F409347

General Info

Members Datasets Scaffolds Average Seq Length
328 248 656 314

Family's Representative Sequence

Representative Sequence 3300041406|Ga0439439_0006960|Ga0439439_0006960_55_1089
Length 344
Sequence LSELTSNGQFKAYGAAARKQPLLVLIGPTAVGKTRMSLDIAKYWNAEIISGDSMQVYRGMDIGTAKIPLDEREGIPHHLIDICEPEESYSAADFQAGAIKVIDQIAGRGRLPFIVGGTGLYVESVCYQYQFAEIGSDEAFRQEQEQYAAANGAEALHRRLAEIDPPAAERLHPNDLRRVIRALEVYHLTGQTFSEQQAGQKKDSPYELCIIGLTMDRAELYRRIEQRVDIMIEQGLVEEVKRLMERDLPPQAVAMQGLGYKEIADYLHGNCSLAAAVERLKRDTRRFAKRQLSWFRHMDDIHWIDMGENFHNNLLSIHAIIAGKFQLHIEYTSNQPFEDGGNVQ

Samples

Sample ID Description Type Environment
1 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
9 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
21 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
22 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
28 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
29 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
30 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
31 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
32 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
36 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
38 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
39 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
41 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
42 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
56 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
57 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
58 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
59 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
60 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
61 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
62 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
63 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
64 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
65 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
66 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
67 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
68 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
69 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
70 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
71 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
72 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
73 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
74 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
75 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
76 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
77 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
78 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
79 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
80 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
81 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
82 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
83 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
84 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
85 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
86 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
87 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
88 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
89 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
90 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
91 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
92 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
93 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
94 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
95 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
96 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
97 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
98 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
99 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
100 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
101 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
102 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
103 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
104 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
105 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
106 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
107 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
108 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
109 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
110 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
111 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
112 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
113 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
114 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
115 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
