F409222

General Info

Members Datasets Scaffolds Average Seq Length
328 218 656 211

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10224902|Ga0105247_102249021
Length 240
Sequence MLGQHRDPRRAFATDAHRLAFANIREGTDMLTVHHLGISQSERIVWLCEELGIDYTLKRYERRADNRLAPDEYKALHPMGIAPVITDGGFVLGESGAICDYICARYGNGRLSPKADDPDFTDHLFWFHWSNGTFMTTLMMQLVLSRGAQSNPAAEFVEDRSRRGWAMVEKRLGETPFFGGRDLTTADIMMVYCLTTSRAFRGTSIDPYPNLKAYLRRIGERAAYRRAMAKAEPDMTPLLS

Samples

Sample ID Description Type Environment
1 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
78 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
119 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
120 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
124 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
127 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
142 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
153 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
154 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
155 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
156 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
161 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
162 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
163 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
164 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
167 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
168 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
169 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
172 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
173 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
181 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
182 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
183 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
189 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
193 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
194 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
195 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
196 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
197 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
198 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
199 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
200 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
201 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
202 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
203 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
204 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
205 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
206 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
207 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
208 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
209 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
210 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
211 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
212 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
213 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
214 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
215 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
216 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
217 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
218 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.17
Metatranscriptomes 0.3
Isolates 1.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.76
Nodule 0.3
Rhizoplane 2.13
Rhizosphere 82.62
Stem 0
Stem Tuber 0
Unclassified 7.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105247_10224902 3300009101 Unclassified 1272
2 JGI24752J21851_1000163 3300001976 Bacteria 9139
3 Ga0055531_10028870 3300003794 Bacteria 1902
4 Ga0065704_10088318 3300005289 Bacteria 2949
5 Ga0065707_10137346 3300005295 Bacteria 1821
