F409252

General Info

Members Datasets Scaffolds Average Seq Length
328 220 320 236

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10014376|Ga0157380_100143765
Length 280
Sequence MPEVLPCSSAGATFENVKPGGGRRQRPYDAANHWGGVCMNNRVNSLGQPVGYQVPHWKAVNPPPKALIDGRYCRIEPIDIDRHAADLFEAISDDADGRTWTYMAYGPFGTLPEYRAWMKTTCLGDDPLFHAVIDSSTDKAVGVASYLRIDPKFGVIETGHIHYSPRLQRTRAATEAMYLMMRRVFEELGYRRYEWKCDALNEPSRKAAARLGFSFEGVFRQATIYKGRNRDTAWFAIIDHEWPALKAAYETWLDPGNFDAHGKQQQSLGALTAAALGVKP

Samples

Sample ID Description Type Environment
1 2643221561 Nocardioides sp. Root151 Isolate Unclassified
2 2643221609 Acidovorax sp. Root217 Isolate Unclassified
3 2643221611 Acidovorax sp. Root219 Isolate Unclassified
4 2643221696 Nocardioides sp. Root140 Isolate Unclassified
5 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
6 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
7 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
8 2941479691
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
80 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
132 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
133 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
143 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
144 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
145 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
146 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
147 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
154 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
155 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
156 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
157 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
158 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
159 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
160 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
161 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
162 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
175 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
176 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
177 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
193 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
194 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
197 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
198 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
213 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
214 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
215 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
216 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
217 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.26
Metatranscriptomes 0.3
Isolates 2.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.76
Nodule 0
Rhizoplane 3.05
Rhizosphere 79.57
Stem 0
Stem Tuber 0
Unclassified 7.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000992 3300002987 Bacteria 12273
2 rootH1_10094136 3300003323 Bacteria 3862
3 Ga0055526_1002394 3300003771 Bacteria 12702
4 Ga0055526_1003145 3300003771 Bacteria 10695
5 Ga0055537_1000709 3300003773 Bacteria 17283
6 Ga0055524_1000082 3300003775 Bacteria 119749
7 Ga0055528_1002493 3300003790 Bacteria 9828
8 Ga0055530_10000688 3300003791 Bacteria 28617
9 Ga0055540_1000010 3300003792 Bacteria 290865
10 Ga0065165_1009717 3300005262 Bacteria 4263
11 Ga0065707_10249851 3300005295 Bacteria 1129
12 Ga0070658_10012971 3300005327 Bacteria 6688
13 Ga0068869_100209141 3300005334 Bacteria 1542
14 Ga0070680_100057337 3300005336 Bacteria 3184
15 Ga0070682_100147094 3300005337 Bacteria 1613
16 Ga0068868_100119716 3300005338 Bacteria 2147
17 Ga0070660_100125209 3300005339 Bacteria 2053
18 Ga0070692_10392308 3300005345 Bacteria 874
19 Ga0070668_100165819 3300005347 Bacteria 1795
20 Ga0070669_100071957 3300005353 Bacteria 2559
21 Ga0070669_100165860 3300005353 Bacteria 1719
22 Ga0070675_100001263 3300005354 Bacteria 18495
23 Ga0070659_100014521 3300005366 Bacteria 5886
24 Ga0070659_100074191 3300005366 Bacteria 2710
25 Ga0070714_100570503 3300005435 Bacteria 1085
26 Ga0070713_100327343 3300005436 Bacteria 1416
27 Ga0070700_100239281 3300005441 Bacteria 1296
28 Ga0070708_100004995 3300005445 Bacteria 10487
29 Ga0070663_100694677 3300005455 Bacteria 864
30 Ga0070662_100102429 3300005457 Bacteria 2169
31 Ga0070681_10071685 3300005458 Bacteria 3429
32 Ga0068867_100214851 3300005459 Bacteria 1547
33 Ga0070706_100022875 3300005467 Bacteria 5756
34 Ga0070698_100154388 3300005471 Bacteria 2241
35 Ga0070699_100054690 3300005518 Unclassified 3455
36 Ga0070699_100073174 3300005518 Bacteria 2981
37 Ga0070699_100167911 3300005518 Bacteria 1944
38 Ga0070679_100006034 3300005530 Bacteria 11271
39 Ga0070679_100613277 3300005530 Bacteria 1031
40 Ga0070697_100024824 3300005536 Plasmid 4773
41 Ga0070697_100304212 3300005536 Bacteria 1371
42 Ga0068853_100103098 3300005539 Bacteria 2525
43 Ga0070686_100150837 3300005544 Bacteria 1628
44 Ga0068855_100050656 3300005563 Bacteria 4892
45 Ga0070664_100025800 3300005564 Bacteria 4872
46 Ga0070664_100289672 3300005564 Bacteria 1478
47 Ga0070702_100336218 3300005615 Bacteria 1058
48 Ga0068860_100219972 3300005843 Bacteria 1844
49 Ga0068860_100709362 3300005843 Bacteria 1016
50 Ga0081538_10009622 3300005981 Bacteria 8038
51 Ga0070717_10430990 3300006028 Unclassified 1187
52 Ga0075365_10021629 3300006038 Bacteria 4015
53 Ga0068871_100053469 3300006358 Bacteria 3273
54 Ga0075434_100296827 3300006871 Bacteria 1636
55 Ga0075434_100536008 3300006871 Unclassified 1190
56 Ga0075434_100614480 3300006871 Unclassified 1106
57 Ga0068865_100013142 3300006881 Bacteria 5224
58 Ga0068865_100235429 3300006881 Bacteria 1438
59 Ga0099795_10002085 3300007788 Bacteria 4595
60 Ga0105240_10001785 3300009093 Bacteria 36285
61 Ga0105240_10045087 3300009093 Bacteria 5596
62 Ga0111539_10000283 3300009094 Bacteria 61000
63 Ga0111539_10093667 3300009094 Bacteria 3528
64 Ga0105245_10212616 3300009098 Bacteria 1862
65 Ga0105245_11213895 3300009098 Bacteria 802
66 Ga0114129_10135191 3300009147 Bacteria 3383
