F409354

General Info

Members Datasets Scaffolds Average Seq Length
328 162 328 219

Family's Representative Sequence

Representative Sequence 3300042122|Ga0450920_004820|Ga0450920_004820_483_1235
Length 250
Sequence MPYTDARHALLARLIDHAPMFPPASLSPADALVEDARAAASPHAFMLARLVWPASRLVELPPSERAISAVLDAPIPSGFPVEAVEAPPSVDPAAGDAVLLMGEVYVETPIDGGVEDRLDRLAEHGLRAKVRCGGASVPSVGALAAFVRACRERGLVFKATAGLHHAVRSNGEHGFLNLLAAAAFAGEEEGALAETDPSAFALDSGSFAWRERSGSPEELARVRRDLIHSIGSCSFFEPVDELVSLGMLPQ

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
22 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
35 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
54 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
55 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
56 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
57 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
58 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
59 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
60 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
61 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
62 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
63 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
64 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
65 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
66 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
67 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
68 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
69 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
70 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
71 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
72 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
73 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
74 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
75 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
76 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
77 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
78 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
79 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
80 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
81 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
82 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
83 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
84 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
85 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
86 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
87 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
88 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
89 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
90 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
91 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
92 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
93 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
94 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
95 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
96 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
97 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
98 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
99 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
100 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
101 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
102 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
103 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
104 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
105 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
106 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
107 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
108 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
109 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
110 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
111 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
112 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
113 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
114 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
115 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
116 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
117 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
118 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
119 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
120 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
121 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
122 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
130 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
131 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
132 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
133 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
150 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
151 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
152 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
156 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
157 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
158 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
159 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
160 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
161 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
162 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.59