116 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
117 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
118 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
119 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
120 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
121 2643221729 Bacillus sp. Root11 Isolate Unclassified
122 2643221730 Bacillus sp. Root131 Isolate Unclassified
123 2643221731 Bacillus sp. Root147 Isolate Unclassified
124 2643221732 Bacillus sp. Root239 Isolate Unclassified
125 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
126 2671180694 Paenibacillus sp. A3 Isolate Unclassified
127 2684622632 Bacillus cereus 905 Isolate Unclassified
128 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
129 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
130 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
131 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
132 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
133 2738541295 Bacillus sp. OK085 Isolate Unclassified
134 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
135 2738541358 Bacillus sp. OV752 Isolate Unclassified
136 2738543006 Bacillus sp. OK077 Isolate Unclassified
137 2738543010 Bacillus sp. YR335 Isolate Unclassified
138 2738543017 Bacillus sp. OV186 Isolate Unclassified
139 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
140 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
141 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
142 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
143 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
144 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
145 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
146 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
147 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
148 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
149 2818991441 Niallia circulans 3243 Isolate Rhizosphere
150 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
151 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
152 2818991459 Paenibacillus sp. 597 Isolate Unclassified
153 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
154 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
155 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
156 2842682962 Bacillus sp. R-72492 Isolate Unclassified
157 2842882022 Bacillus sp. R-71893 Isolate Unclassified
158 2849139964 Bacillus sp. R-71875 Isolate Unclassified
159 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
160 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
161 2857472729 Cohnella sp. R-74144 Isolate Unclassified
162 2857581216 Bacillus sp. R-71922 Isolate Unclassified
163 2857586860 Bacillus sp. R-71935 Isolate Unclassified
164 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
165 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
166 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
167 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
168 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
169 2881633906 Lactiplantibacillus garii FI11369 Isolate Unclassified
170 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
171 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
172 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
173 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
174 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
175 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
176 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
177 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
178 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
179 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
180 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
181 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
182 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
183 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
184 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
185 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
186 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
187 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
188 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
189 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
190 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
191 2919720352 Priestia megaterium 4340 Isolate Unclassified
192 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
193 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
194 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
195 2929004312 Priestia megaterium 1104 Isolate Unclassified
196 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
197 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
198 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
199 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