67 Ga0114129_10271393 3300009147 Bacteria 2269
68 Ga0114129_10832780 3300009147 Bacteria 1174
69 Ga0114129_10928806 3300009147 Bacteria 1101
70 Ga0105243_10588985 3300009148 Bacteria 1069
71 Ga0105242_10046608 3300009176 Bacteria 3517
72 Ga0105242_10252081 3300009176 Bacteria 1591
73 Ga0105242_10258662 3300009176 Bacteria 1572
74 Ga0105248_10077764 3300009177 Bacteria 3730
75 Ga0105248_10752118 3300009177 Unclassified 1100
76 Ga0105237_10006601 3300009545 Bacteria 12827
77 Ga0105237_10031531 3300009545 Bacteria 5372
78 Ga0105237_10082185 3300009545 Bacteria 3212
79 Ga0105238_10000063 3300009551 Bacteria 123809
80 Ga0105238_10917651 3300009551 Bacteria 895
81 Ga0105249_10148914 3300009553 Bacteria 2251
82 Ga0099796_10034654 3300010159 Bacteria 1669
83 Ga0105239_10001427 3300010375 Bacteria 31882
84 Ga0105239_10868717 3300010375 Bacteria 1035
85 Ga0157370_10005401 3300013104 Bacteria 14334
86 Ga0163162_10211460 3300013306 Bacteria 2069
87 Ga0163162_10280385 3300013306 Bacteria 1799
88 Ga0163162_10333998 3300013306 Bacteria 1648
89 Ga0157375_11212659 3300013308 Bacteria 885
90 Ga0163163_10433009 3300014325 Bacteria 1374
91 Ga0163163_10522512 3300014325 Bacteria 1249
92 Ga0157380_10014376 3300014326 Bacteria 5790
93 Ga0182008_10020524 3300014497 Bacteria 3401
94 Ga0157379_10189852 3300014968 Bacteria 1857
95 Ga0157379_10355505 3300014968 Bacteria 1342
96 Ga0157376_10011883 3300014969 Bacteria 6437
97 Ga0206356_10034130 3300020070 Bacteria 1558
98 Ga0213872_10007389 3300021361 Bacteria 5410
99 Ga0213872_10080336 3300021361 Bacteria 1465
100 Ga0213872_10112492 3300021361 Bacteria 1208
101 Ga0213872_10130347 3300021361 Bacteria 1108
102 Ga0213876_10096569 3300021384 Bacteria 1565
103 Ga0209129_1035653 3300025258 Bacteria 808
104 Ga0209565_1000036 3300025263 Bacteria 293334
105 Ga0209673_1000282 3300025273 Bacteria 95013
106 Ga0209130_1000151 3300025284 Bacteria 107021
107 Ga0209675_1000751 3300025291 Bacteria 21867
108 Ga0209675_1012585 3300025291 Bacteria 2713
109 Ga0209676_1000007 3300025292 Bacteria 1029371
110 Ga0209676_1018497 3300025292 Bacteria 2429
111 Ga0209564_1000729 3300025295 Bacteria 46947
112 Ga0209564_1000903 3300025295 Bacteria 38881
113 Ga0209050_1000003 3300025298 Bacteria 1609245
114 Ga0209050_1002339 3300025298 Bacteria 16628
115 Ga0209256_1000001 3300025299 Bacteria 2166974
116 Ga0207426_1001878 3300025302 Bacteria 15369
117 Ga0209051_1000003 3300025303 Bacteria 1609245
118 Ga0209051_1014181 3300025303 Bacteria 3733
119 Ga0209257_1000020 3300025304 Bacteria 773356
120 Ga0207642_10167380 3300025899 Bacteria 1186
121 Ga0207705_10015851 3300025909 Bacteria 5413
122 Ga0207684_10022785 3300025910 Bacteria 5347
123 Ga0207707_10005765 3300025912 Bacteria 10828
124 Ga0207695_10003498 3300025913 Bacteria 22039
125 Ga0207671_10003791 3300025914 Bacteria 14837
126 Ga0207671_10103551 3300025914 Bacteria 2159
127 Ga0207671_10316013 3300025914 Bacteria 1235
128 Ga0207693_10022829 3300025915 Bacteria 4967
129 Ga0207660_10017940 3300025917 Bacteria 4712
130 Ga0207660_10474223 3300025917 Bacteria 1014
131 Ga0207657_10127683 3300025919 Bacteria 2087
132 Ga0207657_10158672 3300025919 Bacteria 1838
133 Ga0207681_10123525 3300025923 Bacteria 1902
134 Ga0207681_10179860 3300025923 Bacteria 1610
135 Ga0207694_10001975 3300025924 Bacteria 16971
136 Ga0207694_10014513 3300025924 Bacteria 5939
137 Ga0207659_10018237 3300025926 Bacteria 4599
138 Ga0207700_10030078 3300025928 Bacteria 3841
139 Ga0207664_10330682 3300025929 Bacteria 1346
140 Ga0207690_10063823 3300025932 Bacteria 2513
141 Ga0207690_10071933 3300025932 Bacteria 2387
142 Ga0207706_10051606 3300025933 Bacteria 3631
143 Ga0207706_10299849 3300025933 Bacteria 1400
144 Ga0207686_10036544 3300025934 Bacteria 2958
145 Ga0207669_10020721 3300025937 Bacteria 3454
146 Ga0207704_10013150 3300025938 Bacteria 4134
147 Ga0207704_10253011 3300025938 Bacteria 1323
148 Ga0207711_10051732 3300025941 Bacteria 3519
149 Ga0207711_10446527 3300025941 Bacteria 1204
150 Ga0207679_10005100 3300025945 Bacteria 8213
151 Ga0207667_10000216 3300025949 Bacteria 80609
152 Ga0207712_10015436 3300025961 Bacteria 4929
153 Ga0207668_10679950 3300025972 Bacteria 903
154 Ga0207703_10791267 3300026035 Bacteria 905
155 Ga0207678_10048772 3300026067 Bacteria 3660
156 Ga0207708_10282116 3300026075 Bacteria 1346
157 Ga0207641_10082927 3300026088 Bacteria 2787
158 Ga0207648_10315641 3300026089 Bacteria 1404
159 Ga0207674_10382728 3300026116 Bacteria 1360
160 Ga0207675_100025209 3300026118 Bacteria 5535
161 Ga0209371_1041349 3300027312 Bacteria 933
162 Ga0209981_1001434 3300027378 Bacteria 3012
163 Ga0210000_1013248 3300027462 Bacteria 1230
164 Ga0209995_1012297 3300027471 Bacteria 1396
165 Ga0209970_1033662 3300027614 Bacteria 897
166 Ga0209974_10003268 3300027876 Bacteria 5860
167 Ga0207428_10001439 3300027907 Bacteria 25009
168 Ga0268265_10607785 3300028380 Bacteria 1046
169 Ga0268265_10971741 3300028380 Bacteria 838
170 Ga0268264_10458619 3300028381 Bacteria 1236
171 Ga0268264_10555517 3300028381 Bacteria 1126
172 Ga0268256_1046919 3300030500 Bacteria 933
173 Ga0265328_10069358 3300031239 Bacteria 1295
174 Ga0265329_10005116 3300031242 Bacteria 5346
175 Ga0307408_100150713 3300031548 Bacteria 1835
176 Ga0265314_10000389 3300031711 Bacteria 59681
177 Ga0307410_10100051 3300031852 Bacteria 2076
178 Ga0307410_10274103 3300031852 Bacteria 1321
179 Ga0307410_10367587 3300031852 Bacteria 1154
180 Ga0307407_10091970 3300031903 Bacteria 1862
181 Ga0307412_10002597 3300031911 Bacteria 10032
182 Ga0307409_100379023 3300031995 Bacteria 1344
183 Ga0307409_100466933 3300031995 Bacteria 1221
184 Ga0307416_100162771 3300032002 Bacteria 2065
185 Ga0307416_100598867 3300032002 Bacteria 1182
186 Ga0307411_10008584 3300032005 Bacteria 5305
187 Ga0307411_10063185 3300032005 Bacteria 2473
188 Ga0373952_0008838 3300035092 Bacteria 1917
189 Ga0373939_0005098 3300035114 Bacteria 3122
190 Ga0373941_0015469 3300035115 Bacteria 2058
191 Ga0373960_0021601 3300035121 Bacteria 1714
192 Ga0373946_0008881 3300035171 Bacteria 3692
193 Ga0316574_0190759 3300035398 Bacteria 1318
