F409247

General Info

Members Datasets Scaffolds Average Seq Length
328 179 656 263

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10002803|Ga0157372_100028036
Length 308
Sequence VKRSGKRGAAGAGKRATDGRGELQAFLDKKVAEYNRAAFVADDPIRVPHGYSRQQDIEIAAFFTAIFSWGNRTTIIRKSEELMRLMDQAPYEFVLHHTDKDLKRLLDFRHRTFNATDLLYFVAFFRHHYSRYDSLEDAFLRPWEERGPAGEGWEAERALSAFYHYFFSLDETPVRSFSPGAKTKSGPREKLSNDWPSACAVPPRTRKHIASPEKNSSCKRINMFLRWMVRKDNNGVDFGLWRRIGQDRLICPLDVHVARVAKKFGLLTRPSSDWLAAIELTEHLREFDAEDPTKYDFALFGLGALEKF

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
80 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
124 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
125 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
126 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
127 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
130 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
138 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
139 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
140 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
141 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
142 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
146 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
147 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
151 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
152 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
153 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
154 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
155 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
168 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
169 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
170 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
171 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
172 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
173 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
174 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
175 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
176 2738541284 Pedobacter sp. YR016 Isolate Unclassified
177 2738543023 Pedobacter sp. OK628 Isolate Unclassified
178 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
179 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.78
Metatranscriptomes 0
Isolates 1.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.66
Nodule 0
Rhizoplane 0.61
Rhizosphere 90.24
Stem 0
Stem Tuber 0
Unclassified 10.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10002803 3300013307 Bacteria 18830
2 SwRhRL2b_contig_3494997 2162886007 Bacteria 2355
3 rootH2_10000442 3300003320 Bacteria 46233
4 rootH2_10019109 3300003320 Bacteria 8521
5 rootL2_10050729 3300003322 Bacteria 2501
6 rootH1_10164094 3300003323 Bacteria 1759
7 Ga0065714_10003029 3300005288 Bacteria 15216
8 Ga0065714_10003294 3300005288 Bacteria 14467
9 Ga0065704_10000619 3300005289 Bacteria 18504
10 Ga0065704_10071031 3300005289 Bacteria 13589
11 Ga0065704_10197741 3300005289 Bacteria 1160
12 Ga0065712_10083709 3300005290 Bacteria 2804
13 Ga0065712_10188316 3300005290 Unclassified 1148
14 Ga0065707_10151124 3300005295 Unclassified 1657
15 Ga0065707_10323559 3300005295 Unclassified 962
16 Ga0070658_10008178 3300005327 Bacteria 8409
17 Ga0070676_10004140 3300005328 Bacteria 7619
18 Ga0070683_100000518 3300005329 Bacteria 27144
19 Ga0070683_100091003 3300005329 Unclassified 2864
20 Ga0070683_100217165 3300005329 Bacteria 1817