200 2938917290 Bacillus sp. CR71 Isolate Unclassified
201 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
202 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
203 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
204 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
205 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
206 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
207 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
208 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
209 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
210 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
211 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
212 2965761152 Bacillus sp. COPE52 Isolate Unclassified
213 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
214 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
215 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
216 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
217 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
218 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
219 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
220 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
221 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
222 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
223 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
224 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
225 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
226 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
227 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
228 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
229 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
230 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
231 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
232 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
233 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
234 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
235 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
236 8022792930 Bacillus sp. Xin Isolate Rhizosphere
237 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
238 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
239 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
240 8023438354 Bacillus sp. BH2 Isolate Unclassified
241 8023444577 Bacillus sp. BH32 Isolate Unclassified
242 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
243 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
244 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
245 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
246 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
247 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
248 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 57.32
Metatranscriptomes 0.3
Isolates 42.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.63
Nodule 0
Rhizoplane 9.45
Rhizosphere 43.29
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439439_0006960 3300041406 Bacteria 2630
2 JGI25159J45721_1006835 3300002987 Bacteria 3352
3 JGI25159J45721_1008986 3300002987 Bacteria 2681
4 JGI25151J46595_10000200 3300003187 Bacteria 73683
5 JGI25151J46595_10004140 3300003187 Bacteria 7751
6 JGI25151J46595_10004937 3300003187 Bacteria 6962
7 JGI25151J46595_10035389 3300003187 Bacteria 1897
8 JGI25151J46595_10038357 3300003187 Bacteria 1784
9 JGI25151J46595_10064976 3300003187 Bacteria 1139
10 JGI25151J46595_10072503 3300003187 Bacteria 1035
11 JGI25151J46595_10072646 3300003187 Bacteria 1034
12 rootH1_10000119 3300003316 Bacteria 90410
13 rootH2_10293405 3300003320 Bacteria 3064
14 rootL2_10022284 3300003322 Bacteria 35547
15 Ga0006562J51391_1000047 3300003578 Bacteria 14819
16 Ga0055538_1000068 3300003751 Bacteria 97329
17 Ga0055538_1000349 3300003751 Bacteria 20267
18 Ga0055532_1000126 3300003758 Bacteria 76489
19 Ga0055535_1002640 3300003761 Bacteria 5946
20 Ga0055536_1014704 3300003781 Bacteria 2724
21 Ga0055528_1007030 3300003790 Bacteria 5029
22 Ga0055541_1002765 3300003841 Bacteria 3416
23 Ga0055541_1004547 3300003841 Bacteria 2504
24 Ga0070682_100121172 3300005337 Bacteria 1756
25 Ga0070671_100056799 3300005355 Bacteria 3257
26 Ga0070667_100354947 3300005367 Bacteria 1328
27 Ga0068857_100233690 3300005577 Bacteria 1682
28 Ga0068852_100131434 3300005616 Bacteria 2306
29 Ga0068864_100264757 3300005618 Bacteria 1600
30 Ga0105251_10091385 3300009011 Bacteria 1398
31 Ga0105244_10007990 3300009036 Bacteria 6657
32 Ga0105244_10037902 3300009036 Bacteria 2517
33 Ga0105250_10005590 3300009092 Bacteria 5622
34 Ga0105250_10010750 3300009092 Bacteria 3809
35 Ga0105250_10020132 3300009092 Bacteria 2697
36 Ga0105245_10078290 3300009098 Bacteria 3017
37 Ga0105245_10586854 3300009098 Bacteria 1139
38 Ga0105247_10150183 3300009101 Bacteria 1534