194 Ga0373931_0000611 3300035691 Bacteria 14798
195 Ga0373927_0131321 3300035695 Bacteria 1636
196 Ga0373947_0274641 3300035725 Bacteria 1119
197 Ga0400483_012271 3300039062 Bacteria 15360
198 Ga0400483_064861 3300039062 Bacteria 2367
199 Ga0400483_244292 3300039062 Bacteria 3480
200 Ga0400483_246197 3300039062 Bacteria 8889
201 Ga0400483_254494 3300039062 Bacteria 1109
202 Ga0436365_1149121 3300039437 Bacteria 3369
203 Ga0436365_1928739 3300039437 Bacteria 7039
204 Ga0436361_0047187 3300039447 Bacteria 15576
205 Ga0436361_1029863 3300039447 Bacteria 1351
206 Ga0436361_1165271 3300039447 Bacteria 12230
207 Ga0436363_0544542 3300039450 Bacteria 2616
208 Ga0436362_0927393 3300039453 Bacteria 3974
209 Ga0436362_1160388 3300039453 Bacteria 2432
210 Ga0439442_015479 3300042002 Bacteria 1572
211 Ga0439445_0080593 3300042004 Bacteria 909
212 Ga0439457_041225 3300042014 Bacteria 1029
213 Ga0439446_0010452 3300042156 Bacteria 2499
214 Ga0439446_0130170 3300042156 Bacteria 815
215 Ga0439464_0011583 3300042439 Bacteria 2338
216 Ga0451577_0078301 3300042876 Bacteria 2947
217 Ga0453684_0053144 3300044712 Bacteria 5290
218 Ga0453684_0095254 3300044712 Bacteria 3660
219 Ga0466958_0000025 3300045836 Bacteria 42350
220 Ga0495580_0045149 3300046472 Bacteria 3131
221 Ga0496102_0082085 3300048905 Bacteria 2973
222 Ga0496104_0183753 3300048907 Bacteria 2001
223 Ga0496105_0111553 3300048908 Bacteria 2257
224 Ga0496106_0510204 3300048909 Unclassified 966
225 Ga0496108_0000469 3300048911 Bacteria 32315
226 Ga0496110_0126076 3300048913 Bacteria 2310
227 Ga0496110_0321725 3300048913 Bacteria 1409
228 Ga0496110_0402490 3300048913 Bacteria 1248
229 Ga0496112_0057075 3300048915 Bacteria 3843
230 Ga0496112_0520686 3300048915 Bacteria 1124
231 Ga0496116_0016981 3300048919 Bacteria 5672
232 Ga0496121_0017993 3300048924 Bacteria 7161
233 Ga0496122_0000165 3300048925 Bacteria 157612
234 Ga0496123_0001042 3300048926 Bacteria 41981
235 Ga0496124_0118379 3300048927 Bacteria 2120
236 Ga0496124_0284272 3300048927 Bacteria 1204
237 Ga0496125_0092920 3300048928 Bacteria 2253
238 Ga0496125_0227197 3300048928 Bacteria 1197
239 Ga0501032_0065424 3300049569 Bacteria 2431
240 Ga0501032_0179700 3300049569 Bacteria 1385
241 Ga0501033_0047747 3300049570 Bacteria 3183
242 Ga0501033_0138637 3300049570 Bacteria 1759
243 Ga0501033_0392560 3300049570 Bacteria 968
244 Ga0501034_0064932 3300049571 Bacteria 3663
245 Ga0501036_0017723 3300049572 Bacteria 5961
246 Ga0501036_0090079 3300049572 Bacteria 2591
247 Ga0501037_0043422 3300049573 Bacteria 3303
248 Ga0501037_0126890 3300049573 Bacteria 1831
249 Ga0501038_0028442 3300049574 Bacteria 4967
250 Ga0501038_0074896 3300049574 Bacteria 2862
251 Ga0501038_0471239 3300049574 Bacteria 963
252 Ga0501039_0039095 3300049575 Bacteria 3664
253 Ga0501040_0233028 3300049576 Bacteria 1311
254 Ga0501041_0012067 3300049577 Bacteria 5115
255 Ga0501041_0454859 3300049577 Bacteria 813
256 Ga0501042_0014840 3300049578 Bacteria 5322
257 Ga0501043_0017139 3300049579 Bacteria 5681
258 Ga0501043_0309612 3300049579 Bacteria 1205
259 Ga0501046_0044312 3300049580 Bacteria 3538
260 Ga0501046_0439150 3300049580 Bacteria 939
261 Ga0501047_0270753 3300049581 Bacteria 1544
262 Ga0501047_0617837 3300049581 Bacteria 904
263 Ga0501048_0007203 3300049582 Bacteria 8448
264 Ga0501048_0497005 3300049582 Bacteria 874
265 Ga0501067_0001307 3300049583 Bacteria 13493
266 Ga0501067_0013714 3300049583 Bacteria 4488
267 Ga0501068_0010722 3300049584 Bacteria 5152
268 Ga0501069_0028839 3300049585 Bacteria 3044
269 Ga0501070_0043475 3300049586 Bacteria 3737
270 Ga0501070_0630541 3300049586 Bacteria 852
271 Ga0501073_0004294 3300049589 Bacteria 10690
272 Ga0501074_0197461 3300049590 Bacteria 1434
273 Ga0501075_0016098 3300049591 Bacteria 5380
274 Ga0501076_0005240 3300049592 Bacteria 9295
275 Ga0501076_0069169 3300049592 Bacteria 2821
276 Ga0501077_0066283 3300049593 Bacteria 2290
277 Ga0501077_0150805 3300049593 Bacteria 1475
278 Ga0501077_0551747 3300049593 Bacteria 739
279 Ga0501079_0166944 3300049741 Bacteria 1716
280 Ga0501079_0476694 3300049741 Bacteria 980
281 Ga0501080_0009051 3300049742 Bacteria 9061
282 Ga0501080_0010430 3300049742 Bacteria 8505
283 Ga0501080_0055716 3300049742 Bacteria 3682
284 Ga0501081_0003386 3300049743 Bacteria 10149
285 Ga0501081_0166968 3300049743 Bacteria 1588
286 Ga0501083_0032672 3300049744 Bacteria 3567
287 Ga0501083_0084875 3300049744 Bacteria 2095
288 Ga0501035_0052685 3300049822 Bacteria 3640
289 Ga0501035_0117142 3300049822 Bacteria 2331
290 Ga0501035_0434227 3300049822 Bacteria 1088
291 Ga0501044_0110559 3300049823 Bacteria 2756
292 Ga0501044_0417837 3300049823 Bacteria 1251
293 nmdc:mga0yw44_264512_c1 3300050492 Bacteria 1147
294 nmdc:mga05p37_26638_c1 3300050507 Bacteria 7030
295 nmdc:mga0qj67_435160_c1 3300050509 Bacteria 1057
296 nmdc:mga08y16_16_c1 3300050511 Bacteria 386948
297 nmdc:mga08y16_659512_c1 3300050511 Bacteria 1050
298 nmdc:mga0n895_10604_c1 3300050512 Bacteria 8156
299 nmdc:mga0n895_385836_c1 3300050512 Unclassified 1417
300 nmdc:mga0n895_908_c1 3300050512 Bacteria 21366
301 nmdc:mga0rr50_3_c1 3300050513 Bacteria 353622
302 nmdc:mga0rr50_428960_c1 3300050513 Bacteria 1119
303 nmdc:mga08x19_176_c1 3300050514 Bacteria 51743
304 nmdc:mga08x19_28484_c1 3300050514 Bacteria 3498
305 nmdc:mga08x19_331870_c1 3300050514 Bacteria 1060
306 Ga0500556_0095459 3300053104 Bacteria 1140
307 Ga0500658_0055893 3300053134 Bacteria 1626
308 Ga0500573_0007226 3300053140 Bacteria 6052
309 Ga0500633_0120729 3300053160 Bacteria 975
310 Ga0501084_0027038 3300054114 Bacteria 4793
311 Ga0501084_0036395 3300054114 Bacteria 4111
312 Ga0501084_0109683 3300054114 Bacteria 2319
313 Ga0501084_0223555 3300054114 Bacteria 1589
314 Ga0501084_0529715 3300054114 Bacteria 996
315 Ga0590075_002461 3300059424 Bacteria 4428
316 Ga0501082_0016560 3300060353 Bacteria 6346
317 Ga0501082_0068529 3300060353 Bacteria 3054
318 Ga0501082_0096706 3300060353 Bacteria 2552
319 Ga0501082_0234758 3300060353 Bacteria 1596
320 Ga0501082_0445027 3300060353 Bacteria 1132

