F409205

General Info

Members Datasets Scaffolds Average Seq Length
328 230 654 382

Family's Representative Sequence

Representative Sequence 3300006946|Ga0079104_1000008|Ga0079104_1000008258
Length 403
Sequence MNTRIPQSTLDAAAVNRPLRGRVAIAGAATYGCGEAPGMDDMTLLVRAAHAAVADAGLTMQDIDGLATCSVNASMWTMPVIEHLGINPTYVDGTMIGGSSFIAHLLPAIRALEAGQCKAVLVCYGSAQRSATFGRKEGQAARRFLDPQPYEFPYEPVLPVTAYALAAARHMHEFGTTREQLAEVAVAARAWAQLNPEAFMRDPLTIEDVLSARPIASPLSVRDCCLVTDGAGAIVLVRGERARDLPRPPVYVLGNATAIWNRQISCMPDLTTTAAAQSGAQAFAMAGLTAADMDMAQVYDAFTINTLLFLEDLGFCAKGEGGAFVSKGGIAPGGRLAVNTNGGGLSCVHPGMYGIFALIEAVRQLRGEAGQRQLGRHRTAVVHGNGGTLSSQSTAVLGTAEAL

Samples

Sample ID Description Type Environment
1 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
7 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
24 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
25 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
30 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
47 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
74 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
75 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
79 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
80 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
81 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
82 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
83 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
84 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
85 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
88 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
89 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
90 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
91 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
104 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
105 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
106 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
107 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
108 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
109 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
110 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
111 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
112 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
113 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
114 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
115 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
116 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
117 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
118 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
119 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
120 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
121 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
124 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
127 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
128 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
129 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
130 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
131 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
134 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
135 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
136 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
137 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
138 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
139 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
140 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
141 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
142 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
143 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
144 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
145 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
146 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
155 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