6 Ga0070658_10281828 3300005327 Bacteria 1415
7 Ga0070683_100474067 3300005329 Bacteria 1195
8 Ga0070670_100000280 3300005331 Bacteria 44818
9 Ga0070670_100046370 3300005331 Bacteria 3737
10 Ga0070670_100139259 3300005331 Bacteria 2098
11 Ga0070666_10001554 3300005335 Bacteria 13928
12 Ga0070680_100453085 3300005336 Bacteria 1096
13 Ga0068868_100149795 3300005338 Bacteria 1921
14 Ga0070691_10000120 3300005341 Bacteria 23639
15 Ga0070668_100000833 3300005347 Bacteria 21319
16 Ga0070668_100021165 3300005347 Bacteria 4916
17 Ga0070669_100197786 3300005353 Bacteria 1580
18 Ga0070671_100130462 3300005355 Bacteria 2117
19 Ga0070671_100308086 3300005355 Bacteria 1348
20 Ga0070674_100350672 3300005356 Unclassified 1192
21 Ga0070673_100139851 3300005364 Unclassified 2041
22 Ga0070667_100000423 3300005367 Bacteria 44812
23 Ga0070667_100004087 3300005367 Bacteria 12345
24 Ga0070667_100025137 3300005367 Bacteria 4951
25 Ga0070667_100224520 3300005367 Bacteria 1673
26 Ga0070667_100249703 3300005367 Bacteria 1586
27 Ga0070714_100013646 3300005435 Bacteria 6515
28 Ga0070713_100000027 3300005436 Bacteria 93318
29 Ga0070713_100747044 3300005436 Bacteria 936
30 Ga0070711_100067685 3300005439 Bacteria 2506
31 Ga0070705_100485664 3300005440 Bacteria 934
32 Ga0070699_100263683 3300005518 Bacteria 1541
33 Ga0070679_100507347 3300005530 Bacteria 1150
34 Ga0070684_101138948 3300005535 Bacteria 733
35 Ga0070684_101164551 3300005535 Bacteria 725
36 Ga0068853_100000776 3300005539 Bacteria 22141
37 Ga0068853_100079994 3300005539 Bacteria 2859
38 Ga0068853_100319135 3300005539 Bacteria 1440
39 Ga0070672_100596052 3300005543 Bacteria 962
40 Ga0070693_100188161 3300005547 Bacteria 1334
41 Ga0070693_100254373 3300005547 Bacteria 1166
42 Ga0070665_100211156 3300005548 Bacteria 1942
43 Ga0068855_100023841 3300005563 Bacteria 7330
44 Ga0070664_100108392 3300005564 Bacteria 2422
45 Ga0068857_100001805 3300005577 Bacteria 17209
46 Ga0068857_100233876 3300005577 Bacteria 1681
47 Ga0068854_100001856 3300005578 Bacteria 12879
48 Ga0068854_100195825 3300005578 Bacteria 1586
49 Ga0068854_100352485 3300005578 Unclassified 1205
50 Ga0068856_100000330 3300005614 Bacteria 52037
51 Ga0068856_100000393 3300005614 Bacteria 47861
52 Ga0068852_100059487 3300005616 Bacteria 3313
53 Ga0068859_100023184 3300005617 Bacteria 6227
54 Ga0068859_100028929 3300005617 Bacteria 5559
55 Ga0068859_100034950 3300005617 Bacteria 5042
56 Ga0068859_100365314 3300005617 Unclassified 1538
57 Ga0068864_100000264 3300005618 Bacteria 46968
58 Ga0068864_100004489 3300005618 Bacteria 11477
59 Ga0068864_100020466 3300005618 Bacteria 5536
60 Ga0068864_100043371 3300005618 Bacteria 3851
61 Ga0068861_100091681 3300005719 Bacteria 2400
62 Ga0068863_100000385 3300005841 Bacteria 44821
63 Ga0068863_100018850 3300005841 Bacteria 6604
64 Ga0068863_100102182 3300005841 Bacteria 2725
65 Ga0068863_100123344 3300005841 Bacteria 2472
66 Ga0068863_100240730 3300005841 Bacteria 1746
67 Ga0068858_100020926 3300005842 Bacteria 6113
68 Ga0068858_100312808 3300005842 Unclassified 1500
69 Ga0068858_100368607 3300005842 Bacteria 1377
70 Ga0068860_100000515 3300005843 Bacteria 47393
71 Ga0068860_100015676 3300005843 Bacteria 7400
72 Ga0068862_100000398 3300005844 Bacteria 46968
73 Ga0068862_100039612 3300005844 Bacteria 4003
74 Ga0068862_100145661 3300005844 Bacteria 2105
75 Ga0068862_100258678 3300005844 Bacteria 1588
76 Ga0081539_10020705 3300005985 Bacteria 4429
77 Ga0070712_100000075 3300006175 Bacteria 51167
78 Ga0070712_100000501 3300006175 Bacteria 22386
79 Ga0075369_10261779 3300006186 Bacteria 804
80 Ga0075370_10314607 3300006353 Bacteria 932
81 Ga0068871_100102060 3300006358 Bacteria 2404
82 Ga0068871_100176243 3300006358 Bacteria 1835
83 Ga0068871_100243279 3300006358 Unclassified 1565
84 Ga0075428_100001139 3300006844 Bacteria 28405
85 Ga0075430_100313691 3300006846 Bacteria 1297