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032002 Ga0307416_100598867 Ga0307416_1005988671 201
2 3300049593 Ga0501077_0551747 Ga0501077_0551747_10_615 201
3 3300049569 Ga0501032_0065424 Ga0501032_0065424_1730_2353 207
4 3300049569 Ga0501032_0179700 Ga0501032_0179700_750_1373 207
5 3300049570 Ga0501033_0047747 Ga0501033_0047747_206_829 207
6 3300049570 Ga0501033_0392560 Ga0501033_0392560_42_665 207
7 3300049571 Ga0501034_0064932 Ga0501034_0064932_2581_3204 207
8 3300049572 Ga0501036_0017723 Ga0501036_0017723_2977_3600 207
9 3300049573 Ga0501037_0043422 Ga0501037_0043422_319_942 207
10 3300049574 Ga0501038_0074896 Ga0501038_0074896_1972_2595 207
11 3300049574 Ga0501038_0471239 Ga0501038_0471239_37_660 207
12 3300049579 Ga0501043_0309612 Ga0501043_0309612_65_688 207
13 3300049580 Ga0501046_0044312 Ga0501046_0044312_1872_2495 207
14 3300049581 Ga0501047_0270753 Ga0501047_0270753_171_794 207
15 3300049581 Ga0501047_0617837 Ga0501047_0617837_113_736 207
16 3300049582 Ga0501048_0007203 Ga0501048_0007203_5492_6115 207
17 3300049582 Ga0501048_0497005 Ga0501048_0497005_141_764 207
18 3300049583 Ga0501067_0013714 Ga0501067_0013714_1512_2135 207
19 3300049584 Ga0501068_0010722 Ga0501068_0010722_2258_2881 207
20 3300049585 Ga0501069_0028839 Ga0501069_0028839_77_700 207
21 3300049586 Ga0501070_0043475 Ga0501070_0043475_2977_3600 207
22 3300049586 Ga0501070_0630541 Ga0501070_0630541_136_759 207
23 3300049589 Ga0501073_0004294 Ga0501073_0004294_6792_7415 207
24 3300049590 Ga0501074_0197461 Ga0501074_0197461_77_700 207
25 3300049592 Ga0501076_0069169 Ga0501076_0069169_228_851 207
26 3300049741 Ga0501079_0166944 Ga0501079_0166944_343_966 207
27 3300049741 Ga0501079_0476694 Ga0501079_0476694_17_640 207
28 3300049742 Ga0501080_0009051 Ga0501080_0009051_8268_8891 207
29 3300049744 Ga0501083_0032672 Ga0501083_0032672_336_959 207
30 3300049822 Ga0501035_0052685 Ga0501035_0052685_343_966 207
31 3300049822 Ga0501035_0434227 Ga0501035_0434227_341_964 207
32 3300049823 Ga0501044_0110559 Ga0501044_0110559_1791_2414 207
33 3300049823 Ga0501044_0417837 Ga0501044_0417837_341_964 207
34 3300054114 Ga0501084_0529715 Ga0501084_0529715_238_861 207
35 3300060353 Ga0501082_0068529 Ga0501082_0068529_2413_3036 207
36 3300005353 Ga0070669_100165860 Ga0070669_1001658602 209
37 3300005354 Ga0070675_100001263 Ga0070675_1000012637 209
38 3300025926 Ga0207659_10018237 Ga0207659_100182373 209
39 3300005445 Ga0070708_100004995 Ga0070708_10000499513 210
40 3300006028 Ga0070717_10430990 Ga0070717_104309902 210
41 3300009147 Ga0114129_10271393 Ga0114129_102713932 210
42 3300021384 Ga0213876_10096569 Ga0213876_100965692 210
43 3300027378 Ga0209981_1001434 Ga0209981_10014344 210
44 3300027462 Ga0210000_1013248 Ga0210000_10132482 210
45 3300027471 Ga0209995_1012297 Ga0209995_10122972 210
46 3300027614 Ga0209970_1033662 Ga0209970_10336622 210
47 3300027876 Ga0209974_10003268 Ga0209974_100032685 210
48 3300039437 Ga0436365_1149121 Ga0436365_1149121_2422_3060 210
49 3300039453 Ga0436362_1160388 Ga0436362_1160388_1008_1646 210
50 3300005564 Ga0070664_100289672 Ga0070664_1002896721 211
51 3300006038 Ga0075365_10021629 Ga0075365_100216293 219
52 3300025919 Ga0207657_10158672 Ga0207657_101586722 223
53 3300025933 Ga0207706_10299849 Ga0207706_102998491 223
54 3300005334 Ga0068869_100209141 Ga0068869_1002091412 224
55 3300005338 Ga0068868_100119716 Ga0068868_1001197162 224
56 3300005459 Ga0068867_100214851 Ga0068867_1002148512 224
57 3300005843 Ga0068860_100219972 Ga0068860_1002199722 224
58 3300006881 Ga0068865_100235429 Ga0068865_1002354292 224
59 3300009098 Ga0105245_10212616 Ga0105245_102126162 224
60 3300009176 Ga0105242_10046608 Ga0105242_100466082 224
61 3300009551 Ga0105238_10917651 Ga0105238_109176512 224
62 3300014968 Ga0157379_10355505 Ga0157379_103555052 224
63 3300025934 Ga0207686_10036544 Ga0207686_100365442 224
64 3300025938 Ga0207704_10013150 Ga0207704_100131503 224
65 3300026035 Ga0207703_10791267 Ga0207703_107912672 224
66 3300026089 Ga0207648_10315641 Ga0207648_103156412 224
67 3300028381 Ga0268264_10458619 Ga0268264_104586192 224
68 3300048928 Ga0496125_0227197 Ga0496125_0227197_504_1184 226
69 3300005455 Ga0070663_100694677 Ga0070663_1006946771 227
70 3300009553 Ga0105249_10148914 Ga0105249_101489142 227
71 3300013306 Ga0163162_10333998 Ga0163162_103339982 227
72 iso_pu_bacteria 2887443736 2887446975 227
73 3300005366 Ga0070659_100074191 Ga0070659_1000741912 228
74 3300005457 Ga0070662_100102429 Ga0070662_1001024291 228
75 3300005564 Ga0070664_100025800 Ga0070664_1000258005 228
76 3300025932 Ga0207690_10063823 Ga0207690_100638233 228
77 3300025933 Ga0207706_10051606 Ga0207706_100516063 228
78 3300025945 Ga0207679_10005100 Ga0207679_100051007 228
79 3300026067 Ga0207678_10048772 Ga0207678_100487723 228
80 3300028380 Ga0268265_10971741 Ga0268265_109717412 228
81 3300042002 Ga0439442_015479 Ga0439442_015479_633_1322 228
82 3300042004 Ga0439445_0080593 Ga0439445_0080593_194_883 228
