F409356

General Info

Members Datasets Scaffolds Average Seq Length
328 175 656 185

Family's Representative Sequence

Representative Sequence 3300042438|Ga0439459_0011646|Ga0439459_0011646_224_781
Length 185
Sequence MSGALDLLRHGDTGQQGYRGQLDDPLSALGWQQLREAVQGHAWDAIVSSPLSRCAAFASELARARDLPLQLDARLMEYHFGAWQGVPMATLAATQGPALARFWVDPAAHPPSGAETLAAFQARLTAALDDITQAHGGRVLVVTHGGAIRLLRCLAEGRPFTQMTELSVPHASLQTLRWPAPMPVP

Samples

Sample ID Description Type Environment
1 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
18 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
19 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
20 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
21 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
22 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
23 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
24 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
25 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
59 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
60 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
61 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
62 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
69 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
71 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
72 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
75 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
76 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
77 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
108 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
109 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
110 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
111 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
112 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
113 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
114 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
115 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
116 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
121 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
122 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
123 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
124 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
125 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
126 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
127 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
128 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
129 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
140 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
141 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
142 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
143 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
144 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
145 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
146 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
147 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
148 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
149 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
150 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
151 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
162 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
165 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
166 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
167 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
168 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
169 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
170 2738543009 Luteibacter sp. OK325 Isolate Unclassified
171 2739367700 Dyella sp. YR388 Isolate Unclassified