156 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
157 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
158 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
159 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
160 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
161 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
162 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
163 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
164 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
173 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
177 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
178 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
179 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
180 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
181 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
182 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
186 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
187 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
188 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
189 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
190 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
191 2517572101 Frankia sp. DC12 Isolate Nodule
192 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
193 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
194 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
195 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
196 2643221569 Achromobacter sp. Root565 Isolate Unclassified
197 2643221594 Achromobacter sp. Root170 Isolate Unclassified
198 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
199 2643221621 Achromobacter sp. Root83 Isolate Unclassified
200 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
201 2643221658 Variovorax sp. Root411 Isolate Unclassified
202 2643221672 Variovorax sp. Root434 Isolate Unclassified
203 2643221733 Bosea sp. Root381 Isolate Unclassified
204 2721755523 Delftia sp. HK171 Isolate Unclassified
205 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
206 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
207 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
208 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
209 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
210 2842677519 Variovorax sp. R-72495 Isolate Unclassified
211 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
212 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
213 2858950400 Achromobacter sp. K91 Isolate Unclassified
214 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
215 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
216 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
217 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
218 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
219 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
220 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
221 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
222 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
223 2929520902 Variovorax beijingensis 502 Isolate Unclassified
224 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
225 2941479691
226 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
227 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
228 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
229 8002775197 Frankia nepalensis CN7 Isolate Nodule
230 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.93
Metatranscriptomes 0.61
Isolates 16.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.85
Nodule 4.27
Rhizoplane 3.05
Rhizosphere 50
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0079104_1000008 3300006946 Bacteria 371223
2 JGI25151J46595_10000254 3300003187 Bacteria 62429
3 JGI25151J46595_10000357 3300003187 Bacteria 48666
4 Ga0006562J51391_1028714 3300003578 Bacteria 4602
5 Ga0006562J51391_1028715 3300003578 Bacteria 2540