39 Ga0105243_10002092 3300009148 Bacteria 16912
40 Ga0105239_10244712 3300010375 Bacteria 2013
41 Ga0105246_10053218 3300011119 Bacteria 2785
42 Ga0105246_10286617 3300011119 Bacteria 1323
43 Ga0157371_10051395 3300013102 Bacteria 2929
44 Ga0157378_10092394 3300013297 Bacteria 2753
45 Ga0157375_10176212 3300013308 Bacteria 2288
46 Ga0157376_10054571 3300014969 Bacteria 3332
47 Ga0209784_100253 3300025224 Bacteria 33410
48 Ga0209566_100015 3300025225 Bacteria 457963
49 Ga0209566_100345 3300025225 Bacteria 40126
50 Ga0209566_100417 3300025225 Bacteria 33299
51 Ga0209147_100182 3300025229 Bacteria 76541
52 Ga0209147_100245 3300025229 Bacteria 52865
53 Ga0209147_101329 3300025229 Bacteria 9443
54 Ga0209437_101985 3300025233 Bacteria 4221
55 Ga0209258_102479 3300025242 Bacteria 4726
56 Ga0209673_1003550 3300025273 Bacteria 9101
57 Ga0209130_1001564 3300025284 Bacteria 14494
58 Ga0209130_1003080 3300025284 Bacteria 7460
59 Ga0209130_1003265 3300025284 Bacteria 7092
60 Ga0209676_1000204 3300025292 Bacteria 132896
61 Ga0209676_1000851 3300025292 Bacteria 39362
62 Ga0209676_1018375 3300025292 Bacteria 2441
63 Ga0209676_1023693 3300025292 Bacteria 2004
64 Ga0209025_1000127 3300025294 Bacteria 200766
65 Ga0209025_1000577 3300025294 Bacteria 66553
66 Ga0209025_1001655 3300025294 Bacteria 27460
67 Ga0209025_1001856 3300025294 Bacteria 24783
68 Ga0209025_1004104 3300025294 Bacteria 12964
69 Ga0209025_1004273 3300025294 Bacteria 12547
70 Ga0209025_1004899 3300025294 Bacteria 11271
71 Ga0209025_1006676 3300025294 Bacteria 8861
72 Ga0209025_1025146 3300025294 Bacteria 3042
73 Ga0209025_1029755 3300025294 Bacteria 2632
74 Ga0209025_1031804 3300025294 Bacteria 2485
75 Ga0209025_1041824 3300025294 Bacteria 1956
76 Ga0207426_1013536 3300025302 Bacteria 3019
77 Ga0207656_10108905 3300025321 Bacteria 1278
78 Ga0207696_1003717 3300025711 Bacteria 6836
79 Ga0207696_1004235 3300025711 Bacteria 6229
80 Ga0207696_1011163 3300025711 Bacteria 3250
81 Ga0207696_1025537 3300025711 Bacteria 1840
82 Ga0207696_1032448 3300025711 Bacteria 1572
83 Ga0207655_1002243 3300025728 Bacteria 15988
84 Ga0207655_1029059 3300025728 Bacteria 2596
85 Ga0207713_1025578 3300025735 Bacteria 2722
86 Ga0207644_10020955 3300025931 Bacteria 4450
87 Ga0207686_10206893 3300025934 Bacteria 1408
88 Ga0207679_10187148 3300025945 Bacteria 1718
89 Ga0207678_10058383 3300026067 Bacteria 3320
90 Ga0207678_10219836 3300026067 Bacteria 1626
91 Ga0207708_10097730 3300026075 Bacteria 2269
92 Ga0207676_10406938 3300026095 Bacteria 1273
93 Ga0207674_10044863 3300026116 Bacteria 4552
94 Ga0207683_10087162 3300026121 Bacteria 2776
95 Ga0207683_10364300 3300026121 Bacteria 1327
96 Ga0207698_10489127 3300026142 Bacteria 1195
97 Ga0209371_1011835 3300027312 Bacteria 2563
98 Ga0237817_10450 3300030083 Bacteria 6196
99 Ga0237817_10453 3300030083 Bacteria 6172
100 Ga0268256_1012886 3300030500 Bacteria 2563
101 Ga0307408_100052393 3300031548 Bacteria 2943
102 Ga0316575_10001194 3300031665 Bacteria 8205
103 Ga0307410_10194951 3300031852 Bacteria 1543
104 Ga0307409_100225279 3300031995 Bacteria 1695
105 Ga0373956_0000625 3300035119 Bacteria 14511
106 Ga0316574_0003369 3300035398 Bacteria 8233
107 Ga0316574_0045362 3300035398 Unclassified 2722
108 Ga0316584_0070189 3300036712 Bacteria 2627
109 Ga0395899_0087135 3300037312 Bacteria 2267
110 Ga0237819_00373 3300038705 Bacteria 15840
111 Ga0237819_02240 3300038705 Bacteria 4062
112 Ga0439439_0005498 3300041406 Bacteria 2895
113 Ga0451797_0600402 3300041453 Bacteria 2244
114 Ga0439433_0008551 3300041999 Bacteria 2222
115 Ga0439449_0000186 3300042007 Bacteria 21698
116 Ga0439462_0000441 3300042015 Bacteria 8122
117 Ga0439462_0005735 3300042015 Bacteria 3070
118 Ga0466969_0005265 3300044656 Bacteria 6890
119 Ga0453684_0192252 3300044712 Bacteria 2386
120 Ga0466959_0003094 3300045049 Bacteria 10784
121 Ga0451576_0000067 3300045051 Bacteria 265145
122 Ga0451576_0001746 3300045051 Bacteria 35704
123 Ga0466967_0011984 3300045976 Bacteria 6605
124 Ga0466967_0098923 3300045976 Bacteria 2664
125 Ga0495590_0033014 3300046457 Bacteria 1810
126 Ga0495584_0122194 3300046491 Bacteria 1319
127 Ga0495622_0028299 3300046557 Bacteria 2617
128 Ga0495676_0053548 3300047321 Bacteria 3215
129 Ga0495683_0024943 3300047323 Bacteria 3066
130 Ga0495626_0154356 3300048091 Bacteria 966
131 Ga0496100_0039415 3300048903 Bacteria 3000
132 Ga0496101_0001169 3300048904 Bacteria 15706
133 Ga0496102_0002061 3300048905 Bacteria 17306
134 Ga0496102_0050930 3300048905 Bacteria 3772
135 Ga0496102_0305914 3300048905 Bacteria 1498
136 Ga0496103_0001039 3300048906 Bacteria 19439
137 Ga0496103_0019576 3300048906 Bacteria 4064
138 Ga0496104_0008887 3300048907 Bacteria 8927
139 Ga0496104_0249544 3300048907 Bacteria 1687
140 Ga0496105_0000223 3300048908 Bacteria 38096
141 Ga0496106_0000875 3300048909 Bacteria 21949
142 Ga0496107_0005512 3300048910 Bacteria 8661