86 Ga0075434_100033157 3300006871 Bacteria 5095
87 Ga0068865_100000195 3300006881 Bacteria 33732
88 Ga0075436_100000033 3300006914 Bacteria 87819
89 Ga0097620_100023185 3300006931 Bacteria 6227
90 Ga0097620_100028929 3300006931 Bacteria 5559
91 Ga0097620_100034950 3300006931 Bacteria 5042
92 Ga0097620_100365306 3300006931 Unclassified 1538
93 Ga0079104_1002341 3300006946 Bacteria 10403
94 Ga0075435_100093002 3300007076 Unclassified 2491
95 Ga0105251_10000522 3300009011 Bacteria 36283
96 Ga0105240_10021522 3300009093 Bacteria 8575
97 Ga0105240_10181163 3300009093 Bacteria 2486
98 Ga0105241_10002995 3300009174 Bacteria 12617
99 Ga0105242_10975195 3300009176 Bacteria 853
100 Ga0105248_10000029 3300009177 Bacteria 223366
101 Ga0105248_10001014 3300009177 Bacteria 31020
102 Ga0105248_10316212 3300009177 Bacteria 1758
103 Ga0105237_10130786 3300009545 Bacteria 2504
104 Ga0105238_10008352 3300009551 Bacteria 10360
105 Ga0105238_10255062 3300009551 Bacteria 1733
106 Ga0105249_10000024 3300009553 Bacteria 232947
107 Ga0105249_10457631 3300009553 Bacteria 1315
108 Ga0105249_10989648 3300009553 Bacteria 910
109 Ga0105239_10108891 3300010375 Unclassified 3069
110 Ga0105239_10110482 3300010375 Bacteria 3047
111 Ga0105246_10326368 3300011119 Unclassified 1249
112 Ga0157373_10028729 3300013100 Unclassified 4010
113 Ga0157370_10129469 3300013104 Bacteria 2355
114 Ga0157369_10017171 3300013105 Bacteria 8130
115 Ga0157374_10050868 3300013296 Bacteria 3853
116 Ga0163162_10025163 3300013306 Bacteria 5883
117 Ga0163162_10404252 3300013306 Bacteria 1498
118 Ga0163162_10647480 3300013306 Bacteria 1180
119 Ga0157372_10167494 3300013307 Bacteria 2541
120 Ga0163163_10200692 3300014325 Bacteria 2043
121 Ga0163163_10355138 3300014325 Bacteria 1522
122 Ga0163163_10939966 3300014325 Bacteria 928
123 Ga0157380_10125517 3300014326 Bacteria 2181
124 Ga0157380_10257501 3300014326 Unclassified 1583
125 Ga0157379_10014337 3300014968 Bacteria 6955
126 Ga0157379_10014572 3300014968 Bacteria 6896
127 Ga0157379_10042253 3300014968 Bacteria 4070
128 Ga0157379_11025238 3300014968 Bacteria 788
129 Ga0163161_10003070 3300017792 Bacteria 11781
130 Ga0213876_10000791 3300021384 Bacteria 21470
131 Ga0213876_10047275 3300021384 Bacteria 2275
132 Ga0209026_1001430 3300025250 Bacteria 10576
133 Ga0209257_1000749 3300025304 Bacteria 49070
134 Ga0207713_1011398 3300025735 Bacteria 4836
135 Ga0207710_10116498 3300025900 Unclassified 1272
136 Ga0207680_10001532 3300025903 Bacteria 10869
137 Ga0207680_10011455 3300025903 Bacteria 4484
138 Ga0207685_10047008 3300025905 Bacteria 1645
139 Ga0207699_10002044 3300025906 Bacteria 9533
140 Ga0207645_10088507 3300025907 Bacteria 1991
141 Ga0207654_10006117 3300025911 Bacteria 6046
142 Ga0207654_10271415 3300025911 Unclassified 1144
143 Ga0207695_10025851 3300025913 Bacteria 6562
144 Ga0207671_10056246 3300025914 Unclassified 2915
145 Ga0207693_10000231 3300025915 Bacteria 51213
146 Ga0207693_10000352 3300025915 Bacteria 42246
147 Ga0207681_10177631 3300025923 Bacteria 1619
148 Ga0207650_10000162 3300025925 Bacteria 81071
149 Ga0207650_10065009 3300025925 Bacteria 2732
150 Ga0207650_10098954 3300025925 Bacteria 2241
151 Ga0207650_10668165 3300025925 Bacteria 876
152 Ga0207650_10849871 3300025925 Bacteria 774
153 Ga0207700_10000124 3300025928 Bacteria 45785
154 Ga0207664_10010382 3300025929 Bacteria 6577
155 Ga0207644_10309260 3300025931 Bacteria 1275
156 Ga0207706_10478983 3300025933 Bacteria 1075
157 Ga0207704_10010529 3300025938 Bacteria 4518
158 Ga0207711_10000004 3300025941 Bacteria 870636
159 Ga0207711_10957152 3300025941 Bacteria 795
160 Ga0207661_10327662 3300025944 Bacteria 1378
161 Ga0207679_10033208 3300025945 Bacteria 3630
162 Ga0207679_10332565 3300025945 Bacteria 1319
163 Ga0207667_10098861 3300025949 Bacteria 3010
164 Ga0207667_10459614 3300025949 Bacteria 1293