6 Ga0055537_1000064 3300003773 Bacteria 77134
7 Ga0055536_1004216 3300003781 Bacteria 7425
8 Ga0055534_1003498 3300003784 Bacteria 4914
9 Ga0055528_1007269 3300003790 Bacteria 4914
10 Ga0055530_10003198 3300003791 Bacteria 9599
11 Ga0055540_1000610 3300003792 Bacteria 25546
12 Ga0055540_1001790 3300003792 Bacteria 12221
13 Ga0055531_10000084 3300003794 Bacteria 102550
14 Ga0070667_100120150 3300005367 Bacteria 2285
15 Ga0070711_100018430 3300005439 Bacteria 4457
16 Ga0070698_100254922 3300005471 Bacteria 1687
17 Ga0070679_100048610 3300005530 Bacteria 4225
18 Ga0070665_100020091 3300005548 Bacteria 6705
19 Ga0068855_100127226 3300005563 Bacteria 2912
20 Ga0068856_100042229 3300005614 Bacteria 4485
21 Ga0068866_10018085 3300005718 Bacteria 3183
22 Ga0068858_100019423 3300005842 Bacteria 6355
23 Ga0068860_100024136 3300005843 Bacteria 5879
24 Ga0075363_100014525 3300006048 Bacteria 3851
25 Ga0075363_100139663 3300006048 Bacteria 1363
26 Ga0075364_10003257 3300006051 Bacteria 9192
27 Ga0075362_10001585 3300006177 Bacteria 7366
28 Ga0075362_10004561 3300006177 Bacteria 4990
29 Ga0075362_10026067 3300006177 Bacteria 2494
30 Ga0075366_10005468 3300006195 Bacteria 6883
31 Ga0075366_10015909 3300006195 Bacteria 4318
32 Ga0075366_10045906 3300006195 Bacteria 2588
33 Ga0075370_10001502 3300006353 Bacteria 10182
34 Ga0075370_10074975 3300006353 Bacteria 1939
35 Ga0075370_10100797 3300006353 Bacteria 1671
36 Ga0075430_100148393 3300006846 Bacteria 1953
37 Ga0075434_100046415 3300006871 Bacteria 4311
38 Ga0075429_100000515 3300006880 Bacteria 29279
39 Ga0099826_10000031 3300006948 Bacteria 124966
40 Ga0099826_10002996 3300006948 Bacteria 11245
41 Ga0099826_10074282 3300006948 Bacteria 2145
42 Ga0105250_10000607 3300009092 Bacteria 23329
43 Ga0105240_10006694 3300009093 Bacteria 16895
44 Ga0105245_10002039 3300009098 Bacteria 18326
45 Ga0105243_10192480 3300009148 Bacteria 1782
46 Ga0105241_10049097 3300009174 Bacteria 3213
47 Ga0105248_10031080 3300009177 Bacteria 5968
48 Ga0105237_10055118 3300009545 Bacteria 3982
49 Ga0105238_10041600 3300009551 Bacteria 4654
50 Ga0105249_10252102 3300009553 Bacteria 1750
51 Ga0105239_10117838 3300010375 Bacteria 2947
52 Ga0157373_10016774 3300013100 Bacteria 5338
53 Ga0157371_10065751 3300013102 Bacteria 2568
54 Ga0157378_10021906 3300013297 Bacteria 5619
55 Ga0157376_10251659 3300014969 Bacteria 1650
56 Ga0182006_1009496 3300015261 Bacteria 4358
57 Ga0163161_10003274 3300017792 Bacteria 11384
58 Ga0213872_10005513 3300021361 Bacteria 6490
59 Ga0209258_102846 3300025242 Bacteria 4124
60 Ga0209565_1000025 3300025263 Bacteria 377969
61 Ga0209455_1000566 3300025272 Bacteria 24635
62 Ga0209673_1000149 3300025273 Bacteria 148659
63 Ga0209675_1000017 3300025291 Bacteria 378002
64 Ga0209676_1000123 3300025292 Bacteria 195351
65 Ga0209676_1021977 3300025292 Bacteria 2126
66 Ga0209025_1000003 3300025294 Bacteria 1366495
67 Ga0209025_1000019 3300025294 Bacteria 631548
68 Ga0209025_1020619 3300025294 Bacteria 3594
69 Ga0209050_1000188 3300025298 Bacteria 138865
70 Ga0209050_1005397 3300025298 Bacteria 8070
71 Ga0209051_1000091 3300025303 Bacteria 173683
72 Ga0209051_1000444 3300025303 Bacteria 55960
73 Ga0209257_1000057 3300025304 Bacteria 396985
74 Ga0207695_10368013 3300025913 Bacteria 1324
75 Ga0207693_10009830 3300025915 Bacteria 7784
76 Ga0207657_10082647 3300025919 Bacteria 2696
77 Ga0207652_10049529 3300025921 Bacteria 3596
78 Ga0207694_10121128 3300025924 Bacteria 2089
79 Ga0207687_10030822 3300025927 Bacteria 3619
80 Ga0207709_10000070 3300025935 Bacteria 183020
81 Ga0207665_10032947 3300025939 Bacteria 3432
82 Ga0207691_10082798 3300025940 Bacteria 2881
83 Ga0207689_10110489 3300025942 Bacteria 2259
84 Ga0207667_10046823 3300025949 Bacteria 4580
85 Ga0207668_10208035 3300025972 Bacteria 1563
86 Ga0207677_10014210 3300026023 Bacteria 4641
87 Ga0207702_10133541 3300026078 Bacteria 2236
88 Ga0207648_10014324 3300026089 Bacteria 7329
89 Ga0207675_100183605 3300026118 Bacteria 2004