143 Ga0496108_0000942 3300048911 Bacteria 22705
144 Ga0496108_0001567 3300048911 Bacteria 18102
145 Ga0496109_0000329 3300048912 Bacteria 44242
146 Ga0496109_0011179 3300048912 Bacteria 7703
147 Ga0496110_0000735 3300048913 Bacteria 22638
148 Ga0496110_0115704 3300048913 Bacteria 2414
149 Ga0496110_0510871 3300048913 Bacteria 1093
150 Ga0496110_0573387 3300048913 Bacteria 1025
151 Ga0496111_0001374 3300048914 Bacteria 13796
152 Ga0496111_0010810 3300048914 Bacteria 6135
153 Ga0496111_0037725 3300048914 Bacteria 3459
154 Ga0496112_0002742 3300048915 Bacteria 14273
155 Ga0496112_0074552 3300048915 Bacteria 3355
156 Ga0496112_0573706 3300048915 Bacteria 1061
157 Ga0496113_0184719 3300048916 Bacteria 1653
158 Ga0496114_0078243 3300048917 Bacteria 2790
159 Ga0496114_0156155 3300048917 Bacteria 1981
160 Ga0496116_0002870 3300048919 Bacteria 17647
161 Ga0496116_0029745 3300048919 Bacteria 3932
162 Ga0496116_0104789 3300048919 Bacteria 1679
163 Ga0496117_0012130 3300048920 Bacteria 7640
164 Ga0496118_0072233 3300048921 Bacteria 2479
165 Ga0496119_0001421 3300048922 Bacteria 28989
166 Ga0496119_0004043 3300048922 Bacteria 14816
167 Ga0496119_0006270 3300048922 Bacteria 11091
168 Ga0496120_0000470 3300048923 Bacteria 63180
169 Ga0496120_0030789 3300048923 Bacteria 3257
170 Ga0496121_0102479 3300048924 Bacteria 2205
171 Ga0496122_0008562 3300048925 Bacteria 11001
172 Ga0496122_0010989 3300048925 Bacteria 9250
173 Ga0496122_0046198 3300048925 Bacteria 3375
174 Ga0496122_0066573 3300048925 Bacteria 2601
175 Ga0496122_0135790 3300048925 Bacteria 1550
176 Ga0496123_0021751 3300048926 Bacteria 4972
177 Ga0496123_0028271 3300048926 Bacteria 4156
178 Ga0496124_0000171 3300048927 Bacteria 130630
179 Ga0496124_0000629 3300048927 Bacteria 58592
180 Ga0496124_0017594 3300048927 Bacteria 6732
181 Ga0496124_0025556 3300048927 Bacteria 5348
182 Ga0496124_0168704 3300048927 Bacteria 1698
183 Ga0496125_0000346 3300048928 Bacteria 88074
184 Ga0496125_0006548 3300048928 Bacteria 12551
185 Ga0496125_0048593 3300048928 Bacteria 3536
186 Ga0496126_0004722 3300048929 Bacteria 16076
187 Ga0496126_0023810 3300048929 Bacteria 5928
188 Ga0501070_0235630 3300049586 Bacteria 1499
189 nmdc:mga0qj67_91754_c1 3300050509 Bacteria 2441
190 2524186087 2524023129 Bacteria 6762600
191 2563930567 2563366752 Bacteria 4961801
192 2573037212 2571042588 Bacteria 5045676
193 2578337358 2576861424 Bacteria 5270569
194 2580931486 2579778775 Bacteria 5360914
195 2587740965 2585428059 Bacteria 8696589
196 2595089362 2593339131 Bacteria 5116855
197 2595315401 2593339198 Bacteria 7267884
198 2621275663 2619619294 Bacteria 5575484
199 2643735563 2643221543 Bacteria 6628015
200 2644422278 2643221676 Bacteria 8119172
201 2644705441 2643221729 Bacteria 6621700
202 2644710134 2643221730 Bacteria 6523787
203 2644716210 2643221731 Bacteria 5623886
204 2644723920 2643221732 Bacteria 5756404
205 2672335224 2671180330 Bacteria 5521719
206 2673823558 2671180694 Bacteria 7506943
207 2685151682 2684622632 Bacteria 5380049
208 2698321539 2695420987 Bacteria 6152737
209 2705995621 2703719227 Bacteria 5631989
210 2721506844 2718218445 Bacteria 5113413
211 2723604486 2721755693 Bacteria 6126117
212 2730135122 2728369359 Bacteria 5621728
213 2738814881 2738541295 Bacteria 5730091
214 2738837694 2738541299 Bacteria 4020721
215 2739155176 2738541358 Bacteria 5932299
216 2739207503 2738543006 Bacteria 5904091
217 2739231165 2738543010 Bacteria 5583595
218 2739268423 2738543017 Bacteria 4271950
219 2753810057 2751185905 Bacteria 6142767
220 2757565117 2757320391 Bacteria 4746095
221 2777763435 2775507177 Bacteria 4384303
222 2777838388 2775507192 Bacteria 4622234
223 2791212446 2788500588 Bacteria 4584915
224 2793184379 2791355222 Bacteria 5898266
225 2795797601 2795385472 Bacteria 6627535
226 2802436758 2802428803 Bacteria 5806948
227 2808868652 2808606364 Bacteria 4465927
228 2816864070 2816332186 Bacteria 5331395
229 2819570826 2818991441 Bacteria 5062707
230 2819580852 2818991443 Bacteria 6598732
231 2819626051 2818991451 Bacteria 4697364
232 2819669046 2818991459 Bacteria 8736032
233 2819709682 2818991465 Bacteria 5388835
234 2821112065 2821111986 Bacteria 6894338
235 2831907142 2831905167 Bacteria 3319172
236 2842688095 2842682962 Bacteria 5589973
237 2842884061 2842882022 Bacteria 6158489
238 2849145018 2849139964 Bacteria 5613304
239 2852675085 2852673933 Bacteria 3347676
240 2857453971 2857453340 Bacteria 8090534
241 2857475835 2857472729 Bacteria 6568124
242 2857586679 2857581216 Bacteria 5522813
243 2857588448 2857586860 Bacteria 4354574
244 2857605213 2857604169 Bacteria 5111450
245 2864737981 2864733723 Bacteria 6770668
246 2865001570 2864997549 Bacteria 5139696
247 2865004310 2865002811 Bacteria 6333767
248 2866553667 2866552031 Bacteria 5824618
249 2881636084 2881633906 Bacteria 2972201
250 2881637305 2881636855 Bacteria 5205297