172 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
173 2884411467 Dyella sp. AD56 Isolate Rhizosphere
174 2928963466 Dyella japonica 1073 Isolate Unclassified
175 2941471342 Luteibacter sp. 621 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.65
Metatranscriptomes 0.61
Isolates 2.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.48
Nodule 0
Rhizoplane 4.27
Rhizosphere 50.61
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439459_0011646 3300042438 Bacteria 1552
2 JGI24736J21556_1000945 3300001904 Bacteria 5355
3 JGI24740J21852_10043095 3300001979 Bacteria 1348
4 JGI24737J22298_10007214 3300001990 Bacteria 3759
5 JGI24735J21928_10005341 3300002067 Bacteria 4262
6 JGI24735J21928_10043711 3300002067 Bacteria 1302
7 JGI24735J21928_10044892 3300002067 Bacteria 1284
8 JGI25156J39149_1016672 3300002705 Bacteria 1420
9 JGI25162J39368_1000666 3300002737 Bacteria 24265
10 JGI25162J39368_1001197 3300002737 Bacteria 15208
11 JGI25157J39369_1000579 3300002741 Bacteria 21667
12 JGI25157J39369_1001556 3300002741 Bacteria 8225
13 JGI25157J39369_1022196 3300002741 Bacteria 751
14 JGI25163J39215_1000216 3300002771 Bacteria 21729
15 JGI25164J39214_1000030 3300002772 Bacteria 145974
16 JGI25164J39214_1000093 3300002772 Bacteria 89262
17 JGI25152J39213_1019278 3300002773 Bacteria 1243
18 JGI25165J46597_1000057 3300003214 Bacteria 217135
19 JGI25165J46597_1000759 3300003214 Bacteria 24751
20 rootH1_10033986 3300003316 Bacteria 3365
21 rootH2_10032037 3300003320 Bacteria 25057
22 rootH2_10214272 3300003320 Bacteria 1948
23 rootL2_10053837 3300003322 Bacteria 1388
24 rootH1_10152318 3300003323 Bacteria 4511
25 Ga0006562J51391_1038928 3300003578 Bacteria 20190
26 Ga0006562J51391_1038931 3300003578 Bacteria 6740
27 Ga0055538_1000881 3300003751 Bacteria 7554
28 Ga0055539_1002887 3300003752 Bacteria 2509
29 Ga0055533_1002229 3300003756 Bacteria 4557
30 Ga0055525_1000093 3300003759 Bacteria 138423
31 Ga0055527_1000245 3300003760 Bacteria 33608
32 Ga0055527_1000491 3300003760 Bacteria 14191
33 Ga0055527_1004210 3300003760 Bacteria 2007
34 Ga0055535_1000152 3300003761 Bacteria 73843
35 Ga0055535_1000901 3300003761 Bacteria 20311
36 Ga0055535_1001247 3300003761 Bacteria 14183
37 Ga0055535_1002739 3300003761 Bacteria 5675
38 Ga0055542_1000544 3300003762 Bacteria 33466
39 Ga0055542_1000753 3300003762 Bacteria 24623
40 Ga0055542_1000769 3300003762 Bacteria 24265
41 Ga0055542_1001155 3300003762 Bacteria 15422
42 Ga0055542_1001236 3300003762 Bacteria 14182
43 Ga0055529_1000082 3300003763 Bacteria 146912
44 Ga0055529_1000588 3300003763 Bacteria 28906
45 Ga0055529_1000941 3300003763 Bacteria 15422
46 Ga0055529_1000982 3300003763 Bacteria 14182
47 Ga0065165_1006031 3300005262 Bacteria 6518
48 Ga0070689_100000610 3300005340 Bacteria 21657
49 Ga0070661_100204277 3300005344 Bacteria 1511
50 Ga0070663_100000263 3300005455 Bacteria 26391
51 Ga0070663_100038583 3300005455 Bacteria 3333
52 Ga0070663_100084923 3300005455 Bacteria 2335
53 Ga0070662_100418885 3300005457 Bacteria 1108
54 Ga0068853_100000138 3300005539 Bacteria 49814
55 Ga0068853_100000391 3300005539 Bacteria 29990
56 Ga0070665_100017248 3300005548 Bacteria 7246
57 Ga0068855_100005293 3300005563 Bacteria 15755
58 Ga0068855_100010686 3300005563 Bacteria 11078
59 Ga0068855_100069657 3300005563 Bacteria 4093
60 Ga0070664_100238422 3300005564 Bacteria 1632
61 Ga0068857_100002273 3300005577 Bacteria 15618
62 Ga0068857_100041080 3300005577 Bacteria 4101
63 Ga0068854_100002661 3300005578 Bacteria 11078
64 Ga0068854_100006581 3300005578 Bacteria 7401
65 Ga0068856_100007414 3300005614 Bacteria 10703
66 Ga0068856_100467310 3300005614 Bacteria 1282
67 Ga0068856_100733378 3300005614 Bacteria 1008
68 Ga0068852_100066732 3300005616 Bacteria 3143
69 Ga0068851_10000797 3300005834 Bacteria 13612