90 Ga0209281_1000029 3300027111 Bacteria 431495
91 Ga0209282_1000011 3300027666 Bacteria 217665
92 Ga0209282_1016026 3300027666 Bacteria 4768
93 Ga0209974_10009647 3300027876 Bacteria 3275
94 Ga0207428_10030271 3300027907 Bacteria 4477
95 Ga0268264_10067031 3300028381 Bacteria 3029
96 Ga0307517_10091895 3300028786 Bacteria 2474
97 Ga0307515_10000014 3300028794 Bacteria 562358
98 Ga0307515_10000020 3300028794 Bacteria 411735
99 Ga0307515_10001078 3300028794 Bacteria 62511
100 Ga0307515_10004453 3300028794 Bacteria 29008
101 Ga0307515_10008667 3300028794 Bacteria 19791
102 Ga0307515_10015097 3300028794 Bacteria 14257
103 Ga0307512_10099679 3300030522 Bacteria 1975
104 Ga0316177_1042817 3300030731 Bacteria 1334
105 Ga0316178_1000969 3300030735 Bacteria 2979
106 Ga0316183_1098067 3300030742 Bacteria 4763
107 Ga0265327_10000049 3300031251 Bacteria 268046
108 Ga0307513_10000012 3300031456 Bacteria 328865
109 Ga0307513_10028784 3300031456 Bacteria 6345
110 Ga0307513_10049903 3300031456 Bacteria 4529
111 Ga0307513_10051293 3300031456 Bacteria 4452
112 Ga0307408_100005502 3300031548 Bacteria 8465
113 Ga0307408_100026477 3300031548 Bacteria 3984
114 Ga0307408_100038754 3300031548 Bacteria 3364
115 Ga0307408_100052489 3300031548 Bacteria 2940
116 Ga0307408_100142868 3300031548 Bacteria 1880
117 Ga0307508_10213474 3300031616 Bacteria 1530
118 Ga0307514_10049797 3300031649 Bacteria 3256
119 Ga0307516_10001147 3300031730 Bacteria 37031
120 Ga0307516_10006403 3300031730 Bacteria 13804
121 Ga0307516_10012543 3300031730 Bacteria 9122
122 Ga0307405_10069848 3300031731 Bacteria 2253
123 Ga0307405_10078706 3300031731 Bacteria 2146
124 Ga0307406_10001365 3300031901 Bacteria 13654
125 Ga0307412_10000979 3300031911 Bacteria 16330
126 Ga0307412_10001167 3300031911 Bacteria 15025
127 Ga0307412_10032577 3300031911 Bacteria 3304
128 Ga0307412_10140203 3300031911 Bacteria 1769
129 Ga0307409_100092874 3300031995 Bacteria 2478
130 Ga0307416_100056528 3300032002 Bacteria 3168
131 Ga0307416_100365223 3300032002 Bacteria 1467
132 Ga0307414_10032742 3300032004 Bacteria 3427
133 Ga0307414_10043634 3300032004 Bacteria 3056
134 Ga0307414_10088815 3300032004 Bacteria 2288
135 Ga0307415_100163574 3300032126 Bacteria 1728
136 Ga0373927_0010210 3300035695 Bacteria 6274
137 Ga0395900_0028936 3300037418 Bacteria 5680
138 Ga0395898_0087305 3300037466 Bacteria 3005
139 Ga0395905_0000421 3300037471 Bacteria 59264
140 Ga0395905_0004126 3300037471 Bacteria 15209
141 Ga0395905_0013832 3300037471 Bacteria 7720
142 Ga0395905_0041333 3300037471 Bacteria 4327
143 Ga0436364_1148617 3300037853 Bacteria 6939
144 Ga0395901_0011278 3300038443 Bacteria 9054
145 Ga0436361_0024002 3300039447 Bacteria 58799
146 Ga0436361_0998449 3300039447 Bacteria 1791
147 Ga0439436_0004120 3300041404 Bacteria 4453
148 Ga0439439_0000066 3300041406 Bacteria 13467
149 Ga0439439_0034745 3300041406 Bacteria 1293
150 Ga0439466_0005261 3300041411 Bacteria 4952
151 Ga0439465_0003856 3300041413 Bacteria 4892
152 Ga0451853_0232277 3300041512 Bacteria 2595
153 Ga0439431_0016919 3300041997 Bacteria 1711
154 Ga0439432_010218 3300042006 Bacteria 3256
155 Ga0439432_011067 3300042006 Bacteria 3111
156 Ga0439449_0006090 3300042007 Bacteria 4610
157 Ga0439452_008742 3300042010 Bacteria 3026
158 Ga0439457_021906 3300042014 Bacteria 1415
159 Ga0439462_0015261 3300042015 Bacteria 1979
160 Ga0439462_0018399 3300042015 Bacteria 1814
161 Ga0450911_000582 3300042115 Bacteria 11328
162 Ga0450920_004697 3300042122 Bacteria 2411
163 Ga0450896_008181 3300042133 Bacteria 1449
164 Ga0439446_0009406 3300042156 Bacteria 2616
165 Ga0439434_0008759 3300042435 Bacteria 2973
166 Ga0450918_001417 3300042531 Bacteria 4767
167 Ga0450893_0005876 3300042532 Bacteria 1977
168 Ga0451576_0021669 3300045051 Bacteria 6981
169 Ga0495627_000385 3300046453 Bacteria 40228
170 Ga0495650_0002886 3300046471 Bacteria 13080
171 Ga0495580_0001063 3300046472 Bacteria 24156
172 Ga0495605_0005515 3300046474 Bacteria 7363