251 2881647248 2881644220 Bacteria 5302661
252 2885527579 2885526491 Bacteria 7164189
253 2888582559 2888578766 Bacteria 6743310
254 2889046187 2889042446 Bacteria 7618936
255 2889055232 2889049205 Bacteria 7524325
256 2889280385 2889276214 Bacteria 5979355
257 2889296990 2889295896 Bacteria 4704906
258 2904115565 2904113452 Bacteria 7796941
259 2904163786 2904162308 Bacteria 7086713
260 2904493089 2904490793 Bacteria 7046938
261 2904524909 2904524088 Bacteria 5887454
262 2904595674 2904595352 Bacteria 6124848
263 2904611187 2904606771 Bacteria 4684500
264 2904762219 2904755435 Bacteria 7986759
265 2916974489 2916971899 Bacteria 4250608
266 2919146502 2919143609 Bacteria 6219228
267 2919162380 2919160200 Bacteria 6929020
268 2919414453 2919414237 Bacteria 5429133
269 2919429311 2919425241 Bacteria 8055701
270 2919518418 2919517244 Bacteria 5858162
271 2919722783 2919720352 Bacteria 5986006
272 2925331417 2925326138 Bacteria 9652120
273 2928096657 2928093941 Bacteria 5965005
274 2928511798 2928510474 Bacteria 4815308
275 2929005936 2929004312 Bacteria 5678476
276 2929237369 2929233124 Bacteria 5948380
277 2931389637 2931384279 Bacteria 7299545
278 2936343447 2936340661 Bacteria 5139038
279 2936365482 2936361878 Bacteria 5632809
280 2938921564 2938917290 Bacteria 5914775
281 2939593481 2939593269 Bacteria 4798695
282 2939680937 2939679117 Bacteria 6921672
283 2939705683 2939702853 Bacteria 5139229
284 2945991678 2945991243 Bacteria 7008369
285 2946054384 2946053406 Bacteria 6978655
286 2947430458 2947426588 Bacteria 5357194
287 2956901259 2956897341 Bacteria 5447711
288 2960320408 2960319331 Bacteria 5502575
289 2960379669 2960375949 Bacteria 5361395
290 2962292736 2962290636 Bacteria 4072939
291 2964378663 2964375228 Bacteria 4909004
292 2965765363 2965761152 Bacteria 5806513
293 2971416932 2971410472 Bacteria 8311090
294 2971511823 2971511577 Bacteria 5404012
295 2977258238 2977254563 Bacteria 4828420
296 2979087325 2979083700 Bacteria 5894929
297 2980176963 2980176882 Bacteria 5397533
298 2980189520 2980182181 Bacteria 9454109
299 2981285464 2981284811 Bacteria 4641497
300 2981290411 2981289755 Bacteria 4641509
301 2981980961 2981980479 Bacteria 4641628
302 2981985847 2981985349 Bacteria 4641497
303 2990279246 2990275345 Bacteria 4887158
304 2996710232 2996706504 Bacteria 5757485
305 3001267708 3001267043 Bacteria 4823521
306 3001273183 3001272096 Bacteria 4729684
307 3001893381 3001892409 Bacteria 6328293
308 3006828050 3006826541 Bacteria 4678913
309 3006974923 3006973921 Bacteria 4423788
310 3006979323 3006978542 Bacteria 5328100
311 3006985440 3006984091 Bacteria 4207523
312 3006989521 3006988479 Bacteria 4767936
313 648170531 648028048 Bacteria 5394884
314 8002319612 8002317523 Bacteria 8051857
315 8022623571 8022621104 Bacteria 5241040
316 8022793542 8022792930 Bacteria 5693794
317 8022897735 8022893055 Bacteria 5300455
318 8022916914 8022914991 Bacteria 5584517
319 8022949375 8022948649 Bacteria 5366783
320 8023440456 8023438354 Bacteria 5779374
321 8023446520 8023444577 Bacteria 5661597
322 8046998632 8046991243 Bacteria 8497463
323 8055533125 8055531788 Bacteria 5249694
324 8056211543 8056207758 Bacteria 8639239
325 8056533915 8056533031 Bacteria 8964429
326 8057586137 8057582654 Bacteria 5218944
327 8057634280 8057632132 Bacteria 4726859
328 8057980640 8057977335 Bacteria 5694872
329 Ga0439439_0006960
330 JGI25159J45721_1006835
331 JGI25159J45721_1008986
332 JGI25151J46595_10000200
333 JGI25151J46595_10004140
334 JGI25151J46595_10004937
335 JGI25151J46595_10035389
336 JGI25151J46595_10038357
337 JGI25151J46595_10064976
338 JGI25151J46595_10072503
339 JGI25151J46595_10072646
340 rootH1_10000119
341 rootH2_10293405
342 rootL2_10022284
343 Ga0006562J51391_1000047
344 Ga0055538_1000068
345 Ga0055538_1000349
346 Ga0055532_1000126
347 Ga0055535_1002640
348 Ga0055536_1014704
349 Ga0055528_1007030
350 Ga0055541_1002765
351 Ga0055541_1004547
352 Ga0070682_100121172
353 Ga0070671_100056799
354 Ga0070667_100354947
355 Ga0068857_100233690
356 Ga0068852_100131434
357 Ga0068864_100264757
358 Ga0105251_10091385
359 Ga0105244_10007990
360 Ga0105244_10037902
361 Ga0105250_10005590
362 Ga0105250_10010750
363 Ga0105250_10020132
364 Ga0105245_10078290
365 Ga0105245_10586854
366 Ga0105247_10150183
367 Ga0105243_10002092
368 Ga0105239_10244712
369 Ga0105246_10053218
370 Ga0105246_10286617
371 Ga0157371_10051395
372 Ga0157378_10092394
373 Ga0157375_10176212
374 Ga0157376_10054571
375 Ga0209784_100253
376 Ga0209566_100015
377 Ga0209566_100345
378 Ga0209566_100417
379 Ga0209147_100182
380 Ga0209147_100245
381 Ga0209147_101329
382 Ga0209437_101985
383 Ga0209258_102479
384 Ga0209673_1003550
385 Ga0209130_1001564
386 Ga0209130_1003080
387 Ga0209130_1003265
388 Ga0209676_1000204
389 Ga0209676_1000851
390 Ga0209676_1018375
391 Ga0209676_1023693
392 Ga0209025_1000127