Rhizosphere 88.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10028935 3300005327 Bacteria 4448
2 Ga0070683_100082326 3300005329 Bacteria 3014
3 Ga0070680_100078613 3300005336 Bacteria 2718
4 Ga0070680_100109697 3300005336 Bacteria 2296
5 Ga0070660_100011412 3300005339 Bacteria 6309
6 Ga0070661_100104662 3300005344 Bacteria 2109
7 Ga0070709_10043366 3300005434 Bacteria 2782
8 Ga0070709_10248034 3300005434 Bacteria 1281
9 Ga0070714_100019023 3300005435 Bacteria 5589
10 Ga0070714_100061641 3300005435 Bacteria 3222
11 Ga0070714_100340572 3300005435 Bacteria 1406
12 Ga0070713_100257243 3300005436 Bacteria 1594
13 Ga0070710_10002002 3300005437 Bacteria 9653
14 Ga0070710_10160783 3300005437 Bacteria 1392
15 Ga0070711_100033563 3300005439 Bacteria 3417
16 Ga0070681_10034131 3300005458 Bacteria 5109
17 Ga0070681_10211151 3300005458 Bacteria 1857
18 Ga0070679_100026217 3300005530 Bacteria 5721
19 Ga0070684_100185783 3300005535 Bacteria 1890
20 Ga0070684_100618455 3300005535 Bacteria 1008
21 Ga0070693_100246846 3300005547 Bacteria 1181
22 Ga0068857_100472844 3300005577 Bacteria 1174
23 Ga0068856_100037588 3300005614 Bacteria 4750
24 Ga0068856_100132023 3300005614 Bacteria 2502
25 Ga0070702_100112295 3300005615 Bacteria 1692
26 Ga0068852_100052752 3300005616 Bacteria 3496
27 Ga0068866_10137767 3300005718 Bacteria 1397
28 Ga0070717_10010996 3300006028 Bacteria 6855
29 Ga0070717_10033507 3300006028 Bacteria 4144
30 Ga0070717_10160095 3300006028 Bacteria 1952
31 Ga0070717_10626638 3300006028 Bacteria 976
32 Ga0070715_10108792 3300006163 Bacteria 1304
33 Ga0070716_100102112 3300006173 Bacteria 1760
34 Ga0070712_100012112 3300006175 Bacteria 5480
35 Ga0097621_100170600 3300006237 Bacteria 1875
36 Ga0075434_100011666 3300006871 Bacteria 8300
37 Ga0105240_10466343 3300009093 Bacteria 1410
38 Ga0105245_10136860 3300009098 Bacteria 2303
39 Ga0105245_10451222 3300009098 Bacteria 1294
40 Ga0105248_10576568 3300009177 Bacteria 1269
41 Ga0105238_10478808 3300009551 Bacteria 1244
42 Ga0105239_10488892 3300010375 Bacteria 1399
43 Ga0157369_10011368 3300013105 Bacteria 10110
44 Ga0157374_10053204 3300013296 Bacteria 3774
45 Ga0157372_10650742 3300013307 Bacteria 1227
46 Ga0182008_10237845 3300014497 Unclassified 936
47 Ga0206353_10153761 3300020082 Bacteria 1595
48 Ga0207692_10024682 3300025898 Bacteria 2798
49 Ga0207685_10143647 3300025905 Bacteria 1073
50 Ga0207699_10141955 3300025906 Bacteria 1579
51 Ga0207699_10199102 3300025906 Bacteria 1356
52 Ga0207693_10001813 3300025915 Bacteria 18731
53 Ga0207693_10015387 3300025915 Bacteria 6138
54 Ga0207663_10106061 3300025916 Bacteria 1898
55 Ga0207657_10001474 3300025919 Bacteria 25157
56 Ga0207657_10016745 3300025919 Bacteria 7058
57 Ga0207700_10009973 3300025928 Bacteria 5967
58 Ga0207700_10029365 3300025928 Bacteria 3879
59 Ga0207700_10308514 3300025928 Bacteria 1368
60 Ga0207664_10006516 3300025929 Bacteria 8033
61 Ga0207664_10007975 3300025929 Bacteria 7365
62 Ga0207664_10051097 3300025929 Bacteria 3262
63 Ga0207664_10263974 3300025929 Bacteria 1506
64 Ga0207665_10000968 3300025939 Bacteria 19437
65 Ga0207711_10423903 3300025941 Bacteria 1238
66 Ga0207661_10306895 3300025944 Bacteria 1424
67 Ga0207679_10297150 3300025945 Bacteria 1390
68 Ga0207702_10254714 3300026078 Bacteria 1650
69 Ga0207641_10361522 3300026088 Bacteria 1386
70 Ga0207674_10438995 3300026116 Bacteria 1262
71 Ga0207698_10112294 3300026142 Bacteria 2287
72 Ga0268264_10411952 3300028381 Bacteria 1301
73 Ga0265336_10001053 3300028666 Bacteria 13486
74 Ga0265338_10012905 3300028800 Bacteria 9491
75 Ga0265338_10028358 3300028800 Bacteria 5585
76 Ga0373956_0034809 3300035119 Bacteria 2219
77 Ga0373943_0001582 3300035170 Bacteria 10308
78 Ga0373946_0004632 3300035171 Bacteria 4933
79 Ga0373927_0025709 3300035695 Bacteria 3849
80 Ga0373947_0023910 3300035725 Bacteria 3557
81 Ga0373937_0017799 3300036401 Bacteria 6339
82 Ga0373937_0043656 3300036401 Bacteria 4094
83 Ga0373925_0006948 3300037068 Bacteria 8278
84 Ga0395900_0561821 3300037418 Bacteria 1085
85 Ga0395901_0050701 3300038443 Bacteria 4311
86 Ga0436360_0990257 3300039438 Bacteria 11979
87 Ga0450920_004820 3300042122 Bacteria 2384
88 Ga0466969_0003018 3300044656 Bacteria 8968
89 Ga0466969_0024815 3300044656 Bacteria 3083
90 Ga0466965_0009914 3300044683 Bacteria 4432
91 Ga0466965_0142390 3300044683 Bacteria 1249
92 Ga0466966_0020368 3300044684 Bacteria 4362
93 Ga0466966_0099678 3300044684 Bacteria 1797
94 Ga0466966_0144825 3300044684 Bacteria 1451
95 Ga0466961_0013260 3300044693 Bacteria 5273
96 Ga0466961_0142410 3300044693 Bacteria 1500
97 Ga0466963_0000081 3300044694 Bacteria 32755
98 Ga0466963_0000637 3300044694 Bacteria 16858
99 Ga0466963_0001598 3300044694 Bacteria 12313
100 Ga0466963_0005358 3300044694 Bacteria 7504
101 Ga0466963_0005420 3300044694 Bacteria 7469
102 Ga0466963_0008806 3300044694 Bacteria 6061
103 Ga0466963_0014146 3300044694 Bacteria 4916
104 Ga0466963_0028040 3300044694 Bacteria 3611
105 Ga0466963_0067720 3300044694 Bacteria 2396
106 Ga0466963_0200300 3300044694 Bacteria 1396
107 Ga0466964_0014788 3300044706 Bacteria 2970
108 Ga0466964_0162609 3300044706 Bacteria 1044
109 Ga0466971_0000381 3300044719 Bacteria 17046
110 Ga0466971_0003546 3300044719 Bacteria 6669
111 Ga0466971_0016849 3300044719 Bacteria 3228
112 Ga0466968_0002237 3300044735 Bacteria 7073
113 Ga0466968_0004776 3300044735 Bacteria 5073