70 Ga0068863_100299164 3300005841 Bacteria 1561
71 Ga0068858_100097602 3300005842 Bacteria 2739
72 Ga0068860_100029071 3300005843 Bacteria 5316
73 Ga0105240_10001218 3300009093 Bacteria 44763
74 Ga0105240_10001540 3300009093 Bacteria 39145
75 Ga0105240_10004902 3300009093 Bacteria 20148
76 Ga0105240_10029602 3300009093 Bacteria 7130
77 Ga0105240_10062132 3300009093 Bacteria 4651
78 Ga0105240_10291786 3300009093 Bacteria 1869
79 Ga0105241_10567277 3300009174 Bacteria 1021
80 Ga0105248_10000693 3300009177 Bacteria 38048
81 Ga0105237_10000084 3300009545 Bacteria 125742
82 Ga0105237_10005674 3300009545 Bacteria 14044
83 Ga0105237_10116457 3300009545 Bacteria 2666
84 Ga0105237_10293874 3300009545 Bacteria 1627
85 Ga0105238_10179473 3300009551 Bacteria 2094
86 Ga0105249_10000158 3300009553 Bacteria 82194
87 Ga0105029_100382 3300009984 Bacteria 2320
88 Ga0105239_10000174 3300010375 Bacteria 92922
89 Ga0105239_10025526 3300010375 Bacteria 6505
90 Ga0105239_11014096 3300010375 Bacteria 954
91 Ga0157314_1000668 3300012500 Bacteria 3028
92 Ga0157373_10106471 3300013100 Bacteria 1972
93 Ga0157370_10060736 3300013104 Bacteria 3588
94 Ga0157369_10091186 3300013105 Bacteria 3253
95 Ga0163162_11246943 3300013306 Bacteria 844
96 Ga0163163_10316890 3300014325 Bacteria 1613
97 Ga0157376_10583071 3300014969 Bacteria 1111
98 Ga0182005_1016412 3300015265 Bacteria 2059
99 Ga0183369_1013 3300015685 Bacteria 222738
100 Ga0183368_1003 3300015687 Bacteria 1276390
101 Ga0209435_108470 3300025206 Bacteria 1130
102 Ga0209760_101067 3300025207 Bacteria 3180
103 Ga0209784_100011 3300025224 Bacteria 546770
104 Ga0209674_100012 3300025226 Bacteria 950162
105 Ga0209674_100107 3300025226 Bacteria 151298
106 Ga0209674_100375 3300025226 Bacteria 24206
107 Ga0209674_100892 3300025226 Bacteria 9684
108 Ga0209672_100005 3300025228 Bacteria 1069303
109 Ga0209672_100055 3300025228 Bacteria 221655
110 Ga0209672_100124 3300025228 Bacteria 80646
111 Ga0209672_100621 3300025228 Bacteria 18434
112 Ga0209672_103864 3300025228 Bacteria 2954
113 Ga0209563_100045 3300025230 Bacteria 377102
114 Ga0207427_100026 3300025231 Bacteria 412764
115 Ga0207427_100053 3300025231 Bacteria 217191
116 Ga0209437_100108 3300025233 Bacteria 217191
117 Ga0209437_100241 3300025233 Bacteria 89459
118 Ga0209437_100340 3300025233 Bacteria 56228
119 Ga0209437_101214 3300025233 Bacteria 7441
120 Ga0209258_100006 3300025242 Bacteria 1069303
121 Ga0209258_100012 3300025242 Bacteria 825544
122 Ga0209258_100027 3300025242 Bacteria 518449
123 Ga0209258_100055 3300025242 Bacteria 337291
124 Ga0209258_100892 3300025242 Bacteria 15492
125 Ga0209646_1000776 3300025246 Bacteria 10989
126 Ga0209646_1002993 3300025246 Bacteria 3486
127 Ga0209026_1000018 3300025250 Bacteria 381351
128 Ga0209026_1000172 3300025250 Bacteria 98917
129 Ga0209026_1002761 3300025250 Bacteria 6275
130 Ga0209026_1004676 3300025250 Bacteria 3966
131 Ga0209026_1018271 3300025250 Bacteria 1111
132 Ga0209677_100363 3300025253 Bacteria 27818
133 Ga0209677_101139 3300025253 Bacteria 12420
134 Ga0209148_1000001 3300025254 Bacteria 2545271
135 Ga0209148_1000002 3300025254 Bacteria 2399500
136 Ga0209148_1000012 3300025254 Bacteria 1069303
137 Ga0209148_1000014 3300025254 Bacteria 925277
138 Ga0209148_1000058 3300025254 Bacteria 357482
139 Ga0209148_1001134 3300025254 Bacteria 15620
140 Ga0209759_1000211 3300025256 Bacteria 90002
141 Ga0209759_1001436 3300025256 Bacteria 13447
142 Ga0209759_1001635 3300025256 Bacteria 11838
143 Ga0209759_1002469 3300025256 Bacteria 8098
144 Ga0209759_1003934 3300025256 Bacteria 5720
145 Ga0209129_1003050 3300025258 Bacteria 7582
146 Ga0209129_1004016 3300025258 Bacteria 6033
147 Ga0209233_1000002 3300025261 Bacteria 2501366