83 3300042014 Ga0439457_041225 Ga0439457_041225_120_809 228
84 3300042156 Ga0439446_0130170 Ga0439446_0130170_97_786 228
85 3300042439 Ga0439464_0011583 Ga0439464_0011583_1572_2312 228
86 3300039450 Ga0436363_0544542 Ga0436363_0544542_720_1412 229
87 3300035092 Ga0373952_0008838 Ga0373952_0008838_42_752 230
88 3300035114 Ga0373939_0005098 Ga0373939_0005098_2084_2794 230
89 3300035691 Ga0373931_0000611 Ga0373931_0000611_9248_9958 230
90 3300049583 Ga0501067_0001307 Ga0501067_0001307_3295_3987 230
91 3300049744 Ga0501083_0084875 Ga0501083_0084875_403_1095 230
92 3300050511 nmdc:mga08y16_659512_c1 nmdc:mga08y16_659512_c1_122_832 230
93 3300050512 nmdc:mga0n895_10604_c1 nmdc:mga0n895_10604_c1_2658_3368 230
94 3300054114 Ga0501084_0027038 Ga0501084_0027038_2972_3664 230
95 3300054114 Ga0501084_0109683 Ga0501084_0109683_1490_2182 230
96 3300060353 Ga0501082_0096706 Ga0501082_0096706_1489_2181 230
97 3300060353 Ga0501082_0234758 Ga0501082_0234758_84_776 230
98 iso_pu_bacteria 2643221561 2643828174 230
99 iso_pu_bacteria 2643221696 2644531263 230
100 3300039062 Ga0400483_254494 Ga0400483_254494_320_1015 231
101 3300053134 Ga0500658_0055893 Ga0500658_0055893_668_1366 231
102 3300050492 nmdc:mga0yw44_264512_c1 nmdc:mga0yw44_264512_c1_413_1117 232
103 3300005336 Ga0070680_100057337 Ga0070680_1000573374 233
104 3300005458 Ga0070681_10071685 Ga0070681_100716852 233
105 3300005530 Ga0070679_100006034 Ga0070679_1000060348 233
106 3300020070 Ga0206356_10034130 Ga0206356_100341302 233
107 3300025912 Ga0207707_10005765 Ga0207707_1000576512 233
108 3300025917 Ga0207660_10017940 Ga0207660_100179403 233
109 3300042156 Ga0439446_0010452 Ga0439446_0010452_203_919 233
110 3300050514 nmdc:mga08x19_28484_c1 nmdc:mga08x19_28484_c1_2406_3107 233
111 3300060353 Ga0501082_0445027 Ga0501082_0445027_119_829 233
112 3300026116 Ga0207674_10382728 Ga0207674_103827282 234
113 3300031852 Ga0307410_10274103 Ga0307410_102741032 234
114 3300035398 Ga0316574_0190759 Ga0316574_0190759_502_1206 234
115 3300048915 Ga0496112_0520686 Ga0496112_0520686_19_744 234
116 3300006881 Ga0068865_100013142 Ga0068865_1000131425 235
117 3300039062 Ga0400483_012271 Ga0400483_012271_10331_11044 235
118 3300039062 Ga0400483_064861 Ga0400483_064861_1059_1790 235
119 3300039062 Ga0400483_244292 Ga0400483_244292_2047_2778 235
120 3300039062 Ga0400483_246197 Ga0400483_246197_1822_2535 235
121 3300044712 Ga0453684_0053144 Ga0453684_0053144_427_1140 235
122 3300049593 Ga0501077_0150805 Ga0501077_0150805_362_1069 235
123 3300050512 nmdc:mga0n895_908_c1 nmdc:mga0n895_908_c1_4456_5169 235
124 3300050513 nmdc:mga0rr50_3_c1 nmdc:mga0rr50_3_c1_97722_98435 235
125 3300050514 nmdc:mga08x19_176_c1 nmdc:mga08x19_176_c1_24746_25459 235
126 3300021361 Ga0213872_10130347 Ga0213872_101303472 236
127 3300039437 Ga0436365_1928739 Ga0436365_1928739_5769_6488 236
128 3300039447 Ga0436361_0047187 Ga0436361_0047187_3664_4383 236
129 3300039453 Ga0436362_0927393 Ga0436362_0927393_1605_2324 236
130 3300042876 Ga0451577_0078301 Ga0451577_0078301_1632_2399 236
131 3300049577 Ga0501041_0454859 Ga0501041_0454859_15_743 236
132 3300054114 Ga0501084_0223555 Ga0501084_0223555_278_1003 236
133 3300005337 Ga0070682_100147094 Ga0070682_1001470942 237
134 3300005615 Ga0070702_100336218 Ga0070702_1003362181 237
135 3300009094 Ga0111539_10093667 Ga0111539_100936673 237
136 3300014968 Ga0157379_10189852 Ga0157379_101898521 237
137 3300021361 Ga0213872_10007389 Ga0213872_100073893 237
138 3300021361 Ga0213872_10080336 Ga0213872_100803363 237
139 3300021361 Ga0213872_10112492 Ga0213872_101124921 237
140 3300025917 Ga0207660_10474223 Ga0207660_104742232 237
141 3300039447 Ga0436361_1029863 Ga0436361_1029863_557_1285 237
142 3300039447 Ga0436361_1165271 Ga0436361_1165271_3702_4430 237
143 3300045836 Ga0466958_0000025 Ga0466958_0000025_29899_30648 237
144 3300048911 Ga0496108_0000469 Ga0496108_0000469_16466_17185 237
145 3300048913 Ga0496110_0126076 Ga0496110_0126076_1515_2243 237
146 3300049570 Ga0501033_0138637 Ga0501033_0138637_868_1587 237
147 3300049572 Ga0501036_0090079 Ga0501036_0090079_1004_1723 237
148 3300049573 Ga0501037_0126890 Ga0501037_0126890_698_1417 237
149 3300049574 Ga0501038_0028442 Ga0501038_0028442_3709_4428 237
150 3300049575 Ga0501039_0039095 Ga0501039_0039095_435_1154 237
151 3300049576 Ga0501040_0233028 Ga0501040_0233028_175_894 237
152 3300049577 Ga0501041_0012067 Ga0501041_0012067_3875_4594 237
153 3300049578 Ga0501042_0014840 Ga0501042_0014840_247_966 237
154 3300049579 Ga0501043_0017139 Ga0501043_0017139_2250_2969 237
155 3300049580 Ga0501046_0439150 Ga0501046_0439150_44_763 237
156 3300049591 Ga0501075_0016098 Ga0501075_0016098_773_1492 237
157 3300049592 Ga0501076_0005240 Ga0501076_0005240_646_1365 237
158 3300049593 Ga0501077_0066283 Ga0501077_0066283_1096_1815 237
159 3300049742 Ga0501080_0055716 Ga0501080_0055716_1609_2328 237
160 3300049743 Ga0501081_0003386 Ga0501081_0003386_4725_5444 237
161 3300049743 Ga0501081_0166968 Ga0501081_0166968_316_1035 237