21 Ga0070670_100058397 3300005331 Bacteria 3312
22 Ga0070670_100272493 3300005331 Bacteria 1477
23 Ga0068869_100024922 3300005334 Bacteria 4148
24 Ga0070666_10001663 3300005335 Bacteria 13569
25 Ga0070666_10025947 3300005335 Bacteria 3824
26 Ga0070666_10229802 3300005335 Bacteria 1310
27 Ga0068868_100006112 3300005338 Bacteria 8506
28 Ga0068868_100316455 3300005338 Bacteria 1329
29 Ga0070689_100043718 3300005340 Bacteria 3444
30 Ga0070689_100503763 3300005340 Bacteria 1038
31 Ga0070691_10034369 3300005341 Bacteria 2386
32 Ga0070687_100088330 3300005343 Bacteria 1709
33 Ga0070687_100174065 3300005343 Bacteria 1284
34 Ga0070661_100005565 3300005344 Bacteria 8683
35 Ga0070668_100016400 3300005347 Bacteria 5540
36 Ga0070668_100134715 3300005347 Bacteria 1985
37 Ga0070671_100024774 3300005355 Bacteria 4915
38 Ga0070673_100010375 3300005364 Bacteria 6305
39 Ga0070673_100043659 3300005364 Bacteria 3466
40 Ga0070688_100355485 3300005365 Bacteria 1073
41 Ga0070667_100002757 3300005367 Bacteria 15197
42 Ga0070667_100666332 3300005367 Bacteria 961
43 Ga0070662_100029973 3300005457 Bacteria 3803
44 Ga0070662_100113974 3300005457 Bacteria 2063
45 Ga0070681_10126326 3300005458 Bacteria 2490
46 Ga0068867_100009046 3300005459 Bacteria 7028
47 Ga0068867_100027607 3300005459 Bacteria 4082
48 Ga0068867_100381805 3300005459 Bacteria 1183
49 Ga0068867_100432985 3300005459 Bacteria 1117
50 Ga0070685_10037955 3300005466 Bacteria 2730
51 Ga0070698_100000061 3300005471 Bacteria 78637
52 Ga0070698_100019862 3300005471 Bacteria 7048
53 Ga0070684_100005163 3300005535 Bacteria 9982
54 Ga0070684_100277144 3300005535 Bacteria 1536
55 Ga0068853_100002871 3300005539 Bacteria 13074
56 Ga0068853_100006503 3300005539 Bacteria 9298
57 Ga0068853_100014915 3300005539 Bacteria 6383
58 Ga0068853_100109894 3300005539 Bacteria 2448
59 Ga0070672_100055855 3300005543 Bacteria 3094
60 Ga0070672_100119021 3300005543 Bacteria 2160
61 Ga0070672_100152396 3300005543 Unclassified 1913
62 Ga0070672_100185364 3300005543 Bacteria 1735
63 Ga0070672_100692364 3300005543 Unclassified 892
64 Ga0070696_100286991 3300005546 Bacteria 1256
65 Ga0070665_100055377 3300005548 Bacteria 3978
66 Ga0068855_100093179 3300005563 Unclassified 3474
67 Ga0070664_100017817 3300005564 Bacteria 5832
68 Ga0070664_100099456 3300005564 Bacteria 2528
69 Ga0068857_100006200 3300005577 Bacteria 10223
70 Ga0068857_100067820 3300005577 Bacteria 3175
71 Ga0068856_100023565 3300005614 Bacteria 5985
72 Ga0068852_100006581 3300005616 Bacteria 8412
73 Ga0068852_100047647 3300005616 Bacteria 3657
74 Ga0068852_100338905 3300005616 Unclassified 1465
75 Ga0068852_100383227 3300005616 Unclassified 1380
76 Ga0068852_100407739 3300005616 Bacteria 1338
77 Ga0068859_100086373 3300005617 Bacteria 3184
78 Ga0068864_100346566 3300005618 Bacteria 1400
79 Ga0068864_100360645 3300005618 Bacteria 1373
80 Ga0068861_100569318 3300005719 Bacteria 1035
81 Ga0068851_10002986 3300005834 Bacteria 7474
82 Ga0068851_10011585 3300005834 Bacteria 4138
83 Ga0068863_100049893 3300005841 Bacteria 3968
84 Ga0068863_100172920 3300005841 Unclassified 2072
85 Ga0068863_100616483 3300005841 Bacteria 1075
86 Ga0068858_100003133 3300005842 Bacteria 16560
87 Ga0068860_100000024 3300005843 Bacteria 271902
88 Ga0068860_100084094 3300005843 Bacteria 3027
89 Ga0068860_100893033 3300005843 Unclassified 904
90 Ga0081540_1015017 3300005983 Bacteria 4921
91 Ga0081539_10014388 3300005985 Bacteria 5857
92 Ga0097621_100012127 3300006237 Bacteria 6378