173 Ga0495584_0009491 3300046491 Bacteria 5010
174 Ga0495607_0009241 3300046501 Bacteria 6696
175 Ga0495610_0001269 3300046512 Bacteria 22626
176 Ga0495616_0004150 3300046513 Bacteria 9182
177 Ga0495620_0035229 3300046515 Bacteria 2253
178 Ga0495630_0187040 3300046517 Bacteria 1580
179 Ga0495631_0000333 3300046518 Bacteria 32414
180 Ga0495632_0015276 3300046519 Bacteria 4314
181 Ga0495637_0002864 3300046520 Bacteria 9351
182 Ga0495643_0011809 3300046522 Bacteria 5299
183 Ga0495643_0059247 3300046522 Bacteria 2036
184 Ga0495642_0002886 3300046528 Bacteria 6856
185 Ga0495654_0000351 3300046530 Bacteria 39795
186 Ga0495609_0004901 3300046538 Bacteria 7193
187 Ga0495633_0009855 3300046558 Bacteria 5251
188 Ga0495625_0000056 3300046660 Bacteria 186024
189 Ga0495661_0002439 3300046665 Bacteria 14321
190 Ga0495661_0125582 3300046665 Bacteria 1412
191 Ga0495671_0001219 3300046692 Bacteria 17593
192 Ga0495674_0209141 3300047319 Bacteria 1617
193 Ga0495672_0000942 3300047320 Bacteria 30337
194 Ga0495687_001323 3300047443 Bacteria 23117
195 Ga0495687_036603 3300047443 Bacteria 2194
196 Ga0496101_0198456 3300048904 Bacteria 1550
197 Ga0496105_0143638 3300048908 Bacteria 1963
198 Ga0496107_0000159 3300048910 Bacteria 34333
199 Ga0496108_0005409 3300048911 Bacteria 10324
200 Ga0496110_0036038 3300048913 Bacteria 4295
201 Ga0496111_0016452 3300048914 Bacteria 5095
202 Ga0496113_0006116 3300048916 Bacteria 7596
203 Ga0496116_0007047 3300048919 Bacteria 10067
204 Ga0496116_0040701 3300048919 Bacteria 3197
205 Ga0496116_0046563 3300048919 Bacteria 2926
206 Ga0496116_0114352 3300048919 Bacteria 1576
207 Ga0496117_0099867 3300048920 Bacteria 1840
208 Ga0496118_0005781 3300048921 Bacteria 13889
209 Ga0496118_0011669 3300048921 Bacteria 8545
210 Ga0496118_0112388 3300048921 Bacteria 1803
211 Ga0496119_0001978 3300048922 Bacteria 23275
212 Ga0496119_0105431 3300048922 Bacteria 1575
213 Ga0496120_0003793 3300048923 Bacteria 13325
214 Ga0496121_0000314 3300048924 Bacteria 100909
215 Ga0496121_0001760 3300048924 Bacteria 35275
216 Ga0496121_0005771 3300048924 Bacteria 15704
217 Ga0496121_0044203 3300048924 Bacteria 3846
218 Ga0496121_0059778 3300048924 Bacteria 3140
219 Ga0496122_0000046 3300048925 Bacteria 274640
220 Ga0496122_0020624 3300048925 Bacteria 5942
221 Ga0496122_0133102 3300048925 Bacteria 1574
222 Ga0496123_0000082 3300048926 Bacteria 188909
223 Ga0496123_0002298 3300048926 Bacteria 23994
224 Ga0496123_0012894 3300048926 Bacteria 7074
225 Ga0496124_0000007 3300048927 Bacteria 883534
226 Ga0496124_0000459 3300048927 Bacteria 70625
227 Ga0496124_0014958 3300048927 Bacteria 7470
228 Ga0496124_0016559 3300048927 Bacteria 7000
229 Ga0496124_0027248 3300048927 Bacteria 5134
230 Ga0496124_0086638 3300048927 Bacteria 2563
231 Ga0496125_0000028 3300048928 Bacteria 387222
232 Ga0496125_0012469 3300048928 Bacteria 8436
233 Ga0496125_0015580 3300048928 Bacteria 7341
234 Ga0496125_0019457 3300048928 Bacteria 6402
235 Ga0496125_0020077 3300048928 Bacteria 6282
236 Ga0496125_0026435 3300048928 Bacteria 5289
237 Ga0496125_0066641 3300048928 Bacteria 2843
238 Ga0496126_0020011 3300048929 Bacteria 6575
239 Ga0496126_0190509 3300048929 Bacteria 1737
240 Ga0501033_0024190 3300049570 Bacteria 4582
241 Ga0501034_0086300 3300049571 Bacteria 3140
242 Ga0501034_0096031 3300049571 Bacteria 2960
243 Ga0501036_0145681 3300049572 Bacteria 1998
244 Ga0501037_0143991 3300049573 Bacteria 1705
245 Ga0501037_0162288 3300049573 Bacteria 1593
246 Ga0501038_0031829 3300049574 Bacteria 4659
247 Ga0501043_0078911 3300049579 Bacteria 2587
248 Ga0501043_0100654 3300049579 Bacteria 2272
249 Ga0501043_0170175 3300049579 Bacteria 1700
250 Ga0501047_0002464 3300049581 Bacteria 17651
251 Ga0501225_0006142 3300049705 Bacteria 3509
252 Ga0501262_000758 3300049759 Bacteria 3721
253 Ga0501035_0008851 3300049822 Bacteria 9366
254 Ga0501035_0019386 3300049822 Bacteria 6256
255 Ga0501035_0022709 3300049822 Bacteria 5762