114 Ga0466968_0058154 3300044735 Bacteria 1663
115 Ga0466968_0067786 3300044735 Bacteria 1548
116 Ga0466968_0118665 3300044735 Bacteria 1195
117 Ga0466970_0007727 3300044765 Bacteria 5395
118 Ga0466970_0058840 3300044765 Bacteria 2057
119 Ga0466970_0157043 3300044765 Bacteria 1257
120 Ga0466957_0003003 3300044842 Bacteria 9159
121 Ga0466957_0017163 3300044842 Bacteria 4238
122 Ga0466957_0024937 3300044842 Bacteria 3542
123 Ga0466957_0066644 3300044842 Bacteria 2220
124 Ga0466957_0072182 3300044842 Bacteria 2136
125 Ga0466960_0049258 3300044901 Bacteria 2027
126 Ga0466959_0003079 3300045049 Bacteria 10802
127 Ga0466959_0013131 3300045049 Bacteria 5999
128 Ga0466959_0021130 3300045049 Bacteria 4798
129 Ga0466959_0026642 3300045049 Bacteria 4285
130 Ga0466958_0007459 3300045836 Bacteria 6019
131 Ga0466958_0008906 3300045836 Bacteria 5575
132 Ga0466958_0013805 3300045836 Bacteria 4605
133 Ga0466958_0030358 3300045836 Bacteria 3210
134 Ga0466958_0034805 3300045836 Bacteria 3006
135 Ga0466958_0130572 3300045836 Bacteria 1577
136 Ga0466958_0217610 3300045836 Bacteria 1218
137 Ga0466967_0003435 3300045976 Bacteria 10337
138 Ga0466967_0006550 3300045976 Bacteria 8260
139 Ga0466967_0019946 3300045976 Bacteria 5405
140 Ga0466967_0024592 3300045976 Bacteria 4955
141 Ga0466967_0025156 3300045976 Bacteria 4905
142 Ga0466967_0026721 3300045976 Bacteria 4787
143 Ga0466967_0041892 3300045976 Bacteria 3952
144 Ga0466967_0086101 3300045976 Bacteria 2846
145 Ga0466967_0098111 3300045976 Bacteria 2675
146 Ga0466967_0152498 3300045976 Bacteria 2161
147 Ga0466967_0166327 3300045976 Bacteria 2073
148 Ga0495592_0000048 3300046454 Bacteria 114599
149 Ga0495592_0008662 3300046454 Bacteria 7637
150 Ga0495592_0068974 3300046454 Bacteria 2579
151 Ga0495592_0342982 3300046454 Unclassified 960
152 Ga0495603_0175134 3300046455 Bacteria 1242
153 Ga0495629_0009455 3300046459 Bacteria 7130
154 Ga0495629_0111241 3300046459 Bacteria 1909
155 Ga0495641_0027491 3300046461 Bacteria 2766
156 Ga0495641_0042965 3300046461 Bacteria 2091
157 Ga0495641_0091547 3300046461 Bacteria 1359
158 Ga0495651_0000276 3300046462 Bacteria 39992
159 Ga0495651_0150452 3300046462 Bacteria 1678
160 Ga0495653_0005902 3300046463 Bacteria 10024
161 Ga0495653_0060634 3300046463 Bacteria 2865
162 Ga0495580_0231493 3300046472 Bacteria 1268
163 Ga0495582_0013566 3300046473 Bacteria 4485
164 Ga0495582_0020442 3300046473 Bacteria 3625
165 Ga0495582_0050450 3300046473 Bacteria 2293
166 Ga0495639_0000216 3300046475 Bacteria 29605
167 Ga0495662_0005646 3300046476 Bacteria 6255
168 Ga0495664_0014905 3300046477 Bacteria 4413
169 Ga0495664_0064486 3300046477 Bacteria 2183
170 Ga0495664_0103798 3300046477 Bacteria 1713
171 Ga0495664_0381294 3300046477 Unclassified 847
172 Ga0495584_0029276 3300046491 Bacteria 2791
173 Ga0495584_0136828 3300046491 Bacteria 1244
174 Ga0495585_0190028 3300046492 Bacteria 1051
175 Ga0495594_0293235 3300046499 Unclassified 927
176 Ga0495607_0135772 3300046501 Bacteria 1274
177 Ga0495608_0000508 3300046511 Bacteria 26705
178 Ga0495608_0014673 3300046511 Bacteria 5436
179 Ga0495608_0208168 3300046511 Bacteria 1231
180 Ga0495618_0001821 3300046514 Bacteria 14055
181 Ga0495618_0035165 3300046514 Bacteria 3144
182 Ga0495618_0219074 3300046514 Bacteria 1201
183 Ga0495618_0323023 3300046514 Unclassified 955
184 Ga0495618_0453123 3300046514 Unclassified 778
185 Ga0495628_0000026 3300046516 Bacteria 127398
186 Ga0495628_0158290 3300046516 Bacteria 1722
187 Ga0495630_0025712 3300046517 Bacteria 4354
188 Ga0495630_0107078 3300046517 Bacteria 2117
189 Ga0495630_0209535 3300046517 Bacteria 1487
190 Ga0495630_0958917 3300046517 Unclassified 650
191 Ga0495644_0020940 3300046523 Bacteria 2495
192 Ga0495666_0002151 3300046526 Bacteria 9796
193 Ga0495642_0129615 3300046528 Bacteria 1085
194 Ga0495652_0001333 3300046529 Bacteria 27472
195 Ga0495652_0018005 3300046529 Bacteria 6302
196 Ga0495652_0086765 3300046529 Bacteria 2568
197 Ga0495652_0169819 3300046529 Bacteria 1685
198 Ga0495652_0192254 3300046529 Bacteria 1556
199 Ga0495652_0467212 3300046529 Bacteria 880
200 Ga0495665_0018715 3300046531 Bacteria 3720
201 Ga0495640_0157317 3300046533 Bacteria 1458
202 Ga0495640_0208428 3300046533 Bacteria 1236
203 Ga0495640_0260074 3300046533 Bacteria 1085
204 Ga0495586_0045518 3300046535 Bacteria 2364
205 Ga0495586_0211131 3300046535 Bacteria 1101
206 Ga0495587_0000080 3300046536 Bacteria 75321
207 Ga0495645_0000016 3300046543 Bacteria 158415
208 Ga0495645_0102819 3300046543 Bacteria 2030
209 Ga0495645_0148796 3300046543 Bacteria 1628
210 Ga0495667_0007334 3300046559 Bacteria 7479
211 Ga0495667_0140509 3300046559 Bacteria 1556
212 Ga0495667_0180177 3300046559 Bacteria 1356
213 Ga0495667_0266660 3300046559 Unclassified 1089
214 Ga0495667_0279202 3300046559 Bacteria 1060
215 Ga0495668_0189390 3300046616 Bacteria 1127
216 Ga0495634_0132109 3300046642 Unclassified 1590
217 Ga0495635_0023368 3300046663 Bacteria 4308
218 Ga0495635_0156259 3300046663 Bacteria 1552
219 Ga0495635_0408714 3300046663 Bacteria 901
220 Ga0495588_0052540 3300046674 Bacteria 2101
221 Ga0495657_0024592 3300046675 Bacteria 4287
222 Ga0495657_0239596 3300046675 Bacteria 1095
223 Ga0495599_0000016 3300046678 Bacteria 169605
224 Ga0495599_0053769 3300046678 Bacteria 2522
225 Ga0495599_0126127 3300046678 Bacteria 1591
226 Ga0495623_0000385 3300046679 Bacteria 28941