93 Ga0097621_100012967 3300006237 Bacteria 6194
94 Ga0097621_100101373 3300006237 Bacteria 2423
95 Ga0068871_100046225 3300006358 Bacteria 3506
96 Ga0068871_100126315 3300006358 Unclassified 2165
97 Ga0075428_100309368 3300006844 Bacteria 1698
98 Ga0075428_101105484 3300006844 Bacteria 837
99 Ga0075429_100257771 3300006880 Bacteria 1527
100 Ga0068865_100485214 3300006881 Unclassified 1028
101 Ga0097620_100086373 3300006931 Bacteria 3184
102 Ga0105251_10110863 3300009011 Bacteria 1250
103 Ga0105240_10006728 3300009093 Bacteria 16835
104 Ga0105240_10040326 3300009093 Bacteria 5973
105 Ga0111539_10012450 3300009094 Bacteria 10663
106 Ga0111539_10066077 3300009094 Bacteria 4271
107 Ga0114129_10107029 3300009147 Bacteria 3863
108 Ga0105241_10004657 3300009174 Bacteria 10135
109 Ga0105241_10522739 3300009174 Bacteria 1061
110 Ga0105242_10016213 3300009176 Bacteria 5790
111 Ga0105242_10017383 3300009176 Bacteria 5604
112 Ga0105242_10017658 3300009176 Bacteria 5565
113 Ga0105242_10146908 3300009176 Bacteria 2052
114 Ga0105237_10001806 3300009545 Bacteria 27618
115 Ga0105237_10003559 3300009545 Bacteria 18462
116 Ga0105237_10008008 3300009545 Bacteria 11501
117 Ga0105237_10012686 3300009545 Bacteria 8870
118 Ga0105237_10486871 3300009545 Unclassified 1240
119 Ga0105238_10010500 3300009551 Bacteria 9294
120 Ga0105238_10022056 3300009551 Bacteria 6491
121 Ga0105238_10164728 3300009551 Unclassified 2192
122 Ga0105249_10004813 3300009553 Bacteria 11650
123 Ga0105249_10010160 3300009553 Bacteria 8264
124 Ga0105249_10512210 3300009553 Bacteria 1246
125 Ga0105239_10000019 3300010375 Bacteria 273836
126 Ga0105239_10009618 3300010375 Bacteria 10876
127 Ga0105239_10014130 3300010375 Bacteria 8861
128 Ga0105239_10061908 3300010375 Bacteria 4108
129 Ga0105246_10041848 3300011119 Bacteria 3099
130 Ga0157373_10000599 3300013100 Bacteria 28022
131 Ga0157371_10003168 3300013102 Bacteria 15140
132 Ga0157371_10003228 3300013102 Bacteria 14958
133 Ga0157370_10007233 3300013104 Bacteria 12109
134 Ga0157374_10000011 3300013296 Bacteria 466749
135 Ga0157374_10003300 3300013296 Bacteria 13550
136 Ga0157374_10095253 3300013296 Bacteria 2846
137 Ga0157374_10214149 3300013296 Bacteria 1889
138 Ga0157374_10927965 3300013296 Unclassified 889
139 Ga0157378_10016659 3300013297 Bacteria 6440
140 Ga0157378_10017913 3300013297 Bacteria 6217
141 Ga0157378_10289857 3300013297 Unclassified 1581
142 Ga0163162_10008645 3300013306 Bacteria 9914
143 Ga0163162_10090502 3300013306 Bacteria 3141
144 Ga0163162_10124963 3300013306 Bacteria 2678
145 Ga0163162_10165532 3300013306 Bacteria 2334
146 Ga0157372_10004473 3300013307 Bacteria 14914
147 Ga0157372_10054398 3300013307 Bacteria 4465
148 Ga0157375_10112553 3300013308 Unclassified 2822
149 Ga0157375_10391131 3300013308 Bacteria 1557
150 Ga0163163_10004484 3300014325 Bacteria 11913
151 Ga0163163_10041027 3300014325 Bacteria 4524
152 Ga0163163_10210428 3300014325 Bacteria 1994
153 Ga0163163_10415217 3300014325 Bacteria 1404
154 Ga0157380_10009249 3300014326 Bacteria 7053
155 Ga0157380_10589460 3300014326 Unclassified 1098
156 Ga0157380_10804571 3300014326 Bacteria 957
157 Ga0182008_10000009 3300014497 Bacteria 331416
158 Ga0182008_10030753 3300014497 Bacteria 2706
159 Ga0182008_10100181 3300014497 Bacteria 1431
160 Ga0157379_10020051 3300014968 Bacteria 5909
161 Ga0157376_10000417 3300014969 Bacteria 27639
162 Ga0157376_10027216 3300014969 Bacteria 4529
163 Ga0157376_10131080 3300014969 Bacteria 2237