162 3300049822 Ga0501035_0117142 Ga0501035_0117142_226_945 237
163 3300053104 Ga0500556_0095459 Ga0500556_0095459_402_1118 237
164 3300053160 Ga0500633_0120729 Ga0500633_0120729_241_957 237
165 3300054114 Ga0501084_0036395 Ga0501084_0036395_749_1468 237
166 3300060353 Ga0501082_0016560 Ga0501082_0016560_2639_3358 237
167 iso_pu_bacteria 2643221609 2644057351 237
168 iso_pu_bacteria 2643221611 2644072554 237
169 3300003323 rootH1_10094136 rootH1_100941363 238
170 3300005327 Ga0070658_10012971 Ga0070658_100129714 238
171 3300005339 Ga0070660_100125209 Ga0070660_1001252092 238
172 3300005366 Ga0070659_100014521 Ga0070659_1000145212 238
173 3300005435 Ga0070714_100570503 Ga0070714_1005705032 238
174 3300005436 Ga0070713_100327343 Ga0070713_1003273432 238
175 3300005471 Ga0070698_100154388 Ga0070698_1001543883 238
176 3300005536 Ga0070697_100304212 Ga0070697_1003042122 238
177 3300005563 Ga0068855_100050656 Ga0068855_1000506564 238
178 3300006358 Ga0068871_100053469 Ga0068871_1000534692 238
179 3300006871 Ga0075434_100296827 Ga0075434_1002968272 238
180 3300007788 Ga0099795_10002085 Ga0099795_100020852 238
181 3300009093 Ga0105240_10045087 Ga0105240_100450874 238
182 3300009176 Ga0105242_10258662 Ga0105242_102586622 238
183 3300009177 Ga0105248_10077764 Ga0105248_100777644 238
184 3300009545 Ga0105237_10031531 Ga0105237_100315312 238
185 3300010159 Ga0099796_10034654 Ga0099796_100346542 238
186 3300013104 Ga0157370_10005401 Ga0157370_100054019 238
187 3300014325 Ga0163163_10433009 Ga0163163_104330092 238
188 3300014497 Ga0182008_10020524 Ga0182008_100205242 238
189 3300014969 Ga0157376_10011883 Ga0157376_100118835 238
190 3300025899 Ga0207642_10167380 Ga0207642_101673802 238
191 3300025909 Ga0207705_10015851 Ga0207705_100158514 238
192 3300025914 Ga0207671_10316013 Ga0207671_103160131 238
193 3300025915 Ga0207693_10022829 Ga0207693_100228294 238
194 3300025919 Ga0207657_10127683 Ga0207657_101276832 238
195 3300025923 Ga0207681_10179860 Ga0207681_101798602 238
196 3300025928 Ga0207700_10030078 Ga0207700_100300782 238
197 3300025929 Ga0207664_10330682 Ga0207664_103306822 238
198 3300025932 Ga0207690_10071933 Ga0207690_100719332 238
199 3300025938 Ga0207704_10253011 Ga0207704_102530112 238
200 3300025941 Ga0207711_10051732 Ga0207711_100517323 238
201 3300025941 Ga0207711_10446527 Ga0207711_104465271 238
202 3300025949 Ga0207667_10000216 Ga0207667_1000021667 238
203 3300035115 Ga0373941_0015469 Ga0373941_0015469_76_801 238
204 3300035121 Ga0373960_0021601 Ga0373960_0021601_375_1100 238
205 3300035171 Ga0373946_0008881 Ga0373946_0008881_193_918 238
206 3300035695 Ga0373927_0131321 Ga0373927_0131321_207_932 238
207 3300035725 Ga0373947_0274641 Ga0373947_0274641_377_1102 238
208 3300046472 Ga0495580_0045149 Ga0495580_0045149_2359_3084 238
209 3300048907 Ga0496104_0183753 Ga0496104_0183753_937_1656 238
210 3300048908 Ga0496105_0111553 Ga0496105_0111553_708_1427 238
211 3300048913 Ga0496110_0321725 Ga0496110_0321725_604_1329 238
212 3300048915 Ga0496112_0057075 Ga0496112_0057075_2559_3284 238
213 3300050513 nmdc:mga0rr50_428960_c1 nmdc:mga0rr50_428960_c1_331_1056 238
214 3300050514 nmdc:mga08x19_331870_c1 nmdc:mga08x19_331870_c1_37_762 238
215 iso_pu_bacteria 2941479691 2941480784 238
216 3300005345 Ga0070692_10392308 Ga0070692_103923081 239
217 3300005467 Ga0070706_100022875 Ga0070706_1000228752 239
218 3300005518 Ga0070699_100054690 Ga0070699_1000546904 239
219 3300005530 Ga0070679_100613277 Ga0070679_1006132771 239
220 3300005536 Ga0070697_100024824 Ga0070697_1000248245 239
221 3300005544 Ga0070686_100150837 Ga0070686_1001508371 239
222 3300005843 Ga0068860_100709362 Ga0068860_1007093621 239
223 3300006871 Ga0075434_100536008 Ga0075434_1005360081 239
224 3300006871 Ga0075434_100614480 Ga0075434_1006144801 239
225 3300009098 Ga0105245_11213895 Ga0105245_112138951 239
226 3300009147 Ga0114129_10832780 Ga0114129_108327802 239
227 3300009147 Ga0114129_10928806 Ga0114129_109288061 239
228 3300009148 Ga0105243_10588985 Ga0105243_105889852 239
229 3300009176 Ga0105242_10252081 Ga0105242_102520812 239
230 3300009177 Ga0105248_10752118 Ga0105248_107521181 239
231 3300009545 Ga0105237_10082185 Ga0105237_100821854 239
232 3300009551 Ga0105238_10000063 Ga0105238_1000006321 239
233 3300010375 Ga0105239_10868717 Ga0105239_108687171 239
234 3300013306 Ga0163162_10211460 Ga0163162_102114602 239
235 3300013308 Ga0157375_11212659 Ga0157375_112126591 239
236 3300025910 Ga0207684_10022785 Ga0207684_100227852 239
237 3300025914 Ga0207671_10103551 Ga0207671_101035514 239
238 3300025924 Ga0207694_10001975 Ga0207694_1000197512 239
239 3300026088 Ga0207641_10082927 Ga0207641_100829271 239
240 3300028380 Ga0268265_10607785 Ga0268265_106077852 239
241 3300028381 Ga0268264_10555517 Ga0268264_105555171 239
242 3300031239 Ga0265328_10069358 Ga0265328_100693582 239
243 3300031242 Ga0265329_10005116 Ga0265329_100051165 239
244 3300031711 Ga0265314_10000389 Ga0265314_1000038937 239
245 3300044712 Ga0453684_0095254 Ga0453684_0095254_1959_2684 239