227 Ga0495646_0013431 3300046680 Bacteria 5206
228 Ga0495646_0089719 3300046680 Bacteria 1778
229 Ga0495647_0003374 3300046681 Bacteria 5118
230 Ga0495658_0005246 3300046683 Bacteria 6378
231 Ga0495658_0312972 3300046683 Bacteria 994
232 Ga0495613_0124968 3300046689 Bacteria 1845
233 Ga0495613_0132861 3300046689 Bacteria 1781
234 Ga0495613_0189722 3300046689 Bacteria 1453
235 Ga0495613_0210283 3300046689 Bacteria 1368
236 Ga0495624_0001228 3300046690 Bacteria 20224
237 Ga0495624_0080922 3300046690 Bacteria 2012
238 Ga0495670_0112923 3300046691 Bacteria 1407
239 Ga0495589_0235696 3300046794 Bacteria 857
240 Ga0495600_0045100 3300046809 Bacteria 2876
241 Ga0495600_0409899 3300046809 Unclassified 842
242 Ga0495581_0010245 3300047315 Bacteria 5421
243 Ga0495604_0000004 3300047317 Bacteria 456385
244 Ga0495604_0112184 3300047317 Bacteria 1987
245 Ga0495604_0144483 3300047317 Bacteria 1697
246 Ga0495604_0475271 3300047317 Bacteria 814
247 Ga0495674_0057911 3300047319 Bacteria 3389
248 Ga0495674_0774345 3300047319 Bacteria 748
249 Ga0495676_0009799 3300047321 Bacteria 8703
250 Ga0495680_0009342 3300047322 Bacteria 8828
251 Ga0495680_0109496 3300047322 Bacteria 2048
252 Ga0495680_0198030 3300047322 Bacteria 1442
253 Ga0495680_0506166 3300047322 Bacteria 819
254 Ga0495675_0000033 3300047444 Bacteria 98338
255 Ga0495684_0196690 3300047471 Bacteria 1488
256 Ga0495684_0228222 3300047471 Bacteria 1363
257 Ga0495593_0005275 3300047673 Bacteria 7634
258 Ga0495602_0000036 3300048088 Bacteria 133584
259 Ga0495602_0083157 3300048088 Bacteria 2683
260 Ga0495614_0017629 3300048089 Bacteria 3101
261 Ga0496100_0037718 3300048903 Bacteria 3057
262 Ga0496101_0031857 3300048904 Bacteria 3708
263 Ga0496101_0097258 3300048904 Bacteria 2198
264 Ga0496101_0115170 3300048904 Bacteria 2027
265 Ga0496102_0110295 3300048905 Bacteria 2565
266 Ga0496102_0337996 3300048905 Bacteria 1418
267 Ga0496103_0374829 3300048906 Bacteria 914
268 Ga0496104_0091448 3300048907 Bacteria 2908
269 Ga0496104_0261714 3300048907 Bacteria 1642
270 Ga0496105_0005085 3300048908 Bacteria 9969
271 Ga0496105_0086687 3300048908 Bacteria 2587
272 Ga0496105_0259817 3300048908 Bacteria 1404
273 Ga0496105_0484735 3300048908 Bacteria 972
274 Ga0496105_0618323 3300048908 Bacteria 839
275 Ga0496106_0081065 3300048909 Bacteria 2492
276 Ga0496107_0050827 3300048910 Bacteria 2988
277 Ga0496107_0069472 3300048910 Bacteria 2557
278 Ga0496108_0009379 3300048911 Bacteria 7923
279 Ga0496108_0251199 3300048911 Bacteria 1538
280 Ga0496109_0008397 3300048912 Bacteria 8779
281 Ga0496109_0146610 3300048912 Bacteria 2208
282 Ga0496109_0201280 3300048912 Bacteria 1872
283 Ga0496109_0658328 3300048912 Bacteria 984
284 Ga0496110_0509296 3300048913 Bacteria 1095
285 Ga0496111_0424941 3300048914 Unclassified 981
286 Ga0496111_0502085 3300048914 Bacteria 893
287 Ga0496112_0634786 3300048915 Bacteria 998
288 Ga0496113_0070181 3300048916 Bacteria 2662
289 Ga0496113_0237491 3300048916 Bacteria 1454
290 Ga0496113_1040035 3300048916 Bacteria 644
291 Ga0496114_0004272 3300048917 Bacteria 11059
292 Ga0496114_0048871 3300048917 Bacteria 3519
293 Ga0496114_0061548 3300048917 Bacteria 3140
294 Ga0496114_0710414 3300048917 Bacteria 881
295 Ga0496115_0005293 3300048918 Bacteria 9384
296 Ga0496115_0024018 3300048918 Bacteria 4735
297 Ga0496115_0137237 3300048918 Bacteria 2017
298 Ga0496115_0487677 3300048918 Bacteria 992
299 Ga0501067_0077271 3300049583 Bacteria 1845
300 Ga0501071_0367626 3300049587 Bacteria 1096
301 Ga0501081_0436390 3300049743 Bacteria 972
302 nmdc:mga05p37_174977_c1 3300050507 Bacteria 2615
303 nmdc:mga0n895_10080_c1 3300050512 Bacteria 8317
304 nmdc:mga0a205_104502_c1 3300050515 Bacteria 2731
305 Ga0495601_0000101 3300053077 Bacteria 47661
306 Ga0495601_0009453 3300053077 Bacteria 5767
307 Ga0495601_0165673 3300053077 Bacteria 1444
308 Ga0495601_0227462 3300053077 Bacteria 1218
309 Ga0495601_0230182 3300053077 Bacteria 1210
310 Ga0495601_0311876 3300053077 Unclassified 1024
311 Ga0495601_0506280 3300053077 Bacteria 779
312 Ga0495601_0521600 3300053077 Bacteria 766
313 Ga0495612_0000873 3300053078 Bacteria 12297
314 Ga0495612_0034944 3300053078 Bacteria 2036
315 Ga0495612_0073297 3300053078 Bacteria 1430
316 Ga0495612_0300921 3300053078 Bacteria 719
317 Ga0495595_0016393 3300053084 Bacteria 3169
318 Ga0495595_0228423 3300053084 Bacteria 929
319 Ga0495619_0000235 3300053085 Bacteria 40323
320 Ga0495619_0010931 3300053085 Bacteria 5712
321 Ga0495619_0071921 3300053085 Bacteria 2315
322 Ga0501084_0584722 3300054114 Bacteria 944
323 Ga0501082_0251263 3300060353 Bacteria 1539
324 Ga0466962_0001358 3300061719 Bacteria 11323
325 Ga0466962_0003103 3300061719 Bacteria 7896
326 Ga0466962_0020896 3300061719 Bacteria 3145
327 Ga0466962_0039864 3300061719 Bacteria 2248
328 Ga0466962_0191740 3300061719 Bacteria 997

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046559 Ga0495667_0279202 Ga0495667_0279202_543_1049 168
2 3300060353 Ga0501082_0251263 Ga0501082_0251263_127_732 170
3 3300046689 Ga0495613_0189722 Ga0495613_0189722_41_658 173
4 3300047471 Ga0495684_0196690 Ga0495684_0196690_893_1465 173
5 3300006028 Ga0070717_10626638 Ga0070717_106266382 189
6 3300025941 Ga0207711_10423903 Ga0207711_104239032 194
7 3300046491 Ga0495584_0136828 Ga0495584_0136828_474_1220 198
8 3300035171 Ga0373946_0004632 Ga0373946_0004632_10_612 199
9 3300046473 Ga0495582_0013566 Ga0495582_0013566_3873_4475 199