165 Ga0207712_10000034 3300025961 Bacteria 202320
166 Ga0207668_10002815 3300025972 Bacteria 10173
167 Ga0207668_10008383 3300025972 Bacteria 6158
168 Ga0207640_10001358 3300025981 Bacteria 13259
169 Ga0207640_10963731 3300025981 Bacteria 748
170 Ga0207658_10007404 3300025986 Bacteria 7487
171 Ga0207658_10103782 3300025986 Bacteria 2232
172 Ga0207703_10129268 3300026035 Unclassified 2179
173 Ga0207703_10193302 3300026035 Bacteria 1804
174 Ga0207639_10482006 3300026041 Bacteria 1130
175 Ga0207639_10853710 3300026041 Bacteria 850
176 Ga0207702_10000139 3300026078 Bacteria 87741
177 Ga0207702_10001152 3300026078 Bacteria 27045
178 Ga0207641_10000479 3300026088 Bacteria 45166
179 Ga0207641_10207906 3300026088 Bacteria 1808
180 Ga0207641_10219074 3300026088 Bacteria 1764
181 Ga0207641_10360844 3300026088 Bacteria 1387
182 Ga0207641_10823015 3300026088 Bacteria 919
183 Ga0207676_10000036 3300026095 Bacteria 198447
184 Ga0207676_10018652 3300026095 Bacteria 5050
185 Ga0207676_10077565 3300026095 Bacteria 2688
186 Ga0207674_10000297 3300026116 Bacteria 62992
187 Ga0207675_100036097 3300026118 Bacteria 4609
188 Ga0207675_100285190 3300026118 Unclassified 1605
189 Ga0207683_10113262 3300026121 Bacteria 2429
190 Ga0207683_10321385 3300026121 Bacteria 1418
191 Ga0207698_10117299 3300026142 Bacteria 2245
192 Ga0210002_1018146 3300027617 Unclassified 1123
193 Ga0209983_1024152 3300027665 Bacteria 1279
194 Ga0209974_10208629 3300027876 Bacteria 724
195 Ga0268265_10000386 3300028380 Bacteria 46975
196 Ga0268265_10008684 3300028380 Bacteria 6869
197 Ga0268265_10205192 3300028380 Bacteria 1713
198 Ga0268265_10391637 3300028380 Bacteria 1281
199 Ga0268265_10516404 3300028380 Bacteria 1128
200 Ga0268264_10000021 3300028381 Bacteria 481580
201 Ga0268264_10196620 3300028381 Bacteria 1842
202 Ga0268264_10210614 3300028381 Bacteria 1784
203 Ga0265334_10000130 3300028573 Bacteria 47142
204 Ga0307517_10074078 3300028786 Bacteria 3008
205 Ga0307515_10455290 3300028794 Bacteria 895
206 Ga0265338_10034210 3300028800 Bacteria 4915
207 Ga0265338_10043206 3300028800 Bacteria 4183
208 Ga0265338_10136667 3300028800 Bacteria 1926
209 Ga0265760_10081382 3300031090 Bacteria 1003
210 Ga0265325_10005659 3300031241 Bacteria 7687
211 Ga0265339_10018918 3300031249 Bacteria 4051
212 Ga0265327_10016751 3300031251 Bacteria 4633
213 Ga0265316_10192684 3300031344 Bacteria 1513
214 Ga0307513_10002415 3300031456 Bacteria 25884
215 Ga0307513_10007686 3300031456 Bacteria 13927
216 Ga0307513_10443906 3300031456 Bacteria 1023
217 Ga0307408_100329293 3300031548 Bacteria 1289
218 Ga0307408_100415373 3300031548 Bacteria 1159
219 Ga0265313_10015961 3300031595 Bacteria 4343
220 Ga0307405_10196647 3300031731 Bacteria 1461
221 Ga0307413_10191691 3300031824 Bacteria 1468
222 Ga0307413_10900654 3300031824 Bacteria 751
223 Ga0307413_10920933 3300031824 Bacteria 744
224 Ga0307406_10976662 3300031901 Bacteria 725
225 Ga0307407_10464013 3300031903 Bacteria 922
226 Ga0307412_10339977 3300031911 Bacteria 1201
227 Ga0307409_100350861 3300031995 Bacteria 1392
228 Ga0307416_100166131 3300032002 Bacteria 2047
229 Ga0307416_100544528 3300032002 Bacteria 1233
230 Ga0307414_10118216 3300032004 Bacteria 2033
231 Ga0307414_10121698 3300032004 Bacteria 2007
232 Ga0307414_10223615 3300032004 Bacteria 1547
233 Ga0307411_10176594 3300032005 Bacteria 1617
234 Ga0307411_10748479 3300032005 Bacteria 856
235 Ga0307415_100192982 3300032126 Bacteria 1609
236 Ga0373923_0102450 3300035111 Bacteria 1264
237 Ga0373932_0068276 3300035112 Unclassified 1096
238 Ga0373936_0001350 3300035113 Bacteria 8915
239 Ga0373936_0145105 3300035113 Bacteria 1027
240 Ga0373933_0370151 3300035724 Bacteria 932
241 Ga0373937_0036990 3300036401 Bacteria 4448
242 Ga0373937_0610474 3300036401 Bacteria 1035
243 Ga0395899_0175716 3300037312 Bacteria 1506
