ga0495651_0060803
567 Ga0495580_0098115
568 Ga0495582_0033414
569 Ga0495662_0009093
570 Ga0495606_0000498
571 Ga0495608_0066037
572 Ga0495618_0032808
573 Ga0495630_0018570
574 Ga0495637_0102308
575 Ga0495652_0097975
576 Ga0495640_0004689
577 Ga0495645_0018385
578 Ga0495667_0001824
579 Ga0495634_0001345
580 Ga0495635_0009600
581 Ga0495588_0005101
582 Ga0495657_0003737
583 Ga0495657_0081809
584 Ga0495647_0004105
585 Ga0495613_0023349
586 Ga0495624_0002452
587 Ga0495624_0083314
588 Ga0495649_0005229
589 Ga0495600_0000636
590 Ga0495581_0001753
591 Ga0495674_0177190
592 Ga0495676_0063662
593 Ga0495680_0028183
594 Ga0495683_0028563
595 Ga0495675_0069035
596 Ga0495684_0005307
597 Ga0495686_0000009
598 Ga0495686_0001032
599 Ga0495593_0005821
600 Ga0495602_0151393
601 Ga0496101_0229919
602 Ga0496102_0012950
603 Ga0496102_0052187
604 Ga0496102_0063290
605 Ga0496102_0069977
606 Ga0496103_0004755
607 Ga0496103_0009103
608 Ga0496103_0028605
609 Ga0496104_0000019
610 Ga0496104_0012808
611 Ga0496104_0214295
612 Ga0496105_0001195
613 Ga0496105_0058903
614 Ga0496106_0003038
615 Ga0496107_0038017
616 Ga0496108_0003800
617 Ga0496108_0029821
618 Ga0496108_0075308
619 Ga0496109_0003637
620 Ga0496109_0083737
621 Ga0496109_0159186
622 Ga0496109_0345178
623 Ga0496110_0001771
624 Ga0496110_0048123
625 Ga0496111_0017180
626 Ga0496111_0019964
627 Ga0496111_0093903
628 Ga0496112_0072465
629 Ga0496113_0001452
630 Ga0496113_0035405
631 Ga0496113_0043370
632 Ga0496114_0192683
633 Ga0496115_0001298
634 Ga0496115_0008574
635 Ga0496115_0113508
636 Ga0496115_0119378
637 Ga0496126_0002239
638 Ga0501067_0000031
639 Ga0501068_0000030
640 Ga0501069_0000032
641 nmdc:mga08y16_117794_c1
642 nmdc:mga0n895_13546_c1
643 nmdc:mga0n895_3336_c1
644 nmdc:mga0rr50_6585_c1
645 nmdc:mga08x19_12476_c1
646 nmdc:mga08x19_94719_c1
647 nmdc:mga0a205_51718_c1
648 Ga0495601_0013470
649 Ga0495601_0090281
650 Ga0495601_0100795
651 Ga0495595_0010698
652 Ga0495595_0022449
653 Ga0500618_004075
654 Ga0466962_0001483
655 2857358055
656 2904508763

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01566

Nramp

Natural resistance-associated macrophage protein-like

64

449

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8e6n-assembly1.cif.gz_A x-ray structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter g223w mutant in an outward-open, manganese-bound state 0.9316 23 433
8e5v-assembly1.cif.gz_A x-ray structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter wtsoak in an occluded state 0.9276 25 433
8e5v-assembly1.cif.gz_A x-ray structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter wtsoak in an occluded state 0.9253 25 433
6c3i-assembly1.cif.gz_A crystal structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter g45r mutant in an inward occluded state 0.9209 26 434
8e6n-assembly1.cif.gz_A x-ray structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter g223w mutant in an outward-open, manganese-bound state 0.9204 23 433
ID Description Score Start End Superfamily
af_P9WIZ5_52_401_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.944 41 406 1.20.1740.10
af_P9WIZ5_52_401_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9388 41 406 1.20.1740.10
af_Q553K4_170_526_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9282 41 405 1.20.1740.10
af_Q553K4_170_526_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9207 41 405 1.20.1740.10
af_A0A1D8PHV2_78_579_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9168 26 431 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A538EDF6-F1-model_v4 Divalent metal cation transporter 0.9732 24 336 GO:0005384
GO:0005886
GO:0012505
GO:0015086
GO:0034755
AF-A0A0F2JGB0-F1-model_v4 Manganese transport protein MntH 0.9638 65 433 GO:0005384
GO:0005886
GO:0012505
GO:0015086
GO:0034755
AF-A0A538EDF6-F1-model_v4 Divalent metal cation transporter 0.9635 24 336 GO:0005384
GO:0005886
GO:0012505
GO:0015086
GO:0034755
AF-A0A2T3HV98-F1-model_v4 Divalent metal cation transporter MntH 0.9584 17 432 GO:0005384
GO:0005886
GO:0012505
GO:0015086
GO:0015293
GO:0034755
GO:0046872
AF-A0A3A5IQR9-F1-model_v4 deleted 0.9571 15 429

Map