10 3300046517 Ga0495630_0209535 Ga0495630_0209535_11_613 199
11 3300046517 Ga0495630_0958917 Ga0495630_0958917_11_610 199
12 3300046683 Ga0495658_0312972 Ga0495658_0312972_19_618 199
13 3300048916 Ga0496113_1040035 Ga0496113_1040035_13_618 199
14 3300053078 Ga0495612_0300921 Ga0495612_0300921_108_707 199
15 3300005458 Ga0070681_10211151 Ga0070681_102111512 210
16 3300005577 Ga0068857_100472844 Ga0068857_1004728441 210
17 3300026116 Ga0207674_10438995 Ga0207674_104389952 210
18 3300028666 Ga0265336_10001053 Ga0265336_100010537 210
19 3300039438 Ga0436360_0990257 Ga0436360_0990257_3761_4396 210
20 3300046511 Ga0495608_0208168 Ga0495608_0208168_298_930 210
21 3300046663 Ga0495635_0408714 Ga0495635_0408714_249_881 210
22 3300047317 Ga0495604_0475271 Ga0495604_0475271_149_781 210
23 3300047322 Ga0495680_0506166 Ga0495680_0506166_165_797 210
24 3300025944 Ga0207661_10306895 Ga0207661_103068952 211
25 3300050507 nmdc:mga05p37_174977_c1 nmdc:mga05p37_174977_c1_1591_2334 211
26 3300009177 Ga0105248_10576568 Ga0105248_105765682 212
27 3300028800 Ga0265338_10012905 Ga0265338_100129059 212
28 3300044684 Ga0466966_0020368 Ga0466966_0020368_1505_2146 212
29 3300005329 Ga0070683_100082326 Ga0070683_1000823261 213
30 3300005336 Ga0070680_100078613 Ga0070680_1000786132 213
31 3300005339 Ga0070660_100011412 Ga0070660_1000114126 213
32 3300020082 Ga0206353_10153761 Ga0206353_101537612 213
33 3300025919 Ga0207657_10001474 Ga0207657_100014748 213
34 3300049587 Ga0501071_0367626 Ga0501071_0367626_69_809 214
35 3300054114 Ga0501084_0584722 Ga0501084_0584722_151_891 214
36 3300005718 Ga0068866_10137767 Ga0068866_101377672 215
37 3300006237 Ga0097621_100170600 Ga0097621_1001706002 215
38 3300042122 Ga0450920_004820 Ga0450920_004820_483_1235 215
39 3300046455 Ga0495603_0175134 Ga0495603_0175134_258_1001 215
40 3300049743 Ga0501081_0436390 Ga0501081_0436390_174_917 215
41 3300044656 Ga0466969_0024815 Ga0466969_0024815_926_1579 216
42 3300044684 Ga0466966_0099678 Ga0466966_0099678_27_680 216
43 3300044693 Ga0466961_0142410 Ga0466961_0142410_205_858 216
44 3300044719 Ga0466971_0016849 Ga0466971_0016849_1138_1791 216
45 3300045049 Ga0466959_0013131 Ga0466959_0013131_4223_4876 216
46 3300046477 Ga0495664_0064486 Ga0495664_0064486_317_967 216
47 3300053077 Ga0495601_0506280 Ga0495601_0506280_48_698 216
48 3300053077 Ga0495601_0521600 Ga0495601_0521600_101_751 216
49 3300061719 Ga0466962_0020896 Ga0466962_0020896_2445_3098 216
50 3300005327 Ga0070658_10028935 Ga0070658_100289352 217
51 3300005336 Ga0070680_100109697 Ga0070680_1001096974 217
52 3300005344 Ga0070661_100104662 Ga0070661_1001046622 217
53 3300005434 Ga0070709_10043366 Ga0070709_100433663 217
54 3300005434 Ga0070709_10248034 Ga0070709_102480342 217
55 3300005435 Ga0070714_100019023 Ga0070714_1000190237 217
56 3300005435 Ga0070714_100061641 Ga0070714_1000616413 217
57 3300005435 Ga0070714_100340572 Ga0070714_1003405722 217
58 3300005436 Ga0070713_100257243 Ga0070713_1002572432 217
59 3300005437 Ga0070710_10002002 Ga0070710_100020029 217
60 3300005437 Ga0070710_10160783 Ga0070710_101607832 217
61 3300005439 Ga0070711_100033563 Ga0070711_1000335632 217
62 3300005458 Ga0070681_10034131 Ga0070681_100341316 217
63 3300005530 Ga0070679_100026217 Ga0070679_1000262172 217
64 3300005535 Ga0070684_100185783 Ga0070684_1001857832 217
65 3300005535 Ga0070684_100618455 Ga0070684_1006184552 217
66 3300005547 Ga0070693_100246846 Ga0070693_1002468461 217
67 3300005614 Ga0068856_100037588 Ga0068856_1000375886 217
68 3300005614 Ga0068856_100132023 Ga0068856_1001320233 217
69 3300005615 Ga0070702_100112295 Ga0070702_1001122952 217
70 3300005616 Ga0068852_100052752 Ga0068852_1000527525 217
71 3300006028 Ga0070717_10010996 Ga0070717_100109962 217
72 3300006028 Ga0070717_10033507 Ga0070717_100335074 217
73 3300006028 Ga0070717_10160095 Ga0070717_101600952 217
74 3300006163 Ga0070715_10108792 Ga0070715_101087922 217
75 3300006173 Ga0070716_100102112 Ga0070716_1001021122 217
76 3300006175 Ga0070712_100012112 Ga0070712_1000121122 217
77 3300006871 Ga0075434_100011666 Ga0075434_1000116667 217
78 3300009093 Ga0105240_10466343 Ga0105240_104663432 217
79 3300009098 Ga0105245_10136860 Ga0105245_101368602 217
80 3300009098 Ga0105245_10451222 Ga0105245_104512222 217
81 3300009551 Ga0105238_10478808 Ga0105238_104788082 217
82 3300010375 Ga0105239_10488892 Ga0105239_104888922 217
83 3300013105 Ga0157369_10011368 Ga0157369_1001136812 217
84 3300013296 Ga0157374_10053204 Ga0157374_100532046 217
85 3300013307 Ga0157372_10650742 Ga0157372_106507422 217
86 3300014497 Ga0182008_10237845 Ga0182008_102378452 217
87 3300025898 Ga0207692_10024682 Ga0207692_100246824 217
88 3300025905 Ga0207685_10143647 Ga0207685_101436472 217
89 3300025906 Ga0207699_10141955 Ga0207699_101419552 217
90 3300025906 Ga0207699_10199102 Ga0207699_101991022 217
91 3300025915 Ga0207693_10001813 Ga0207693_1000181320 217
92 3300025915 Ga0207693_10015387 Ga0207693_100153874 217
93 3300025916 Ga0207663_10106061 Ga0207663_101060612 217
94 3300025919 Ga0207657_10016745 Ga0207657_100167452 217
95 3300025928 Ga0207700_10009973 Ga0207700_100099737 217
96 3300025928 Ga0207700_10029365 Ga0207700_100293652 217
97 3300025928 Ga0207700_10308514 Ga0207700_103085142 217
98 3300025929 Ga0207664_10006516 Ga0207664_100065169 217
99 3300025929 Ga0207664_10007975 Ga0207664_100079755 217
100 3300025929 Ga0207664_10051097 Ga0207664_100510973 217