244 Ga0395900_0281325 3300037418 Bacteria 1655
245 Ga0395898_0074240 3300037466 Bacteria 3285
246 Ga0395905_0051845 3300037471 Bacteria 3843
247 Ga0395905_0116419 3300037471 Bacteria 2512
248 Ga0436364_1503243 3300037853 Bacteria 992
249 Ga0395901_0070754 3300038443 Bacteria 3635
250 Ga0436365_1207920 3300039437 Bacteria 2202
251 Ga0436361_0756148 3300039447 Bacteria 22880
252 Ga0436362_0631473 3300039453 Bacteria 775
253 Ga0436362_1205673 3300039453 Bacteria 927
254 Ga0451835_0666427 3300041492 Bacteria 876
255 Ga0439445_0053138 3300042004 Bacteria 1097
256 Ga0495650_0027055 3300046471 Bacteria 2657
257 Ga0495580_0027282 3300046472 Bacteria 4155
258 Ga0495639_0239973 3300046475 Bacteria 894
259 Ga0495630_0133575 3300046517 Bacteria 1885
260 Ga0495663_0153273 3300046525 Bacteria 787
261 Ga0495666_0032794 3300046526 Bacteria 2541
262 Ga0495642_0062723 3300046528 Bacteria 1544
263 Ga0495654_0087701 3300046530 Bacteria 1448
264 Ga0495633_0264546 3300046558 Bacteria 784
265 Ga0495668_0057960 3300046616 Bacteria 2138
266 Ga0495668_0062036 3300046616 Unclassified 2060
267 Ga0495668_0337000 3300046616 Bacteria 828
268 Ga0495611_0028026 3300046648 Bacteria 2466
269 Ga0495669_0078452 3300046684 Bacteria 1513
270 Ga0495670_0249695 3300046691 Bacteria 946
271 Ga0495600_0286414 3300046809 Bacteria 1042
272 Ga0495680_0319184 3300047322 Unclassified 1087
273 Ga0495687_102271 3300047443 Bacteria 1072
274 Ga0495686_0366728 3300047472 Bacteria 780
275 Ga0495615_0026032 3300048090 Bacteria 1363
276 Ga0496104_0915478 3300048907 Bacteria 782
277 Ga0496107_0119725 3300048910 Bacteria 1939
278 Ga0496108_0334515 3300048911 Bacteria 1321
279 Ga0496112_0054773 3300048915 Bacteria 3920
280 Ga0496112_0179321 3300048915 Bacteria 2082
281 Ga0496114_0033219 3300048917 Bacteria 4250
282 Ga0496115_0000519 3300048918 Bacteria 29990
283 Ga0496117_0002815 3300048920 Bacteria 21183
284 Ga0496118_0000335 3300048921 Bacteria 80253
285 Ga0496125_0136697 3300048928 Bacteria 1713
286 Ga0501290_003295 3300049513 Bacteria 2049
287 Ga0501046_0140201 3300049580 Bacteria 1830
288 Ga0501070_0797270 3300049586 Bacteria 742
289 Ga0501257_017945 3300049686 Bacteria 1648
290 Ga0501080_0204772 3300049742 Bacteria 1810
291 nmdc:mga03683_78817_c1 3300050489 Bacteria 1419
292 nmdc:mga03n38_36998_c1 3300050490 Bacteria 2102
293 nmdc:mga06r32_85936_c2 3300050510 Unclassified 1644
294 nmdc:mga0n895_30981_c1 3300050512 Bacteria 5116
295 nmdc:mga0rr50_62763_c1 3300050513 Unclassified 2804
296 nmdc:mga08x19_1399_c1 3300050514 Bacteria 14910
297 nmdc:mga08x19_151_c1 3300050514 Bacteria 57376
298 nmdc:mga0sz30_35779_c2 3300050516 Bacteria 816
299 Ga0500578_0220871 3300053086 Bacteria 1152
300 Ga0500651_0006734 3300053093 Bacteria 6654
301 Ga0500641_0198028 3300053096 Bacteria 858
302 Ga0500595_002020 3300053119 Bacteria 10383
303 Ga0500595_003523 3300053119 Bacteria 7278
304 Ga0500595_029652 3300053119 Bacteria 1854
305 Ga0500607_190174 3300053121 Bacteria 897
306 Ga0500608_030259 3300053122 Bacteria 2565
307 Ga0500614_087819 3300053123 Bacteria 879
308 Ga0500618_000102 3300053125 Bacteria 69637
309 Ga0500618_002045 3300053125 Bacteria 8150
310 Ga0500559_0000028 3300053136 Bacteria 117844
311 Ga0500559_0014684 3300053136 Bacteria 3309
312 Ga0500559_0181283 3300053136 Bacteria 992
313 Ga0500564_000236 3300053138 Bacteria 15379
314 Ga0500573_0372244 3300053140 Bacteria 686
315 Ga0500577_0037282 3300053142 Bacteria 1747
316 Ga0500588_0046850 3300053146 Bacteria 1331
317 Ga0500604_0006691 3300053151 Bacteria 3049
318 Ga0500616_0001435 3300053153 Bacteria 22882
319 Ga0500636_0000320 3300053177 Bacteria 26563
320 Ga0500637_0021991 3300053178 Unclassified 3471
321 Ga0500567_011804 3300053723 Bacteria 4192
322 Ga0500625_000020 3300053729 Bacteria 90193
323 Ga0500625_009353 3300053729 Bacteria 4369
324 2511383240 2511231026 Bacteria 5225445