256 Ga0501044_0000022 3300049823 Bacteria 201689
257 Ga0501044_0024648 3300049823 Bacteria 6383
258 nmdc:mga03683_1264_c1 3300050489 Bacteria 7490
259 nmdc:mga03683_36475_c1 3300050489 Bacteria 2000
260 nmdc:mga03683_40394_c2 3300050489 Bacteria 1459
261 nmdc:mga03n38_1980_c1 3300050490 Bacteria 6160
262 nmdc:mga00v17_15965_c1 3300050491 Bacteria 4226
263 nmdc:mga0yw44_44040_c1 3300050492 Bacteria 2668
264 nmdc:mga0k408_20605_c1 3300050493 Bacteria 3696
265 nmdc:mga0k408_29086_c1 3300050493 Bacteria 3144
266 nmdc:mga0k408_3282_c1 3300050493 Bacteria 8561
267 nmdc:mga06z11_75549_c1 3300050494 Bacteria 1794
268 nmdc:mga07m45_6855_c1 3300050496 Bacteria 5793
269 nmdc:mga07m45_94977_c1 3300050496 Bacteria 1710
270 nmdc:mga09592_365_c1 3300050508 Bacteria 33116
271 nmdc:mga0n895_35578_c1 3300050512 Bacteria 4802
272 nmdc:mga0sz30_6078_c1 3300050516 Bacteria 4467
273 Ga0500618_000848 3300053125 Bacteria 16475
274 2501077545 2501025502 Bacteria 9641094
275 2501077788 2501025502 Bacteria 9641094
276 2508696673 2508501042 Bacteria 8719808
277 2511091385 2510917013 Bacteria 9951648
278 2511092244 2510917013 Bacteria 9951648
279 2513698758 2513237101 Bacteria 7952346
280 2517763100 2517572101 Bacteria 6884336
281 2554816738 2554235132 Bacteria 6772433
282 2587759066 2585428062 Bacteria 6842168
283 2599903180 2599185292 Bacteria 6290804
284 2599906430 2599185292 Bacteria 6290804
285 2608379955 2606217733 Bacteria 6360972
286 2643862328 2643221569 Bacteria 6064337
287 2643862703 2643221569 Bacteria 6064337
288 2643980291 2643221594 Bacteria 5811388
289 2644031262 2643221603 Bacteria 6147767
290 2644121929 2643221621 Bacteria 6212786
291 2644159870 2643221628 Bacteria 5745828
292 2644325877 2643221658 Bacteria 6064537
293 2644397250 2643221672 Bacteria 6322190
294 2644731443 2643221733 Bacteria 5690728
295 2722880993 2721755523 Bacteria 6430384
296 2739610174 2739367655 Bacteria 4051151
297 2739611363 2739367655 Bacteria 4051151
298 2809032396 2808606395 Bacteria 6020352
299 2809033028 2808606395 Bacteria 6020352
300 2834646000 2834641062 Bacteria 5559922
301 2838130879 2838122688 Bacteria 8803140
302 2841976908 2841974524 Bacteria 8931498
303 2842680409 2842677519 Bacteria 5615038
304 2857538516 2857537821 Bacteria 5248181
305 2857542466 2857537821 Bacteria 5248181
306 2857544030 2857542790 Bacteria 5326616
307 2858952813 2858950400 Bacteria 6783797
308 2858953060 2858950400 Bacteria 6783797
309 2858953936 2858950400 Bacteria 6783797
310 2858955174 2858950400 Bacteria 6783797
311 2881413973 2881412998 Bacteria 6492157
312 2881930632 2881927736 Bacteria 3993927
313 2885197100 2885192300 Bacteria 5882526
314 2894024966 2894023352 Bacteria 5167372
315 2899278897 2899275550 Bacteria 3958688
316 2904542387 2904541872 Bacteria 8915136
317 2919468086 2919462493 Bacteria 5817112
318 2919708755 2919704043 Bacteria 5560311
319 2928120235 2928115317 Bacteria 6477646
320 2929522101 2929520902 Bacteria 6765052
321 2932422845 2932422444 Bacteria 4678430
322 2941485188
323 2945947902 2945945610 Bacteria 5951079
324 2989781227 2989776772 Bacteria 4843317
325 2995396394 2995392953 Bacteria 4539380
326 8002783503 8002775197 Bacteria 10728764
327 8003403339 8003400568 Bacteria 5535898
328 Ga0079104_1000008
329 JGI25151J46595_10000254
330 JGI25151J46595_10000357
331 Ga0006562J51391_1028714
332 Ga0006562J51391_1028715
333 Ga0055537_1000064
334 Ga0055536_1004216
335 Ga0055534_1003498
336 Ga0055528_1007269
337 Ga0055530_10003198
338 Ga0055540_1000610
339 Ga0055540_1001790
340 Ga0055531_10000084
341 Ga0070667_100120150
342 Ga0070711_100018430
343 Ga0070698_100254922
344 Ga0070679_100048610
345 Ga0070665_100020091
346 Ga0068855_100127226
347 Ga0068856_100042229
348 Ga0068866_10018085
349 Ga0068858_100019423
350 Ga0068860_100024136
351 Ga0075363_100014525
352 Ga0075363_100139663
353 Ga0075364_10003257
354 Ga0075362_10001585
355 Ga0075362_10004561
356 Ga0075362_10026067
357 Ga0075366_10005468
358 Ga0075366_10015909