101 3300025929 Ga0207664_10263974 Ga0207664_102639741 217
102 3300025939 Ga0207665_10000968 Ga0207665_100009688 217
103 3300025945 Ga0207679_10297150 Ga0207679_102971502 217
104 3300026078 Ga0207702_10254714 Ga0207702_102547142 217
105 3300026088 Ga0207641_10361522 Ga0207641_103615222 217
106 3300026142 Ga0207698_10112294 Ga0207698_101122942 217
107 3300028381 Ga0268264_10411952 Ga0268264_104119522 217
108 3300028800 Ga0265338_10028358 Ga0265338_100283587 217
109 3300035119 Ga0373956_0034809 Ga0373956_0034809_604_1257 217
110 3300035170 Ga0373943_0001582 Ga0373943_0001582_1562_2218 217
111 3300035695 Ga0373927_0025709 Ga0373927_0025709_384_1040 217
112 3300035725 Ga0373947_0023910 Ga0373947_0023910_777_1433 217
113 3300036401 Ga0373937_0017799 Ga0373937_0017799_794_1447 217
114 3300036401 Ga0373937_0043656 Ga0373937_0043656_2456_3178 217
115 3300037068 Ga0373925_0006948 Ga0373925_0006948_1543_2199 217
116 3300037418 Ga0395900_0561821 Ga0395900_0561821_346_999 217
117 3300038443 Ga0395901_0050701 Ga0395901_0050701_2462_3115 217
118 3300044656 Ga0466969_0003018 Ga0466969_0003018_1565_2221 217
119 3300044683 Ga0466965_0009914 Ga0466965_0009914_80_736 217
120 3300044683 Ga0466965_0142390 Ga0466965_0142390_526_1182 217
121 3300044684 Ga0466966_0144825 Ga0466966_0144825_626_1282 217
122 3300044693 Ga0466961_0013260 Ga0466961_0013260_1426_2082 217
123 3300044694 Ga0466963_0000081 Ga0466963_0000081_8296_9015 217
124 3300044694 Ga0466963_0000637 Ga0466963_0000637_1587_2243 217
125 3300044694 Ga0466963_0001598 Ga0466963_0001598_7795_8448 217
126 3300044694 Ga0466963_0005358 Ga0466963_0005358_5471_6124 217
127 3300044694 Ga0466963_0005420 Ga0466963_0005420_4356_5060 217
128 3300044694 Ga0466963_0008806 Ga0466963_0008806_3032_3688 217
129 3300044694 Ga0466963_0014146 Ga0466963_0014146_3041_3694 217
130 3300044694 Ga0466963_0028040 Ga0466963_0028040_2193_2846 217
131 3300044694 Ga0466963_0067720 Ga0466963_0067720_1134_1787 217
132 3300044694 Ga0466963_0200300 Ga0466963_0200300_167_823 217
133 3300044706 Ga0466964_0014788 Ga0466964_0014788_1324_1980 217
134 3300044706 Ga0466964_0162609 Ga0466964_0162609_111_767 217
135 3300044719 Ga0466971_0000381 Ga0466971_0000381_2531_3187 217
136 3300044719 Ga0466971_0003546 Ga0466971_0003546_5996_6649 217
137 3300044735 Ga0466968_0002237 Ga0466968_0002237_1596_2252 217
138 3300044735 Ga0466968_0004776 Ga0466968_0004776_2186_2839 217
139 3300044735 Ga0466968_0058154 Ga0466968_0058154_521_1174 217
140 3300044735 Ga0466968_0067786 Ga0466968_0067786_161_814 217
141 3300044735 Ga0466968_0118665 Ga0466968_0118665_305_961 217
142 3300044765 Ga0466970_0007727 Ga0466970_0007727_3711_4367 217
143 3300044765 Ga0466970_0058840 Ga0466970_0058840_978_1631 217
144 3300044765 Ga0466970_0157043 Ga0466970_0157043_506_1162 217
145 3300044842 Ga0466957_0003003 Ga0466957_0003003_1502_2158 217
146 3300044842 Ga0466957_0017163 Ga0466957_0017163_908_1561 217
147 3300044842 Ga0466957_0024937 Ga0466957_0024937_444_1097 217
148 3300044842 Ga0466957_0066644 Ga0466957_0066644_78_734 217
149 3300044842 Ga0466957_0072182 Ga0466957_0072182_982_1635 217
150 3300044901 Ga0466960_0049258 Ga0466960_0049258_214_867 217
151 3300045049 Ga0466959_0003079 Ga0466959_0003079_8654_9310 217
152 3300045049 Ga0466959_0021130 Ga0466959_0021130_1171_1827 217
153 3300045049 Ga0466959_0026642 Ga0466959_0026642_3482_4144 217
154 3300045836 Ga0466958_0007459 Ga0466958_0007459_2355_3011 217
155 3300045836 Ga0466958_0008906 Ga0466958_0008906_662_1315 217
156 3300045836 Ga0466958_0013805 Ga0466958_0013805_3509_4162 217
157 3300045836 Ga0466958_0030358 Ga0466958_0030358_2363_3019 217
158 3300045836 Ga0466958_0034805 Ga0466958_0034805_657_1313 217
159 3300045836 Ga0466958_0130572 Ga0466958_0130572_83_739 217
160 3300045836 Ga0466958_0217610 Ga0466958_0217610_419_1078 217
161 3300045976 Ga0466967_0003435 Ga0466967_0003435_7326_7979 217
162 3300045976 Ga0466967_0006550 Ga0466967_0006550_4579_5235 217
163 3300045976 Ga0466967_0019946 Ga0466967_0019946_4416_5069 217
164 3300045976 Ga0466967_0024592 Ga0466967_0024592_2345_2998 217
165 3300045976 Ga0466967_0025156 Ga0466967_0025156_885_1538 217
166 3300045976 Ga0466967_0026721 Ga0466967_0026721_522_1226 217
167 3300045976 Ga0466967_0041892 Ga0466967_0041892_24_677 217
168 3300045976 Ga0466967_0086101 Ga0466967_0086101_1573_2226 217
169 3300045976 Ga0466967_0098111 Ga0466967_0098111_531_1187 217
170 3300045976 Ga0466967_0152498 Ga0466967_0152498_246_902 217
171 3300045976 Ga0466967_0166327 Ga0466967_0166327_1279_1932 217
172 3300046454 Ga0495592_0000048 Ga0495592_0000048_97135_97788 217
173 3300046454 Ga0495592_0008662 Ga0495592_0008662_1239_1943 217
174 3300046454 Ga0495592_0068974 Ga0495592_0068974_566_1219 217
175 3300046454 Ga0495592_0342982 Ga0495592_0342982_133_789 217
176 3300046459 Ga0495629_0009455 Ga0495629_0009455_4605_5261 217
177 3300046459 Ga0495629_0111241 Ga0495629_0111241_141_794 217
178 3300046461 Ga0495641_0027491 Ga0495641_0027491_1276_1998 217
179 3300046461 Ga0495641_0042965 Ga0495641_0042965_629_1285 217
180 3300046461 Ga0495641_0091547 Ga0495641_0091547_597_1250 217
181 3300046462 Ga0495651_0000276 Ga0495651_0000276_4332_4985 217
182 3300046462 Ga0495651_0150452 Ga0495651_0150452_863_1567 217
183 3300046463 Ga0495653_0005902 Ga0495653_0005902_4771_5424 217
184 3300046463 Ga0495653_0060634 Ga0495653_0060634_213_869 217