246 3300048909 Ga0496106_0510204 Ga0496106_0510204_82_819 239
247 3300048913 Ga0496110_0402490 Ga0496110_0402490_331_1098 239
248 3300049742 Ga0501080_0010430 Ga0501080_0010430_2454_3209 239
249 3300050509 nmdc:mga0qj67_435160_c1 nmdc:mga0qj67_435160_c1_145_873 239
250 3300050512 nmdc:mga0n895_385836_c1 nmdc:mga0n895_385836_c1_226_951 239
251 3300053140 Ga0500573_0007226 Ga0500573_0007226_3940_4671 239
252 3300005518 Ga0070699_100073174 Ga0070699_1000731742 240
253 3300048905 Ga0496102_0082085 Ga0496102_0082085_348_1076 240
254 3300005295 Ga0065707_10249851 Ga0065707_102498512 241
255 3300005347 Ga0070668_100165819 Ga0070668_1001658191 241
256 3300005353 Ga0070669_100071957 Ga0070669_1000719573 241
257 3300005441 Ga0070700_100239281 Ga0070700_1002392811 241
258 3300005518 Ga0070699_100167911 Ga0070699_1001679111 241
259 3300005539 Ga0068853_100103098 Ga0068853_1001030983 241
260 3300005981 Ga0081538_10009622 Ga0081538_100096222 241
261 3300009093 Ga0105240_10001785 Ga0105240_100017859 241
262 3300009094 Ga0111539_10000283 Ga0111539_1000028338 241
263 3300009147 Ga0114129_10135191 Ga0114129_101351912 241
264 3300009545 Ga0105237_10006601 Ga0105237_100066017 241
265 3300010375 Ga0105239_10001427 Ga0105239_1000142722 241
266 3300013306 Ga0163162_10280385 Ga0163162_102803852 241
267 3300014325 Ga0163163_10522512 Ga0163163_105225122 241
268 3300014326 Ga0157380_10014376 Ga0157380_100143765 241
269 3300025913 Ga0207695_10003498 Ga0207695_100034986 241
270 3300025914 Ga0207671_10003791 Ga0207671_100037917 241
271 3300025923 Ga0207681_10123525 Ga0207681_101235252 241
272 3300025924 Ga0207694_10014513 Ga0207694_100145136 241
273 3300025937 Ga0207669_10020721 Ga0207669_100207212 241
274 3300025961 Ga0207712_10015436 Ga0207712_100154362 241
275 3300025972 Ga0207668_10679950 Ga0207668_106799501 241
276 3300026075 Ga0207708_10282116 Ga0207708_102821162 241
277 3300026118 Ga0207675_100025209 Ga0207675_1000252092 241
278 3300027907 Ga0207428_10001439 Ga0207428_1000143917 241
279 3300031548 Ga0307408_100150713 Ga0307408_1001507131 241
280 3300031852 Ga0307410_10100051 Ga0307410_101000511 241
281 3300031852 Ga0307410_10367587 Ga0307410_103675872 241
282 3300031903 Ga0307407_10091970 Ga0307407_100919704 241
283 3300031995 Ga0307409_100379023 Ga0307409_1003790232 241
284 3300031995 Ga0307409_100466933 Ga0307409_1004669331 241
285 3300032002 Ga0307416_100162771 Ga0307416_1001627712 241
286 3300032005 Ga0307411_10008584 Ga0307411_100085845 241
287 3300032005 Ga0307411_10063185 Ga0307411_100631851 241
288 3300050507 nmdc:mga05p37_26638_c1 nmdc:mga05p37_26638_c1_5626_6357 241
289 3300050511 nmdc:mga08y16_16_c1 nmdc:mga08y16_16_c1_245712_246473 241
290 3300059424 Ga0590075_002461 Ga0590075_002461_2689_3525 241
291 3300027312 Ga0209371_1041349 Ga0209371_10413491 242
292 3300030500 Ga0268256_1046919 Ga0268256_10469192 242
293 3300031911 Ga0307412_10002597 Ga0307412_100025978 242
294 3300048919 Ga0496116_0016981 Ga0496116_0016981_1158_1886 242
295 3300048924 Ga0496121_0017993 Ga0496121_0017993_4889_5617 242
296 3300048925 Ga0496122_0000165 Ga0496122_0000165_141805_142533 242
297 3300048926 Ga0496123_0001042 Ga0496123_0001042_9701_10429 242
298 3300048927 Ga0496124_0118379 Ga0496124_0118379_291_1019 242
299 3300048928 Ga0496125_0092920 Ga0496125_0092920_55_783 242
300 iso_pu_bacteria 2808606395 2809031303 242
301 iso_pu_bacteria 2857537821 2857539381 242
302 3300025292 Ga0209676_1018497 Ga0209676_10184972 243
303 3300025298 Ga0209050_1002339 Ga0209050_10023396 243
304 3300025303 Ga0209051_1014181 Ga0209051_10141812 243
305 3300048927 Ga0496124_0284272 Ga0496124_0284272_21_773 243
306 3300002987 JGI25159J45721_1000992 JGI25159J45721_10009927 247
307 3300003771 Ga0055526_1002394 Ga0055526_10023945 247
308 3300003771 Ga0055526_1003145 Ga0055526_10031453 247
309 3300003773 Ga0055537_1000709 Ga0055537_10007093 247
310 3300003775 Ga0055524_1000082 Ga0055524_1000082104 247
311 3300003790 Ga0055528_1002493 Ga0055528_10024938 247
312 3300003791 Ga0055530_10000688 Ga0055530_100006883 247
313 3300003792 Ga0055540_1000010 Ga0055540_1000010253 247
314 3300005262 Ga0065165_1009717 Ga0065165_10097173 247
315 3300025258 Ga0209129_1035653 Ga0209129_10356531 247
316 3300025263 Ga0209565_1000036 Ga0209565_1000036106 247
317 3300025273 Ga0209673_1000282 Ga0209673_100028216 247
318 3300025284 Ga0209130_1000151 Ga0209130_100015196 247
319 3300025291 Ga0209675_1000751 Ga0209675_100075116 247
320 3300025291 Ga0209675_1012585 Ga0209675_10125853 247
321 3300025292 Ga0209676_1000007 Ga0209676_1000007279 247
322 3300025295 Ga0209564_1000729 Ga0209564_100072935 247
323 3300025295 Ga0209564_1000903 Ga0209564_10009036 247
324 3300025298 Ga0209050_1000003 Ga0209050_10000031229 247
325 3300025299 Ga0209256_1000001 Ga0209256_10000011233 247
326 3300025302 Ga0207426_1001878 Ga0207426_10018783 247
327 3300025303 Ga0209051_1000003 Ga0209051_10000031229 247
328 3300025304 Ga0209257_1000020 Ga0209257_1000020279 247