393 Ga0209025_1000577
394 Ga0209025_1001655
395 Ga0209025_1001856
396 Ga0209025_1004104
397 Ga0209025_1004273
398 Ga0209025_1004899
399 Ga0209025_1006676
400 Ga0209025_1025146
401 Ga0209025_1029755
402 Ga0209025_1031804
403 Ga0209025_1041824
404 Ga0207426_1013536
405 Ga0207656_10108905
406 Ga0207696_1003717
407 Ga0207696_1004235
408 Ga0207696_1011163
409 Ga0207696_1025537
410 Ga0207696_1032448
411 Ga0207655_1002243
412 Ga0207655_1029059
413 Ga0207713_1025578
414 Ga0207644_10020955
415 Ga0207686_10206893
416 Ga0207679_10187148
417 Ga0207678_10058383
418 Ga0207678_10219836
419 Ga0207708_10097730
420 Ga0207676_10406938
421 Ga0207674_10044863
422 Ga0207683_10087162
423 Ga0207683_10364300
424 Ga0207698_10489127
425 Ga0209371_1011835
426 Ga0237817_10450
427 Ga0237817_10453
428 Ga0268256_1012886
429 Ga0307408_100052393
430 Ga0316575_10001194
431 Ga0307410_10194951
432 Ga0307409_100225279
433 Ga0373956_0000625
434 Ga0316574_0003369
435 Ga0316574_0045362
436 Ga0316584_0070189
437 Ga0395899_0087135
438 Ga0237819_00373
439 Ga0237819_02240
440 Ga0439439_0005498
441 Ga0451797_0600402
442 Ga0439433_0008551
443 Ga0439449_0000186
444 Ga0439462_0000441
445 Ga0439462_0005735
446 Ga0466969_0005265
447 Ga0453684_0192252
448 Ga0466959_0003094
449 Ga0451576_0000067
450 Ga0451576_0001746
451 Ga0466967_0011984
452 Ga0466967_0098923
453 Ga0495590_0033014
454 Ga0495584_0122194
455 Ga0495622_0028299
456 Ga0495676_0053548
457 Ga0495683_0024943
458 Ga0495626_0154356
459 Ga0496100_0039415
460 Ga0496101_0001169
461 Ga0496102_0002061
462 Ga0496102_0050930
463 Ga0496102_0305914
464 Ga0496103_0001039
465 Ga0496103_0019576
466 Ga0496104_0008887
467 Ga0496104_0249544
468 Ga0496105_0000223
469 Ga0496106_0000875
470 Ga0496107_0005512
471 Ga0496108_0000942
472 Ga0496108_0001567
473 Ga0496109_0000329
474 Ga0496109_0011179
475 Ga0496110_0000735
476 Ga0496110_0115704
477 Ga0496110_0510871
478 Ga0496110_0573387
479 Ga0496111_0001374
480 Ga0496111_0010810
481 Ga0496111_0037725
482 Ga0496112_0002742
483 Ga0496112_0074552
484 Ga0496112_0573706
485 Ga0496113_0184719
486 Ga0496114_0078243
487 Ga0496114_0156155
488 Ga0496116_0002870
489 Ga0496116_0029745
490 Ga0496116_0104789
491 Ga0496117_0012130
492 Ga0496118_0072233
493 Ga0496119_0001421
494 Ga0496119_0004043
495 Ga0496119_0006270
496 Ga0496120_0000470
497 Ga0496120_0030789
498 Ga0496121_0102479
499 Ga0496122_0008562
500 Ga0496122_0010989
501 Ga0496122_0046198
502 Ga0496122_0066573
503 Ga0496122_0135790
504 Ga0496123_0021751
505 Ga0496123_0028271
506 Ga0496124_0000171
507 Ga0496124_0000629
508 Ga0496124_0017594
509 Ga0496124_0025556
510 Ga0496124_0168704
511 Ga0496125_0000346
512 Ga0496125_0006548
513 Ga0496125_0048593
514 Ga0496126_0004722
515 Ga0496126_0023810
516 Ga0501070_0235630
517 nmdc:mga0qj67_91754_c1
518 2524186087
519 2563930567
520 2573037212
521 2578337358
522 2580931486
523 2587740965
524 2595089362
525 2595315401
526 2621275663
527 2643735563
528 2644422278
529 2644705441
530 2644710134
531 2644716210
532 2644723920
533 2672335224
534 2673823558
535 2685151682
536 2698321539
537 2705995621
538 2721506844
539 2723604486
540 2730135122
541 2738814881
542 2738837694
543 2739155176
544 2739207503
545 2739231165
546 2739268423
547 2753810057
548 2757565117
549 2777763435
550 2777838388
551 2791212446
552 2793184379
553 2795797601
554 2802436758
555 2808868652
556 2816864070
557 2819570826
558 2819580852
559 2819626051
560 2819669046
561 2819709682
562 2821112065
563 2831907142
564 2842688095
565 2842884061
566 2849145018
567 2852675085
568 2857453971
569 2857475835
570 2857586679
571 2857588448
572 2857605213
573 2864737981
574 2865001570
575 2865004310
576 2866553667
577 2881636084
578 2881637305
579 2881647248
580 2885527579
581 2888582559
582 2889046187
583 2889055232
584 2889280385
585 2889296990
586 2904115565
587 2904163786
588 2904493089
589 2904524909
590 2904595674
591 2904611187
592 2904762219
593 2916974489
594 2919146502
595 2919162380
596 2919414453
597 2919429311
598 2919518418
599 2919722783
600 2925331417
601 2928096657
602 2928511798
603 2929005936
604 2929237369
605 2931389637
606 2936343447
607 2936365482
608 2938921564
609 2939593481
610 2939680937
611 2939705683
612 2945991678
613 2946054384
614 2947430458
615 2956901259
616 2960320408
617 2960379669
618 2962292736
619 2964378663
620 2965765363
621 2971416932
622 2971511823
623 2977258238
624 2979087325
625 2980176963
626 2980189520
627 2981285464
628 2981290411
629 2981980961
630 2981985847
631 2990279246
632 2996710232
633 3001267708
634 3001273183
635 3001893381
636 3006828050
637 3006974923
638 3006979323
639 3006985440
640 3006989521
641 648170531
642 8002319612
643 8022623571
644 8022793542
645 8022897735
646 8022916914
647 8022949375
648 8023440456
649 8023446520
650 8046998632
651 8055533125
652 8056211543
653 8056533915
654 8057586137
655 8057634280
656 8057980640