325 2739651755 2739367664 Bacteria 4114334
326 2740030229 2739367865 Bacteria 4114482
327 2895885950 2895880812 Bacteria 11255272
328 2904437789 2904434214 Bacteria 6230908
329 Ga0105247_10224902
330 JGI24752J21851_1000163
331 Ga0055531_10028870
332 Ga0065704_10088318
333 Ga0065707_10137346
334 Ga0070658_10281828
335 Ga0070683_100474067
336 Ga0070670_100000280
337 Ga0070670_100046370
338 Ga0070670_100139259
339 Ga0070666_10001554
340 Ga0070680_100453085
341 Ga0068868_100149795
342 Ga0070691_10000120
343 Ga0070668_100000833
344 Ga0070668_100021165
345 Ga0070669_100197786
346 Ga0070671_100130462
347 Ga0070671_100308086
348 Ga0070674_100350672
349 Ga0070673_100139851
350 Ga0070667_100000423
351 Ga0070667_100004087
352 Ga0070667_100025137
353 Ga0070667_100224520
354 Ga0070667_100249703
355 Ga0070714_100013646
356 Ga0070713_100000027
357 Ga0070713_100747044
358 Ga0070711_100067685
359 Ga0070705_100485664
360 Ga0070699_100263683
361 Ga0070679_100507347
362 Ga0070684_101138948
363 Ga0070684_101164551
364 Ga0068853_100000776
365 Ga0068853_100079994
366 Ga0068853_100319135
367 Ga0070672_100596052
368 Ga0070693_100188161
369 Ga0070693_100254373
370 Ga0070665_100211156
371 Ga0068855_100023841
372 Ga0070664_100108392
373 Ga0068857_100001805
374 Ga0068857_100233876
375 Ga0068854_100001856
376 Ga0068854_100195825
377 Ga0068854_100352485
378 Ga0068856_100000330
379 Ga0068856_100000393
380 Ga0068852_100059487
381 Ga0068859_100023184
382 Ga0068859_100028929
383 Ga0068859_100034950
384 Ga0068859_100365314
385 Ga0068864_100000264
386 Ga0068864_100004489
387 Ga0068864_100020466
388 Ga0068864_100043371
389 Ga0068861_100091681
390 Ga0068863_100000385
391 Ga0068863_100018850
392 Ga0068863_100102182
393 Ga0068863_100123344
394 Ga0068863_100240730
395 Ga0068858_100020926
396 Ga0068858_100312808
397 Ga0068858_100368607
398 Ga0068860_100000515
399 Ga0068860_100015676
400 Ga0068862_100000398
401 Ga0068862_100039612
402 Ga0068862_100145661
403 Ga0068862_100258678
404 Ga0081539_10020705
405 Ga0070712_100000075
406 Ga0070712_100000501
407 Ga0075369_10261779
408 Ga0075370_10314607
409 Ga0068871_100102060
410 Ga0068871_100176243
411 Ga0068871_100243279
412 Ga0075428_100001139
413 Ga0075430_100313691
414 Ga0075434_100033157
415 Ga0068865_100000195
416 Ga0075436_100000033
417 Ga0097620_100023185
418 Ga0097620_100028929
419 Ga0097620_100034950
420 Ga0097620_100365306
421 Ga0079104_1002341
422 Ga0075435_100093002
423 Ga0105251_10000522
424 Ga0105240_10021522
425 Ga0105240_10181163
426 Ga0105241_10002995
427 Ga0105242_10975195
428 Ga0105248_10000029
429 Ga0105248_10001014
430 Ga0105248_10316212
431 Ga0105237_10130786
432 Ga0105238_10008352
433 Ga0105238_10255062
434 Ga0105249_10000024
435 Ga0105249_10457631
436 Ga0105249_10989648
437 Ga0105239_10108891
438 Ga0105239_10110482
439 Ga0105246_10326368
440 Ga0157373_10028729
441 Ga0157370_10129469
442 Ga0157369_10017171
443 Ga0157374_10050868
444 Ga0163162_10025163
445 Ga0163162_10404252
446 Ga0163162_10647480
447 Ga0157372_10167494
448 Ga0163163_10200692
449 Ga0163163_10355138
450 Ga0163163_10939966
451 Ga0157380_10125517
452 Ga0157380_10257501
453 Ga0157379_10014337
454 Ga0157379_10014572
455 Ga0157379_10042253
456 Ga0157379_11025238
457 Ga0163161_10003070
458 Ga0213876_10000791
459 Ga0213876_10047275
460 Ga0209026_1001430
461 Ga0209257_1000749
462 Ga0207713_1011398
463 Ga0207710_10116498
464 Ga0207680_10001532
465 Ga0207680_10011455
466 Ga0207685_10047008
467 Ga0207699_10002044
468 Ga0207645_10088507
469 Ga0207654_10006117
470 Ga0207654_10271415
471 Ga0207695_10025851
472 Ga0207671_10056246
473 Ga0207693_10000231
474 Ga0207693_10000352
475 Ga0207681_10177631
476 Ga0207650_10000162
477 Ga0207650_10065009
478 Ga0207650_10098954
479 Ga0207650_10668165
480 Ga0207650_10849871
481 Ga0207700_10000124
482 Ga0207664_10010382
483 Ga0207644_10309260
484 Ga0207706_10478983
485 Ga0207704_10010529