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

93

213

0.81

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

73

214

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tcv-assembly1.cif.gz_A crystal structure of a gcn5-related n-acetyltransferase from brucella melitensis 0.9794 16 235
3tcv-assembly1.cif.gz_A crystal structure of a gcn5-related n-acetyltransferase from brucella melitensis 0.9706 16 235
3pzj-assembly1.cif.gz_A crystal structure of a probable acetyltransferases (gnat family) from chromobacterium violaceum atcc 12472 0.9328 11 205
3pzj-assembly1.cif.gz_B crystal structure of a probable acetyltransferases (gnat family) from chromobacterium violaceum atcc 12472 0.9084 18 205
3pzj-assembly1.cif.gz_A crystal structure of a probable acetyltransferases (gnat family) from chromobacterium violaceum atcc 12472 0.9016 11 205
ID Description Score Start End Superfamily
3tcvA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9794 16 235 3.40.630.30
af_P40586_15_233_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9788 16 235 3.40.630.30
3tcvA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9706 16 235 3.40.630.30
af_P40586_15_233_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.97 16 235 3.40.630.30
af_A0A0R0ECR9_59_131_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9125 135 200 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A7H9VA42-F1-model_v4 N-acetyltransferase 0.9936 143 214 GO:0008999
GO:1990189
AF-A0A2U2BLB6-F1-model_v4 Ribosomal-protein-serine acetyltransferase 0.99 3 232 GO:0008999
GO:1990189
AF-A0A535NEY3-F1-model_v4 GNAT family N-acetyltransferase 0.9815 86 240 GO:0008999
GO:1990189
AF-A0A7R7YFK8-F1-model_v4 N-acetyltransferase domain-containing protein 0.9798 27 230 GO:0008999
GO:1990189
AF-A0A657LVG5-F1-model_v4 GCN5 family acetyltransferase 0.9786 14 231 GO:0008999
GO:1990189

Feature Viewer

pLDDT pTM Quality
94.25 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map