164 Ga0157376_10210828 3300014969 Bacteria 1793
165 Ga0157376_10383473 3300014969 Bacteria 1354
166 Ga0157376_10754062 3300014969 Bacteria 983
167 Ga0182006_1009786 3300015261 Bacteria 4286
168 Ga0182006_1012946 3300015261 Bacteria 3637
169 Ga0182007_10023778 3300015262 Bacteria 2151
170 Ga0163161_10030346 3300017792 Bacteria 3847
171 Ga0163161_10033381 3300017792 Bacteria 3678
172 Ga0163161_10075132 3300017792 Bacteria 2479
173 Ga0163161_10207344 3300017792 Bacteria 1513
174 Ga0213876_10006047 3300021384 Bacteria 6615
175 Ga0207697_10128826 3300025315 Bacteria 1093
176 Ga0207656_10056153 3300025321 Unclassified 1716
177 Ga0207642_10005710 3300025899 Bacteria 4080
178 Ga0207680_10018164 3300025903 Bacteria 3731
179 Ga0207680_10422949 3300025903 Unclassified 944
180 Ga0207647_10011639 3300025904 Bacteria 6161
181 Ga0207645_10005727 3300025907 Bacteria 8964
182 Ga0207645_10019707 3300025907 Bacteria 4421
183 Ga0207645_10139387 3300025907 Bacteria 1580
184 Ga0207705_10005298 3300025909 Bacteria 9651
185 Ga0207654_10002554 3300025911 Bacteria 9235
186 Ga0207695_10016301 3300025913 Bacteria 8701
187 Ga0207695_10064772 3300025913 Unclassified 3761
188 Ga0207671_10006343 3300025914 Bacteria 10552
189 Ga0207671_10009432 3300025914 Bacteria 8160
190 Ga0207671_10187861 3300025914 Bacteria 1610
191 Ga0207671_10206730 3300025914 Bacteria 1534
192 Ga0207671_10289445 3300025914 Unclassified 1293
193 Ga0207662_10109499 3300025918 Bacteria 1721
194 Ga0207694_10121235 3300025924 Unclassified 2088
195 Ga0207650_10005814 3300025925 Bacteria 8415
196 Ga0207644_10113416 3300025931 Bacteria 2053
197 Ga0207706_10008034 3300025933 Bacteria 9737
198 Ga0207706_10046810 3300025933 Bacteria 3828
199 Ga0207686_10002888 3300025934 Bacteria 9265
200 Ga0207686_10095246 3300025934 Bacteria 1975
201 Ga0207670_10016255 3300025936 Bacteria 4467
202 Ga0207704_10078690 3300025938 Unclassified 2122
203 Ga0207691_10000753 3300025940 Bacteria 32051
204 Ga0207691_10218733 3300025940 Unclassified 1652
205 Ga0207689_10019017 3300025942 Bacteria 5794
206 Ga0207689_10025842 3300025942 Bacteria 4919
207 Ga0207689_10065629 3300025942 Bacteria 2985
208 Ga0207689_10167934 3300025942 Bacteria 1808
209 Ga0207679_10007353 3300025945 Bacteria 6984
210 Ga0207679_10222141 3300025945 Bacteria 1590
211 Ga0207667_10000098 3300025949 Bacteria 140051
212 Ga0207667_10017975 3300025949 Bacteria 7945
213 Ga0207651_10006033 3300025960 Bacteria 6290
214 Ga0207651_10008698 3300025960 Bacteria 5503
215 Ga0207712_10002618 3300025961 Bacteria 11539
216 Ga0207712_10106226 3300025961 Unclassified 2097
217 Ga0207712_10123128 3300025961 Bacteria 1965
218 Ga0207668_10002845 3300025972 Bacteria 10140
219 Ga0207668_10063497 3300025972 Unclassified 2606
220 Ga0207658_10012138 3300025986 Bacteria 5875
221 Ga0207677_10027924 3300026023 Bacteria 3563
222 Ga0207703_10011137 3300026035 Bacteria 7003
223 Ga0207639_10007951 3300026041 Bacteria 7244
224 Ga0207639_10058874 3300026041 Bacteria 2957
225 Ga0207639_10131516 3300026041 Bacteria 2072
226 Ga0207639_10319363 3300026041 Bacteria 1378
227 Ga0207678_10060360 3300026067 Bacteria 3262
228 Ga0207702_10025627 3300026078 Bacteria 4895
229 Ga0207641_10010791 3300026088 Bacteria 7489
230 Ga0207641_10012655 3300026088 Bacteria 6917
231 Ga0207648_10000768 3300026089 Bacteria 36105
232 Ga0207648_10000820 3300026089 Bacteria 35151
233 Ga0207648_10161304 3300026089 Bacteria 1980
234 Ga0207648_10274126 3300026089 Bacteria 1508