185 3300046472 Ga0495580_0231493 Ga0495580_0231493_305_961 217
186 3300046473 Ga0495582_0020442 Ga0495582_0020442_59_712 217
187 3300046473 Ga0495582_0050450 Ga0495582_0050450_1549_2208 217
188 3300046475 Ga0495639_0000216 Ga0495639_0000216_26779_27435 217
189 3300046476 Ga0495662_0005646 Ga0495662_0005646_3415_4071 217
190 3300046477 Ga0495664_0014905 Ga0495664_0014905_2653_3357 217
191 3300046477 Ga0495664_0103798 Ga0495664_0103798_531_1187 217
192 3300046477 Ga0495664_0381294 Ga0495664_0381294_89_742 217
193 3300046491 Ga0495584_0029276 Ga0495584_0029276_1313_1966 217
194 3300046492 Ga0495585_0190028 Ga0495585_0190028_209_862 217
195 3300046499 Ga0495594_0293235 Ga0495594_0293235_74_727 217
196 3300046501 Ga0495607_0135772 Ga0495607_0135772_472_1125 217
197 3300046511 Ga0495608_0000508 Ga0495608_0000508_10779_11432 217
198 3300046511 Ga0495608_0014673 Ga0495608_0014673_4683_5405 217
199 3300046514 Ga0495618_0001821 Ga0495618_0001821_10433_11086 217
200 3300046514 Ga0495618_0035165 Ga0495618_0035165_89_745 217
201 3300046514 Ga0495618_0219074 Ga0495618_0219074_85_738 217
202 3300046514 Ga0495618_0323023 Ga0495618_0323023_89_742 217
203 3300046514 Ga0495618_0453123 Ga0495618_0453123_107_760 217
204 3300046516 Ga0495628_0000026 Ga0495628_0000026_95835_96488 217
205 3300046516 Ga0495628_0158290 Ga0495628_0158290_364_1020 217
206 3300046517 Ga0495630_0025712 Ga0495630_0025712_3046_3768 217
207 3300046517 Ga0495630_0107078 Ga0495630_0107078_970_1623 217
208 3300046523 Ga0495644_0020940 Ga0495644_0020940_1128_1781 217
209 3300046526 Ga0495666_0002151 Ga0495666_0002151_642_1298 217
210 3300046528 Ga0495642_0129615 Ga0495642_0129615_353_1006 217
211 3300046529 Ga0495652_0001333 Ga0495652_0001333_4893_5546 217
212 3300046529 Ga0495652_0018005 Ga0495652_0018005_1178_1834 217
213 3300046529 Ga0495652_0086765 Ga0495652_0086765_535_1188 217
214 3300046529 Ga0495652_0169819 Ga0495652_0169819_297_1019 217
215 3300046529 Ga0495652_0192254 Ga0495652_0192254_169_873 217
216 3300046529 Ga0495652_0467212 Ga0495652_0467212_32_736 217
217 3300046531 Ga0495665_0018715 Ga0495665_0018715_2160_2816 217
218 3300046533 Ga0495640_0157317 Ga0495640_0157317_551_1204 217
219 3300046533 Ga0495640_0208428 Ga0495640_0208428_42_695 217
220 3300046533 Ga0495640_0260074 Ga0495640_0260074_78_731 217
221 3300046535 Ga0495586_0045518 Ga0495586_0045518_1351_2007 217
222 3300046535 Ga0495586_0211131 Ga0495586_0211131_244_897 217
223 3300046536 Ga0495587_0000080 Ga0495587_0000080_63484_64137 217
224 3300046543 Ga0495645_0000016 Ga0495645_0000016_61448_62101 217
225 3300046543 Ga0495645_0102819 Ga0495645_0102819_449_1102 217
226 3300046543 Ga0495645_0148796 Ga0495645_0148796_602_1306 217
227 3300046559 Ga0495667_0007334 Ga0495667_0007334_6427_7080 217
228 3300046559 Ga0495667_0140509 Ga0495667_0140509_646_1299 217
229 3300046559 Ga0495667_0180177 Ga0495667_0180177_567_1271 217
230 3300046559 Ga0495667_0266660 Ga0495667_0266660_260_916 217
231 3300046616 Ga0495668_0189390 Ga0495668_0189390_386_1039 217
232 3300046642 Ga0495634_0132109 Ga0495634_0132109_79_732 217
233 3300046663 Ga0495635_0023368 Ga0495635_0023368_2302_2958 217
234 3300046663 Ga0495635_0156259 Ga0495635_0156259_306_959 217
235 3300046674 Ga0495588_0052540 Ga0495588_0052540_1206_1859 217
236 3300046675 Ga0495657_0024592 Ga0495657_0024592_657_1310 217
237 3300046675 Ga0495657_0239596 Ga0495657_0239596_334_987 217
238 3300046678 Ga0495599_0000016 Ga0495599_0000016_95854_96507 217
239 3300046678 Ga0495599_0053769 Ga0495599_0053769_602_1306 217
240 3300046678 Ga0495599_0126127 Ga0495599_0126127_19_672 217
241 3300046679 Ga0495623_0000385 Ga0495623_0000385_21927_22580 217
242 3300046680 Ga0495646_0013431 Ga0495646_0013431_3342_4046 217
243 3300046680 Ga0495646_0089719 Ga0495646_0089719_573_1226 217
244 3300046681 Ga0495647_0003374 Ga0495647_0003374_1292_1948 217
245 3300046683 Ga0495658_0005246 Ga0495658_0005246_340_993 217
246 3300046689 Ga0495613_0124968 Ga0495613_0124968_1116_1769 217
247 3300046689 Ga0495613_0132861 Ga0495613_0132861_875_1531 217
248 3300046689 Ga0495613_0210283 Ga0495613_0210283_408_1130 217
249 3300046690 Ga0495624_0001228 Ga0495624_0001228_6080_6736 217
250 3300046690 Ga0495624_0080922 Ga0495624_0080922_1174_1896 217
251 3300046691 Ga0495670_0112923 Ga0495670_0112923_193_846 217
252 3300046794 Ga0495589_0235696 Ga0495589_0235696_74_727 217
253 3300046809 Ga0495600_0045100 Ga0495600_0045100_2003_2656 217
254 3300046809 Ga0495600_0409899 Ga0495600_0409899_105_758 217
255 3300047315 Ga0495581_0010245 Ga0495581_0010245_3415_4071 217
256 3300047317 Ga0495604_0000004 Ga0495604_0000004_155865_156518 217
257 3300047317 Ga0495604_0112184 Ga0495604_0112184_1294_1947 217
258 3300047317 Ga0495604_0144483 Ga0495604_0144483_876_1598 217
259 3300047319 Ga0495674_0057911 Ga0495674_0057911_2709_3365 217
260 3300047319 Ga0495674_0774345 Ga0495674_0774345_33_686 217
261 3300047321 Ga0495676_0009799 Ga0495676_0009799_3415_4071 217
262 3300047322 Ga0495680_0009342 Ga0495680_0009342_88_744 217
263 3300047322 Ga0495680_0109496 Ga0495680_0109496_261_965 217
264 3300047322 Ga0495680_0198030 Ga0495680_0198030_119_772 217
265 3300047444 Ga0495675_0000033 Ga0495675_0000033_33420_34073 217
266 3300047471 Ga0495684_0228222 Ga0495684_0228222_369_1022 217
267 3300047673 Ga0495593_0005275 Ga0495593_0005275_2301_2957 217
268 3300048088 Ga0495602_0000036 Ga0495602_0000036_62508_63161 217