359 Ga0075366_10045906
360 Ga0075370_10001502
361 Ga0075370_10074975
362 Ga0075370_10100797
363 Ga0075430_100148393
364 Ga0075434_100046415
365 Ga0075429_100000515
366 Ga0099826_10000031
367 Ga0099826_10002996
368 Ga0099826_10074282
369 Ga0105250_10000607
370 Ga0105240_10006694
371 Ga0105245_10002039
372 Ga0105243_10192480
373 Ga0105241_10049097
374 Ga0105248_10031080
375 Ga0105237_10055118
376 Ga0105238_10041600
377 Ga0105249_10252102
378 Ga0105239_10117838
379 Ga0157373_10016774
380 Ga0157371_10065751
381 Ga0157378_10021906
382 Ga0157376_10251659
383 Ga0182006_1009496
384 Ga0163161_10003274
385 Ga0213872_10005513
386 Ga0209258_102846
387 Ga0209565_1000025
388 Ga0209455_1000566
389 Ga0209673_1000149
390 Ga0209675_1000017
391 Ga0209676_1000123
392 Ga0209676_1021977
393 Ga0209025_1000003
394 Ga0209025_1000019
395 Ga0209025_1020619
396 Ga0209050_1000188
397 Ga0209050_1005397
398 Ga0209051_1000091
399 Ga0209051_1000444
400 Ga0209257_1000057
401 Ga0207695_10368013
402 Ga0207693_10009830
403 Ga0207657_10082647
404 Ga0207652_10049529
405 Ga0207694_10121128
406 Ga0207687_10030822
407 Ga0207709_10000070
408 Ga0207665_10032947
409 Ga0207691_10082798
410 Ga0207689_10110489
411 Ga0207667_10046823
412 Ga0207668_10208035
413 Ga0207677_10014210
414 Ga0207702_10133541
415 Ga0207648_10014324
416 Ga0207675_100183605
417 Ga0209281_1000029
418 Ga0209282_1000011
419 Ga0209282_1016026
420 Ga0209974_10009647
421 Ga0207428_10030271
422 Ga0268264_10067031
423 Ga0307517_10091895
424 Ga0307515_10000014
425 Ga0307515_10000020
426 Ga0307515_10001078
427 Ga0307515_10004453
428 Ga0307515_10008667
429 Ga0307515_10015097
430 Ga0307512_10099679
431 Ga0316177_1042817
432 Ga0316178_1000969
433 Ga0316183_1098067
434 Ga0265327_10000049
435 Ga0307513_10000012
436 Ga0307513_10028784
437 Ga0307513_10049903
438 Ga0307513_10051293
439 Ga0307408_100005502
440 Ga0307408_100026477
441 Ga0307408_100038754
442 Ga0307408_100052489
443 Ga0307408_100142868
444 Ga0307508_10213474
445 Ga0307514_10049797
446 Ga0307516_10001147
447 Ga0307516_10006403
448 Ga0307516_10012543
449 Ga0307405_10069848
450 Ga0307405_10078706
451 Ga0307406_10001365
452 Ga0307412_10000979
453 Ga0307412_10001167
454 Ga0307412_10032577
455 Ga0307412_10140203
456 Ga0307409_100092874
457 Ga0307416_100056528
458 Ga0307416_100365223
459 Ga0307414_10032742
460 Ga0307414_10043634
461 Ga0307414_10088815
462 Ga0307415_100163574
463 Ga0373927_0010210
464 Ga0395900_0028936
465 Ga0395898_0087305
466 Ga0395905_0000421
467 Ga0395905_0004126
468 Ga0395905_0013832
469 Ga0395905_0041333
470 Ga0436364_1148617
471 Ga0395901_0011278
472 Ga0436361_0024002
473 Ga0436361_0998449
474 Ga0439436_0004120
475 Ga0439439_0000066
476 Ga0439439_0034745
477 Ga0439466_0005261
478 Ga0439465_0003856
479 Ga0451853_0232277
480 Ga0439431_0016919
481 Ga0439432_010218
482 Ga0439432_011067
483 Ga0439449_0006090
484 Ga0439452_008742
485 Ga0439457_021906
486 Ga0439462_0015261
487 Ga0439462_0018399
488 Ga0450911_000582
489 Ga0450920_004697
490 Ga0450896_008181
491 Ga0439446_0009406
492 Ga0439434_0008759
493 Ga0450918_001417
494 Ga0450893_0005876
495 Ga0451576_0021669
496 Ga0495627_000385
497 Ga0495650_0002886
498 Ga0495580_0001063
499 Ga0495605_0005515
500 Ga0495584_0009491
501 Ga0495607_0009241
502 Ga0495610_0001269
503 Ga0495616_0004150
504 Ga0495620_0035229
505 Ga0495630_0187040
506 Ga0495631_0000333
507 Ga0495632_0015276
508 Ga0495637_0002864
509 Ga0495643_0011809
510 Ga0495643_0059247
511 Ga0495642_0002886
512 Ga0495654_0000351
513 Ga0495609_0004901
514 Ga0495633_0009855
515 Ga0495625_0000056
516 Ga0495661_0002439
517 Ga0495661_0125582
518 Ga0495671_0001219
519 Ga0495674_0209141
520 Ga0495672_0000942
521 Ga0495687_001323
522 Ga0495687_036603
523 Ga0496101_0198456
524 Ga0496105_0143638
525 Ga0496107_0000159
526 Ga0496108_0005409
527 Ga0496110_0036038
528 Ga0496111_0016452
529 Ga0496113_0006116
530 Ga0496116_0007047
531 Ga0496116_0040701
532 Ga0496116_0046563
533 Ga0496116_0114352
534 Ga0496117_0099867