235 Ga0207676_10017707 3300026095 Bacteria 5168
236 Ga0207676_10035971 3300026095 Bacteria 3764
237 Ga0207676_10080406 3300026095 Bacteria 2645
238 Ga0207676_10085953 3300026095 Bacteria 2568
239 Ga0207676_10234752 3300026095 Bacteria 1642
240 Ga0207674_10007157 3300026116 Bacteria 13036
241 Ga0207674_10025519 3300026116 Bacteria 6301
242 Ga0207674_10039317 3300026116 Bacteria 4904
243 Ga0207675_100479560 3300026118 Bacteria 1236
244 Ga0207675_100516518 3300026118 Eukaryota 1190
245 Ga0207698_10030685 3300026142 Unclassified 3870
246 Ga0207698_10099357 3300026142 Bacteria 2407
247 Ga0207698_10109574 3300026142 Bacteria 2311
248 Ga0207698_10318004 3300026142 Bacteria 1456
249 Ga0207698_10338270 3300026142 Unclassified 1417
250 Ga0207698_10348909 3300026142 Bacteria 1397
251 Ga0207428_10207958 3300027907 Bacteria 1471
252 Ga0268266_10038540 3300028379 Bacteria 4068
253 Ga0268264_10000079 3300028381 Bacteria 249516
254 Ga0268264_10012206 3300028381 Bacteria 7069
255 Ga0268264_10084127 3300028381 Bacteria 2727
256 Ga0268264_10400133 3300028381 Bacteria 1319
257 Ga0307517_10020651 3300028786 Bacteria 8377
258 Ga0307515_10000001 3300028794 Bacteria 4259510
259 Ga0307511_10000076 3300030521 Bacteria 82520
260 Ga0265327_10000030 3300031251 Bacteria 333531
261 Ga0265327_10000212 3300031251 Bacteria 121556
262 Ga0265327_10117556 3300031251 Bacteria 1264
263 Ga0265316_10226843 3300031344 Bacteria 1377
264 Ga0307513_10209877 3300031456 Unclassified 1780
265 Ga0307513_10320341 3300031456 Bacteria 1309
266 Ga0307509_10269644 3300031507 Bacteria 1471
267 Ga0307516_10023258 3300031730 Bacteria 6356
268 Ga0307516_10044143 3300031730 Unclassified 4413
269 Ga0307412_10000084 3300031911 Bacteria 90908
270 Ga0307414_10000131 3300032004 Bacteria 51831
271 Ga0307414_10137123 3300032004 Bacteria 1910
272 Ga0373943_0092438 3300035170 Bacteria 1569
273 Ga0373935_0161487 3300035692 Unclassified 1528
274 Ga0373935_0259276 3300035692 Bacteria 1219
275 Ga0373937_0004293 3300036401 Bacteria 12079
276 Ga0436365_0121411 3300039437 Bacteria 11439
277 Ga0436365_0409072 3300039437 Bacteria 2065
278 Ga0451577_0075519 3300042876 Bacteria 3005
279 Ga0466969_0094335 3300044656 Bacteria 1415
280 Ga0466972_0021086 3300044658 Bacteria 3252
281 Ga0453683_0093650 3300044673 Unclassified 1884
282 Ga0453684_0089975 3300044712 Bacteria 3793
283 Ga0453684_0126101 3300044712 Bacteria 3081
284 Ga0466971_0120571 3300044719 Bacteria 1214
285 Ga0466959_0001742 3300045049 Bacteria 13544
286 Ga0451576_0287536 3300045051 Bacteria 1719
287 Ga0466958_0101426 3300045836 Bacteria 1790
288 Ga0495638_0036793 3300046460 Bacteria 3116
289 Ga0495650_0087730 3300046471 Bacteria 1189
290 Ga0495580_0089240 3300046472 Bacteria 2146
291 Ga0495630_0255987 3300046517 Bacteria 1337
292 Ga0495643_0077708 3300046522 Bacteria 1734
293 Ga0495648_0006617 3300046524 Bacteria 9399
294 Ga0495649_0011851 3300046694 Bacteria 5098
295 Ga0495672_0009118 3300047320 Bacteria 7232
296 Ga0495687_001296 3300047443 Bacteria 23472
297 Ga0495684_0089048 3300047471 Bacteria 2339
298 Ga0496109_0708221 3300048912 Bacteria 944
299 Ga0496114_0002926 3300048917 Bacteria 13088
300 Ga0501031_0037411 3300049568 Bacteria 3166
301 Ga0501032_0037801 3300049569 Bacteria 3290
302 Ga0501034_0000007 3300049571 Bacteria 357805
303 Ga0501036_0072726 3300049572 Bacteria 2906
304 Ga0501040_0675378 3300049576 Bacteria 747
305 Ga0501043_0007087 3300049579 Bacteria 8920
306 Ga0501043_0387435 3300049579 Bacteria 1057