486 Ga0207711_10000004
487 Ga0207711_10957152
488 Ga0207661_10327662
489 Ga0207679_10033208
490 Ga0207679_10332565
491 Ga0207667_10098861
492 Ga0207667_10459614
493 Ga0207712_10000034
494 Ga0207668_10002815
495 Ga0207668_10008383
496 Ga0207640_10001358
497 Ga0207640_10963731
498 Ga0207658_10007404
499 Ga0207658_10103782
500 Ga0207703_10129268
501 Ga0207703_10193302
502 Ga0207639_10482006
503 Ga0207639_10853710
504 Ga0207702_10000139
505 Ga0207702_10001152
506 Ga0207641_10000479
507 Ga0207641_10207906
508 Ga0207641_10219074
509 Ga0207641_10360844
510 Ga0207641_10823015
511 Ga0207676_10000036
512 Ga0207676_10018652
513 Ga0207676_10077565
514 Ga0207674_10000297
515 Ga0207675_100036097
516 Ga0207675_100285190
517 Ga0207683_10113262
518 Ga0207683_10321385
519 Ga0207698_10117299
520 Ga0210002_1018146
521 Ga0209983_1024152
522 Ga0209974_10208629
523 Ga0268265_10000386
524 Ga0268265_10008684
525 Ga0268265_10205192
526 Ga0268265_10391637
527 Ga0268265_10516404
528 Ga0268264_10000021
529 Ga0268264_10196620
530 Ga0268264_10210614
531 Ga0265334_10000130
532 Ga0307517_10074078
533 Ga0307515_10455290
534 Ga0265338_10034210
535 Ga0265338_10043206
536 Ga0265338_10136667
537 Ga0265760_10081382
538 Ga0265325_10005659
539 Ga0265339_10018918
540 Ga0265327_10016751
541 Ga0265316_10192684
542 Ga0307513_10002415
543 Ga0307513_10007686
544 Ga0307513_10443906
545 Ga0307408_100329293
546 Ga0307408_100415373
547 Ga0265313_10015961
548 Ga0307405_10196647
549 Ga0307413_10191691
550 Ga0307413_10900654
551 Ga0307413_10920933
552 Ga0307406_10976662
553 Ga0307407_10464013
554 Ga0307412_10339977
555 Ga0307409_100350861
556 Ga0307416_100166131
557 Ga0307416_100544528
558 Ga0307414_10118216
559 Ga0307414_10121698
560 Ga0307414_10223615
561 Ga0307411_10176594
562 Ga0307411_10748479
563 Ga0307415_100192982
564 Ga0373923_0102450
565 Ga0373932_0068276
566 Ga0373936_0001350
567 Ga0373936_0145105
568 Ga0373933_0370151
569 Ga0373937_0036990
570 Ga0373937_0610474
571 Ga0395899_0175716
572 Ga0395900_0281325
573 Ga0395898_0074240
574 Ga0395905_0051845
575 Ga0395905_0116419
576 Ga0436364_1503243
577 Ga0395901_0070754
578 Ga0436365_1207920
579 Ga0436361_0756148
580 Ga0436362_0631473
581 Ga0436362_1205673
582 Ga0451835_0666427
583 Ga0439445_0053138
584 Ga0495650_0027055
585 Ga0495580_0027282
586 Ga0495639_0239973
587 Ga0495630_0133575
588 Ga0495663_0153273
589 Ga0495666_0032794
590 Ga0495642_0062723
591 Ga0495654_0087701
592 Ga0495633_0264546
593 Ga0495668_0057960
594 Ga0495668_0062036
595 Ga0495668_0337000
596 Ga0495611_0028026
597 Ga0495669_0078452
598 Ga0495670_0249695
599 Ga0495600_0286414
600 Ga0495680_0319184
601 Ga0495687_102271
602 Ga0495686_0366728
603 Ga0495615_0026032
604 Ga0496104_0915478
605 Ga0496107_0119725
606 Ga0496108_0334515
607 Ga0496112_0054773
608 Ga0496112_0179321
609 Ga0496114_0033219
610 Ga0496115_0000519
611 Ga0496117_0002815
612 Ga0496118_0000335
613 Ga0496125_0136697
614 Ga0501290_003295
615 Ga0501046_0140201
616 Ga0501070_0797270
617 Ga0501257_017945
618 Ga0501080_0204772
619 nmdc:mga03683_78817_c1
620 nmdc:mga03n38_36998_c1
621 nmdc:mga06r32_85936_c2
622 nmdc:mga0n895_30981_c1
623 nmdc:mga0rr50_62763_c1
624 nmdc:mga08x19_1399_c1
625 nmdc:mga08x19_151_c1
626 nmdc:mga0sz30_35779_c2
627 Ga0500578_0220871
628 Ga0500651_0006734
629 Ga0500641_0198028
630 Ga0500595_002020
631 Ga0500595_003523
632 Ga0500595_029652
633 Ga0500607_190174
634 Ga0500608_030259
635 Ga0500614_087819
636 Ga0500618_000102
637 Ga0500618_002045
638 Ga0500559_0000028
639 Ga0500559_0014684
640 Ga0500559_0181283
641 Ga0500564_000236
642 Ga0500573_0372244
643 Ga0500577_0037282
644 Ga0500588_0046850
645 Ga0500604_0006691
646 Ga0500616_0001435
647 Ga0500636_0000320
648 Ga0500637_0021991
649 Ga0500567_011804
650 Ga0500625_000020
651 Ga0500625_009353
652 2511383240
653 2739651755
654 2740030229
655 2895885950
656 2904437789