535 Ga0496118_0005781
536 Ga0496118_0011669
537 Ga0496118_0112388
538 Ga0496119_0001978
539 Ga0496119_0105431
540 Ga0496120_0003793
541 Ga0496121_0000314
542 Ga0496121_0001760
543 Ga0496121_0005771
544 Ga0496121_0044203
545 Ga0496121_0059778
546 Ga0496122_0000046
547 Ga0496122_0020624
548 Ga0496122_0133102
549 Ga0496123_0000082
550 Ga0496123_0002298
551 Ga0496123_0012894
552 Ga0496124_0000007
553 Ga0496124_0000459
554 Ga0496124_0014958
555 Ga0496124_0016559
556 Ga0496124_0027248
557 Ga0496124_0086638
558 Ga0496125_0000028
559 Ga0496125_0012469
560 Ga0496125_0015580
561 Ga0496125_0019457
562 Ga0496125_0020077
563 Ga0496125_0026435
564 Ga0496125_0066641
565 Ga0496126_0020011
566 Ga0496126_0190509
567 Ga0501033_0024190
568 Ga0501034_0086300
569 Ga0501034_0096031
570 Ga0501036_0145681
571 Ga0501037_0143991
572 Ga0501037_0162288
573 Ga0501038_0031829
574 Ga0501043_0078911
575 Ga0501043_0100654
576 Ga0501043_0170175
577 Ga0501047_0002464
578 Ga0501225_0006142
579 Ga0501262_000758
580 Ga0501035_0008851
581 Ga0501035_0019386
582 Ga0501035_0022709
583 Ga0501044_0000022
584 Ga0501044_0024648
585 nmdc:mga03683_1264_c1
586 nmdc:mga03683_36475_c1
587 nmdc:mga03683_40394_c2
588 nmdc:mga03n38_1980_c1
589 nmdc:mga00v17_15965_c1
590 nmdc:mga0yw44_44040_c1
591 nmdc:mga0k408_20605_c1
592 nmdc:mga0k408_29086_c1
593 nmdc:mga0k408_3282_c1
594 nmdc:mga06z11_75549_c1
595 nmdc:mga07m45_6855_c1
596 nmdc:mga07m45_94977_c1
597 nmdc:mga09592_365_c1
598 nmdc:mga0n895_35578_c1
599 nmdc:mga0sz30_6078_c1
600 Ga0500618_000848
601 2501077545
602 2501077788
603 2508696673
604 2511091385
605 2511092244
606 2513698758
607 2517763100
608 2554816738
609 2587759066
610 2599903180
611 2599906430
612 2608379955
613 2643862328
614 2643862703
615 2643980291
616 2644031262
617 2644121929
618 2644159870
619 2644325877
620 2644397250
621 2644731443
622 2722880993
623 2739610174
624 2739611363
625 2809032396
626 2809033028
627 2834646000
628 2838130879
629 2841976908
630 2842680409
631 2857538516
632 2857542466
633 2857544030
634 2858952813
635 2858953060
636 2858953936
637 2858955174
638 2881413973
639 2881930632
640 2885197100
641 2894024966
642 2899278897
643 2904542387
644 2919468086
645 2919708755
646 2928120235
647 2929522101
648 2932422845
649 2941485188
650 2945947902
651 2989781227
652 2995396394
653 8002783503
654 8003403339

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22691

Thiolase_C_1

Thiolase C-terminal domain-like

256

399

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u4e-assembly1.cif.gz_A crystal structure of putative thiolase from sphaerobacter thermophilus dsm 20745 0.9454 6 387
4u4e-assembly1.cif.gz_A crystal structure of putative thiolase from sphaerobacter thermophilus dsm 20745 0.9403 6 387
4yzo-assembly2.cif.gz_D crystal structure analysis of thiolase-like protein, st0096 from sulfolobus tokodaii 0.9248 11 387
6esq-assembly1.cif.gz_C structure of the acetoacetyl-coa thiolase/hmg-coa synthase complex from methanothermococcus thermolithotrophicus soaked with acetyl-coa 0.9198 7 385
4yzo-assembly2.cif.gz_D crystal structure analysis of thiolase-like protein, st0096 from sulfolobus tokodaii 0.9171 11 387
ID Description Score Start End Superfamily
4u4eA00 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9385 6 387 3.40.47.10
4u4eA00 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9333 6 387 3.40.47.10
af_Q58944_3_392_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9213 10 385 3.40.47.10
af_I6Y3T7_1_386_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9049 6 385 3.40.47.10
af_I6Y3T7_1_386_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.889 6 385 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A536DP89-F1-model_v4 Thiolase 0.9891 158 385 GO:0016746
AF-A0A2W4THG7-F1-model_v4 Thiolase 0.9868 178 390 GO:0016746
AF-A0A356HTX4-F1-model_v4 deleted 0.9833 260 387
AF-A0A1Z9SCQ0-F1-model_v4 Thiolase 0.9828 235 390 GO:0016746
AF-W7WJC5-F1-model_v4 deleted 0.9796 238 386

Map