307 Ga0501046_0014871 3300049580 Bacteria 6551
308 Ga0501241_002174 3300049758 Bacteria 3832
309 Ga0501044_0010855 3300049823 Bacteria 9883
310 Ga0501044_0074816 3300049823 Bacteria 3440
311 Ga0501044_0685904 3300049823 Bacteria 911
312 Ga0500583_0000153 3300053092 Bacteria 28587
313 Ga0500583_0000864 3300053092 Bacteria 8746
314 Ga0500583_0004037 3300053092 Bacteria 4720
315 Ga0500651_0000645 3300053093 Bacteria 17394
316 Ga0500642_0007559 3300053130 Bacteria 3660
317 Ga0500568_0018060 3300053139 Bacteria 3097
318 Ga0500568_0073525 3300053139 Unclassified 1306
319 Ga0500568_0101376 3300053139 Bacteria 1080
320 Ga0500589_022137 3300053147 Unclassified 2922
321 Ga0500616_0195776 3300053153 Bacteria 899
322 Ga0500622_0001618 3300053156 Bacteria 17675
323 Ga0500637_0019770 3300053178 Bacteria 3638
324 Ga0466962_0004351 3300061719 Bacteria 6796
325 2738762775 2738541284 Bacteria 5199923
326 2739300452 2738543023 Bacteria 6767879
327 2776614340 2775506987 Bacteria 5373360
328 2852630280 2852627209 Bacteria 5896285
329 Ga0157372_10002803
330 SwRhRL2b_contig_3494997
331 rootH2_10000442
332 rootH2_10019109
333 rootL2_10050729
334 rootH1_10164094
335 Ga0065714_10003029
336 Ga0065714_10003294
337 Ga0065704_10000619
338 Ga0065704_10071031
339 Ga0065704_10197741
340 Ga0065712_10083709
341 Ga0065712_10188316
342 Ga0065707_10151124
343 Ga0065707_10323559
344 Ga0070658_10008178
345 Ga0070676_10004140
346 Ga0070683_100000518
347 Ga0070683_100091003
348 Ga0070683_100217165
349 Ga0070670_100058397
350 Ga0070670_100272493
351 Ga0068869_100024922
352 Ga0070666_10001663
353 Ga0070666_10025947
354 Ga0070666_10229802
355 Ga0068868_100006112
356 Ga0068868_100316455
357 Ga0070689_100043718
358 Ga0070689_100503763
359 Ga0070691_10034369
360 Ga0070687_100088330
361 Ga0070687_100174065
362 Ga0070661_100005565
363 Ga0070668_100016400
364 Ga0070668_100134715
365 Ga0070671_100024774
366 Ga0070673_100010375
367 Ga0070673_100043659
368 Ga0070688_100355485
369 Ga0070667_100002757
370 Ga0070667_100666332
371 Ga0070662_100029973
372 Ga0070662_100113974
373 Ga0070681_10126326
374 Ga0068867_100009046
375 Ga0068867_100027607
376 Ga0068867_100381805
377 Ga0068867_100432985
378 Ga0070685_10037955
379 Ga0070698_100000061
380 Ga0070698_100019862
381 Ga0070684_100005163
382 Ga0070684_100277144
383 Ga0068853_100002871
384 Ga0068853_100006503
385 Ga0068853_100014915
386 Ga0068853_100109894
387 Ga0070672_100055855
388 Ga0070672_100119021
389 Ga0070672_100152396
390 Ga0070672_100185364
391 Ga0070672_100692364
392 Ga0070696_100286991
393 Ga0070665_100055377
394 Ga0068855_100093179
395 Ga0070664_100017817
396 Ga0070664_100099456
397 Ga0068857_100006200
398 Ga0068857_100067820
399 Ga0068856_100023565
400 Ga0068852_100006581
401 Ga0068852_100047647
402 Ga0068852_100338905
403 Ga0068852_100383227
404 Ga0068852_100407739
405 Ga0068859_100086373
406 Ga0068864_100346566
407 Ga0068864_100360645
408 Ga0068861_100569318
409 Ga0068851_10002986
410 Ga0068851_10011585
411 Ga0068863_100049893
412 Ga0068863_100172920
413 Ga0068863_100616483
414 Ga0068858_100003133
415 Ga0068860_100000024
416 Ga0068860_100084094
417 Ga0068860_100893033
418 Ga0081540_1015017
419 Ga0081539_10014388
420 Ga0097621_100012127
421 Ga0097621_100012967
422 Ga0097621_100101373
423 Ga0068871_100046225
424 Ga0068871_100126315
425 Ga0075428_100309368
426 Ga0075428_101105484
427 Ga0075429_100257771
428 Ga0068865_100485214
429 Ga0097620_100086373
430 Ga0105251_10110863
431 Ga0105240_10006728