269 3300048088 Ga0495602_0083157 Ga0495602_0083157_400_1104 217
270 3300048089 Ga0495614_0017629 Ga0495614_0017629_1572_2228 217
271 3300048903 Ga0496100_0037718 Ga0496100_0037718_1862_2518 217
272 3300048904 Ga0496101_0031857 Ga0496101_0031857_1286_1942 217
273 3300048904 Ga0496101_0097258 Ga0496101_0097258_132_791 217
274 3300048904 Ga0496101_0115170 Ga0496101_0115170_1330_1983 217
275 3300048905 Ga0496102_0110295 Ga0496102_0110295_270_923 217
276 3300048905 Ga0496102_0337996 Ga0496102_0337996_447_1103 217
277 3300048906 Ga0496103_0374829 Ga0496103_0374829_149_805 217
278 3300048907 Ga0496104_0091448 Ga0496104_0091448_1836_2489 217
279 3300048907 Ga0496104_0261714 Ga0496104_0261714_687_1346 217
280 3300048908 Ga0496105_0005085 Ga0496105_0005085_5105_5758 217
281 3300048908 Ga0496105_0086687 Ga0496105_0086687_1484_2143 217
282 3300048908 Ga0496105_0259817 Ga0496105_0259817_171_827 217
283 3300048908 Ga0496105_0484735 Ga0496105_0484735_32_685 217
284 3300048908 Ga0496105_0618323 Ga0496105_0618323_34_687 217
285 3300048909 Ga0496106_0081065 Ga0496106_0081065_452_1108 217
286 3300048910 Ga0496107_0050827 Ga0496107_0050827_582_1238 217
287 3300048910 Ga0496107_0069472 Ga0496107_0069472_80_739 217
288 3300048911 Ga0496108_0009379 Ga0496108_0009379_915_1568 217
289 3300048911 Ga0496108_0251199 Ga0496108_0251199_705_1361 217
290 3300048912 Ga0496109_0008397 Ga0496109_0008397_1545_2198 217
291 3300048912 Ga0496109_0146610 Ga0496109_0146610_197_853 217
292 3300048912 Ga0496109_0201280 Ga0496109_0201280_1161_1814 217
293 3300048912 Ga0496109_0658328 Ga0496109_0658328_131_784 217
294 3300048913 Ga0496110_0509296 Ga0496110_0509296_211_867 217
295 3300048914 Ga0496111_0424941 Ga0496111_0424941_119_772 217
296 3300048914 Ga0496111_0502085 Ga0496111_0502085_146_799 217
297 3300048915 Ga0496112_0634786 Ga0496112_0634786_221_877 217
298 3300048916 Ga0496113_0070181 Ga0496113_0070181_566_1222 217
299 3300048916 Ga0496113_0237491 Ga0496113_0237491_697_1350 217
300 3300048917 Ga0496114_0004272 Ga0496114_0004272_3301_3960 217
301 3300048917 Ga0496114_0048871 Ga0496114_0048871_2351_3007 217
302 3300048917 Ga0496114_0061548 Ga0496114_0061548_706_1359 217
303 3300048917 Ga0496114_0710414 Ga0496114_0710414_67_720 217
304 3300048918 Ga0496115_0005293 Ga0496115_0005293_7825_8478 217
305 3300048918 Ga0496115_0024018 Ga0496115_0024018_3390_4049 217
306 3300048918 Ga0496115_0137237 Ga0496115_0137237_22_675 217
307 3300048918 Ga0496115_0487677 Ga0496115_0487677_262_915 217
308 3300049583 Ga0501067_0077271 Ga0501067_0077271_471_1124 217
309 3300050512 nmdc:mga0n895_10080_c1 nmdc:mga0n895_10080_c1_250_903 217
310 3300050515 nmdc:mga0a205_104502_c1 nmdc:mga0a205_104502_c1_1482_2135 217
311 3300053077 Ga0495601_0000101 Ga0495601_0000101_21838_22491 217
312 3300053077 Ga0495601_0009453 Ga0495601_0009453_602_1306 217
313 3300053077 Ga0495601_0165673 Ga0495601_0165673_200_853 217
314 3300053077 Ga0495601_0227462 Ga0495601_0227462_448_1101 217
315 3300053077 Ga0495601_0230182 Ga0495601_0230182_206_859 217
316 3300053077 Ga0495601_0311876 Ga0495601_0311876_11_667 217
317 3300053078 Ga0495612_0000873 Ga0495612_0000873_7150_7806 217
318 3300053078 Ga0495612_0034944 Ga0495612_0034944_391_1044 217
319 3300053078 Ga0495612_0073297 Ga0495612_0073297_208_861 217
320 3300053084 Ga0495595_0016393 Ga0495595_0016393_156_809 217
321 3300053084 Ga0495595_0228423 Ga0495595_0228423_213_866 217
322 3300053085 Ga0495619_0000235 Ga0495619_0000235_38974_39627 217
323 3300053085 Ga0495619_0010931 Ga0495619_0010931_4336_4992 217
324 3300053085 Ga0495619_0071921 Ga0495619_0071921_888_1592 217
325 3300061719 Ga0466962_0001358 Ga0466962_0001358_8733_9389 217
326 3300061719 Ga0466962_0003103 Ga0466962_0003103_5670_6323 217
327 3300061719 Ga0466962_0039864 Ga0466962_0039864_1189_1848 217
328 3300061719 Ga0466962_0191740 Ga0466962_0191740_78_740 217

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nfg-assembly1.cif.gz_B structure of d-hydantoinase 0.7828 88 132
4c1k-assembly1.cif.gz_E crystal structure of pyrococcus furiosus 3-deoxy-d-arabino- heptulosonate 7-phosphate synthase 0.7576 89 131
4tv5-assembly1.cif.gz_A crystal structure of citrate synthase sbng 0.7564 82 131
1zco-assembly1.cif.gz_A crystal structure of pyrococcus furiosus 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase 0.7513 89 131
6hnv-assembly1.cif.gz_B crystal structure of aminotransferase aro9 from c. albicans with ligands 0.7483 97 139
ID Description Score Start End Superfamily
af_Q4E4E4_55_293_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.872 97 130 3.40.640.10
1xi9D02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8503 97 130 3.40.640.10
af_O53619_74_357_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8476 88 134 3.20.20.140
af_Q2FYW6_6_248_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8349 97 132 3.40.640.10
1gkpA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8078 82 129 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A538IDS7-F1-model_v4 Uncharacterized protein 0.9717 1 166
AF-A0A538IDS7-F1-model_v4 Uncharacterized protein 0.966 1 166
AF-A0A538KJV0-F1-model_v4 Uncharacterized protein 0.9485 4 217
AF-A0A538DU44-F1-model_v4 Uncharacterized protein 0.9452 4 217
AF-A0A7Y4VPH8-F1-model_v4 Uncharacterized protein 0.94 96 217

Feature Viewer

pLDDT pTM Quality
95.59 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map