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01715

IPPT

IPP transferase

55

298

0.97

PF01745

IPT

Isopentenyl transferase

20

79

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qgn-assembly1.cif.gz_A crystal structure of trna isopentenylpyrophosphate transferase (bh2366) from bacillus halodurans, northeast structural genomics consortium target bhr41. 0.9556 6 310
2qgn-assembly1.cif.gz_A crystal structure of trna isopentenylpyrophosphate transferase (bh2366) from bacillus halodurans, northeast structural genomics consortium target bhr41. 0.9363 6 310
3crr-assembly1.cif.gz_A structure of trna dimethylallyltransferase: rna modification through a channel 0.9185 5 308
2zm5-assembly1.cif.gz_A crystal structure of trna modification enzyme miaa in the complex with trna(phe) 0.908 8 312
2zm5-assembly1.cif.gz_A crystal structure of trna modification enzyme miaa in the complex with trna(phe) 0.8996 8 312
ID Description Score Start End Superfamily
3exaA03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Crystal structure of tRNA isopentenylpyrophosphate transferase (bh2366) domain 0.9982 203 283 1.10.287.890
3exaA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9864 6 120 3.40.50.300
3exaA03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Crystal structure of tRNA isopentenylpyrophosphate transferase (bh2366) domain 0.9857 203 283 1.10.287.890
af_A0A0P0X3E8_17_159_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9713 8 118 3.40.50.300
3crrA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9658 5 112 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1X0QW13-F1-model_v4 IPPT-domain-containing protein 0.9913 9 112 GO:0005524
GO:0005739
GO:0006400
GO:0052381
AF-A0A496JYQ4-F1-model_v4 deleted 0.9849 5 106
AF-A0A0B0DB55-F1-model_v4 tRNA dimethylallyltransferase (EC 2.5.1.75) 0.9786 4 287 GO:0005524
GO:0006400
GO:0052381
AF-A0A496JYQ4-F1-model_v4 deleted 0.9754 5 106
AF-A0A0B0DB55-F1-model_v4 tRNA dimethylallyltransferase (EC 2.5.1.75) 0.9752 4 287 GO:0005524
GO:0006400
GO:0052381

Map