432 Ga0105240_10040326
433 Ga0111539_10012450
434 Ga0111539_10066077
435 Ga0114129_10107029
436 Ga0105241_10004657
437 Ga0105241_10522739
438 Ga0105242_10016213
439 Ga0105242_10017383
440 Ga0105242_10017658
441 Ga0105242_10146908
442 Ga0105237_10001806
443 Ga0105237_10003559
444 Ga0105237_10008008
445 Ga0105237_10012686
446 Ga0105237_10486871
447 Ga0105238_10010500
448 Ga0105238_10022056
449 Ga0105238_10164728
450 Ga0105249_10004813
451 Ga0105249_10010160
452 Ga0105249_10512210
453 Ga0105239_10000019
454 Ga0105239_10009618
455 Ga0105239_10014130
456 Ga0105239_10061908
457 Ga0105246_10041848
458 Ga0157373_10000599
459 Ga0157371_10003168
460 Ga0157371_10003228
461 Ga0157370_10007233
462 Ga0157374_10000011
463 Ga0157374_10003300
464 Ga0157374_10095253
465 Ga0157374_10214149
466 Ga0157374_10927965
467 Ga0157378_10016659
468 Ga0157378_10017913
469 Ga0157378_10289857
470 Ga0163162_10008645
471 Ga0163162_10090502
472 Ga0163162_10124963
473 Ga0163162_10165532
474 Ga0157372_10004473
475 Ga0157372_10054398
476 Ga0157375_10112553
477 Ga0157375_10391131
478 Ga0163163_10004484
479 Ga0163163_10041027
480 Ga0163163_10210428
481 Ga0163163_10415217
482 Ga0157380_10009249
483 Ga0157380_10589460
484 Ga0157380_10804571
485 Ga0182008_10000009
486 Ga0182008_10030753
487 Ga0182008_10100181
488 Ga0157379_10020051
489 Ga0157376_10000417
490 Ga0157376_10027216
491 Ga0157376_10131080
492 Ga0157376_10210828
493 Ga0157376_10383473
494 Ga0157376_10754062
495 Ga0182006_1009786
496 Ga0182006_1012946
497 Ga0182007_10023778
498 Ga0163161_10030346
499 Ga0163161_10033381
500 Ga0163161_10075132
501 Ga0163161_10207344
502 Ga0213876_10006047
503 Ga0207697_10128826
504 Ga0207656_10056153
505 Ga0207642_10005710
506 Ga0207680_10018164
507 Ga0207680_10422949
508 Ga0207647_10011639
509 Ga0207645_10005727
510 Ga0207645_10019707
511 Ga0207645_10139387
512 Ga0207705_10005298
513 Ga0207654_10002554
514 Ga0207695_10016301
515 Ga0207695_10064772
516 Ga0207671_10006343
517 Ga0207671_10009432
518 Ga0207671_10187861
519 Ga0207671_10206730
520 Ga0207671_10289445
521 Ga0207662_10109499
522 Ga0207694_10121235
523 Ga0207650_10005814
524 Ga0207644_10113416
525 Ga0207706_10008034
526 Ga0207706_10046810
527 Ga0207686_10002888
528 Ga0207686_10095246
529 Ga0207670_10016255
530 Ga0207704_10078690
531 Ga0207691_10000753
532 Ga0207691_10218733
533 Ga0207689_10019017
534 Ga0207689_10025842
535 Ga0207689_10065629
536 Ga0207689_10167934
537 Ga0207679_10007353
538 Ga0207679_10222141
539 Ga0207667_10000098
540 Ga0207667_10017975
541 Ga0207651_10006033
542 Ga0207651_10008698
543 Ga0207712_10002618
544 Ga0207712_10106226
545 Ga0207712_10123128
546 Ga0207668_10002845
547 Ga0207668_10063497
548 Ga0207658_10012138
549 Ga0207677_10027924
550 Ga0207703_10011137
551 Ga0207639_10007951
552 Ga0207639_10058874
553 Ga0207639_10131516
554 Ga0207639_10319363
555 Ga0207678_10060360
556 Ga0207702_10025627
557 Ga0207641_10010791
558 Ga0207641_10012655
559 Ga0207648_10000768
560 Ga0207648_10000820
561 Ga0207648_10161304
562 Ga0207648_10274126
563 Ga0207676_10017707
564 Ga0207676_10035971
565 Ga0207676_10080406
566 Ga0207676_10085953
567 Ga0207676_10234752
568 Ga0207674_10007157
569 Ga0207674_10025519
570 Ga0207674_10039317
571 Ga0207675_100479560
572 Ga0207675_100516518
573 Ga0207698_10030685
574 Ga0207698_10099357
575 Ga0207698_10109574
576 Ga0207698_10318004
577 Ga0207698_10338270
578 Ga0207698_10348909
579 Ga0207428_10207958
580 Ga0268266_10038540
581 Ga0268264_10000079
582 Ga0268264_10012206