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

39

105

0.96

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

29

104

0.9

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

135

224

0.89

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

151

217

0.88

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

34

110

0.87

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

132

222

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hz4-assembly1.cif.gz_A-2 crystal structure of glutathione s-transferase b4xh91 (target efi-501787) from actinobacillus pleuropneumoniae 0.9308 1 205
4hz4-assembly1.cif.gz_A-2 crystal structure of glutathione s-transferase b4xh91 (target efi-501787) from actinobacillus pleuropneumoniae 0.8722 1 205
1n2a-assembly1.cif.gz_B crystal structure of a bacterial glutathione transferase from escherichia coli with glutathione sulfonate in the active site 0.8357 3 205
3qav-assembly1.cif.gz_A crystal structure of a glutathione s-transferase from antarctic clam laternula elliptica 0.8234 2 200
1n2a-assembly1.cif.gz_B crystal structure of a bacterial glutathione transferase from escherichia coli with glutathione sulfonate in the active site 0.8194 3 205
ID Description Score Start End Superfamily
af_Q9P6M1_1_80_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9675 1 80 3.40.30.10
4hz4A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9519 1 81 3.40.30.10
af_Q9P6M1_1_80_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9326 1 80 3.40.30.10
4hz4A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9088 1 81 3.40.30.10
4hz4A02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.8866 84 200 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A0F3II25-F1-model_v4 Glutathione S-transferase 0.9972 1 70 GO:0016740
AF-A0A7G7M7L8-F1-model_v4 deleted 0.9954 1 89
AF-A0A562LPS6-F1-model_v4 Glutathione S-transferase 0.9913 1 81 GO:0016740
AF-A0A6P1R6H8-F1-model_v4 Glutathione S-transferase 0.9881 1 213 GO:0016740
AF-A0A5C4LKD9-F1-model_v4 Glutathione S-transferase family protein 0.9863 1 213 GO:0016740

Map