583 Ga0268264_10084127
584 Ga0268264_10400133
585 Ga0307517_10020651
586 Ga0307515_10000001
587 Ga0307511_10000076
588 Ga0265327_10000030
589 Ga0265327_10000212
590 Ga0265327_10117556
591 Ga0265316_10226843
592 Ga0307513_10209877
593 Ga0307513_10320341
594 Ga0307509_10269644
595 Ga0307516_10023258
596 Ga0307516_10044143
597 Ga0307412_10000084
598 Ga0307414_10000131
599 Ga0307414_10137123
600 Ga0373943_0092438
601 Ga0373935_0161487
602 Ga0373935_0259276
603 Ga0373937_0004293
604 Ga0436365_0121411
605 Ga0436365_0409072
606 Ga0451577_0075519
607 Ga0466969_0094335
608 Ga0466972_0021086
609 Ga0453683_0093650
610 Ga0453684_0089975
611 Ga0453684_0126101
612 Ga0466971_0120571
613 Ga0466959_0001742
614 Ga0451576_0287536
615 Ga0466958_0101426
616 Ga0495638_0036793
617 Ga0495650_0087730
618 Ga0495580_0089240
619 Ga0495630_0255987
620 Ga0495643_0077708
621 Ga0495648_0006617
622 Ga0495649_0011851
623 Ga0495672_0009118
624 Ga0495687_001296
625 Ga0495684_0089048
626 Ga0496109_0708221
627 Ga0496114_0002926
628 Ga0501031_0037411
629 Ga0501032_0037801
630 Ga0501034_0000007
631 Ga0501036_0072726
632 Ga0501040_0675378
633 Ga0501043_0007087
634 Ga0501043_0387435
635 Ga0501046_0014871
636 Ga0501241_002174
637 Ga0501044_0010855
638 Ga0501044_0074816
639 Ga0501044_0685904
640 Ga0500583_0000153
641 Ga0500583_0000864
642 Ga0500583_0004037
643 Ga0500651_0000645
644 Ga0500642_0007559
645 Ga0500568_0018060
646 Ga0500568_0073525
647 Ga0500568_0101376
648 Ga0500589_022137
649 Ga0500616_0195776
650 Ga0500622_0001618
651 Ga0500637_0019770
652 Ga0466962_0004351
653 2738762775
654 2739300452
655 2776614340
656 2852630280

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09674

DUF2400

Protein of unknown function (DUF2400)

43

305

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bq7-assembly1.cif.gz_A structure of the mouse 8-oxoguanine dna glycosylase mogg1 in complex with ligand th2829 0.5843 41 282
6u7t-assembly1.cif.gz_A muty adenine glycosylase bound to dna containing a transition state analog (1n) paired with d(8-oxo-g) 0.5769 8 283
4uob-assembly1.cif.gz_A crystal structure of deinococcus radiodurans endonuclease iii-3 0.5711 34 283
4ejz-assembly2.cif.gz_B structure of mbogg1 in complex with low affinity dna ligand 0.5657 44 286
8dwd-assembly1.cif.gz_A adenine glycosylase muty variant e43s in complex with dna containing d(8-oxo-g) paired with an ap site generated by the enzyme acting on purine 0.5521 24 283
ID Description Score Start End Superfamily
3kntA01 Mainly Alpha;Orthogonal Bundle;Endonuclease Iii, domain 2;Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 0.6749 228 280 1.10.1670.10
3kntA01 Mainly Alpha;Orthogonal Bundle;Endonuclease Iii, domain 2;Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 0.4171 228 280 1.10.1670.10
af_P05100_1_187_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.4024 41 175 1.10.340.30
af_Q2FXR7_1_186_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.3709 43 181 1.10.340.30
af_P05100_1_187_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.3119 41 175 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A645HUA0-F1-model_v4 DUF2400 family protein 0.9847 202 284
AF-A0A645HW04-F1-model_v4 DUF2400 domain-containing protein 0.9806 202 285
AF-A0A7Y4WMZ4-F1-model_v4 TIGR02757 family protein 0.9766 5 286
AF-A0A352J6W5-F1-model_v4 TIGR02757 family protein 0.9765 190 285
AF-A0A2V8GN52-F1-model_v4 TIGR02757 family protein 0.9765 188 282 GO:0003824
GO:0006281

Map