148 Ga0209233_1000125 3300025261 Bacteria 217190
149 Ga0209233_1009349 3300025261 Bacteria 2988
150 Ga0209455_1000008 3300025272 Bacteria 1069303
151 Ga0209455_1000014 3300025272 Bacteria 806601
152 Ga0209455_1000018 3300025272 Bacteria 718034
153 Ga0209455_1000019 3300025272 Bacteria 705658
154 Ga0209455_1005366 3300025272 Bacteria 3978
155 Ga0209025_1036469 3300025294 Bacteria 2201
156 Ga0209758_1000862 3300025297 Bacteria 41975
157 Ga0209758_1015223 3300025297 Bacteria 4005
158 Ga0209256_1007070 3300025299 Bacteria 5674
159 Ga0207426_1115466 3300025302 Bacteria 671
160 Ga0207656_10054960 3300025321 Bacteria 1732
161 Ga0207647_10000005 3300025904 Bacteria 223490
162 Ga0207654_10576513 3300025911 Bacteria 801
163 Ga0207695_10000683 3300025913 Bacteria 66533
164 Ga0207695_10000897 3300025913 Bacteria 53743
165 Ga0207695_10001448 3300025913 Bacteria 39707
166 Ga0207695_10017664 3300025913 Bacteria 8287
167 Ga0207695_10047363 3300025913 Bacteria 4551
168 Ga0207671_10000011 3300025914 Bacteria 530349
169 Ga0207671_10009734 3300025914 Bacteria 7999
170 Ga0207671_10293031 3300025914 Bacteria 1285
171 Ga0207649_10078779 3300025920 Bacteria 2127
172 Ga0207706_10096574 3300025933 Bacteria 2599
173 Ga0207670_10108105 3300025936 Bacteria 1999
174 Ga0207711_10000994 3300025941 Bacteria 27213
175 Ga0207667_10000578 3300025949 Bacteria 47763
176 Ga0207667_10001421 3300025949 Bacteria 29981
177 Ga0207667_10585267 3300025949 Bacteria 1126
178 Ga0207712_10000246 3300025961 Bacteria 52868
179 Ga0207712_10380063 3300025961 Bacteria 1182
180 Ga0207640_10000091 3300025981 Bacteria 71621
181 Ga0207640_10002486 3300025981 Bacteria 9873
182 Ga0207658_10000174 3300025986 Bacteria 69513
183 Ga0207703_10022892 3300026035 Bacteria 4908
184 Ga0207639_10037774 3300026041 Bacteria 3589
185 Ga0207678_10001727 3300026067 Bacteria 20011
186 Ga0207678_10314571 3300026067 Bacteria 1346
187 Ga0207702_10000154 3300026078 Bacteria 80923
188 Ga0207702_10632344 3300026078 Bacteria 1052
189 Ga0207641_10043689 3300026088 Bacteria 3765
190 Ga0207674_10000217 3300026116 Bacteria 71594
191 Ga0207674_10052467 3300026116 Bacteria 4159
192 Ga0207698_10446745 3300026142 Bacteria 1247
193 Ga0268266_10029897 3300028379 Bacteria 4629
194 Ga0395899_0000076 3300037312 Bacteria 177673
195 Ga0395899_0122857 3300037312 Bacteria 1858
196 Ga0395900_0000024 3300037418 Bacteria 323480
197 Ga0395898_0000044 3300037466 Bacteria 298164
198 Ga0395898_0000311 3300037466 Bacteria 112412
199 Ga0395901_0019164 3300038443 Bacteria 6995
200 Ga0395901_0038678 3300038443 Bacteria 4934
201 Ga0451847_0861860 3300041503 Bacteria 2513
202 Ga0439449_0024535 3300042007 Bacteria 2254
203 Ga0466982_0000018 3300044672 Bacteria 113912
204 Ga0466965_0024505 3300044683 Bacteria 2919
205 Ga0466965_0084103 3300044683 Bacteria 1611
206 Ga0466966_0012070 3300044684 Bacteria 5724
207 Ga0466966_0683161 3300044684 Bacteria 618
208 Ga0466961_0000688 3300044693 Bacteria 21353
209 Ga0466961_0004138 3300044693 Bacteria 9059
210 Ga0466961_0017474 3300044693 Bacteria 4608
211 Ga0466964_0043181 3300044706 Bacteria 1828
212 Ga0466964_0064772 3300044706 Bacteria 1529
213 Ga0466971_0003730 3300044719 Bacteria 6519
214 Ga0466971_0013497 3300044719 Bacteria 3589
215 Ga0466971_0049263 3300044719 Bacteria 1895
216 Ga0466971_0268694 3300044719 Bacteria 815
217 Ga0466968_0115845 3300044735 Bacteria 1209
218 Ga0466970_0006501 3300044765 Bacteria 5840
219 Ga0466970_0062403 3300044765 Bacteria 1997
220 Ga0466970_0095564 3300044765 Bacteria 1616
221 Ga0466970_0214694 3300044765 Bacteria 1072
222 Ga0466957_0044591 3300044842 Bacteria 2687
223 Ga0466957_0096551 3300044842 Bacteria 1857
224 Ga0466957_0111387 3300044842 Bacteria 1736
225 Ga0466960_0016247 3300044901 Bacteria 3224
226 Ga0466959_0000082 3300045049 Bacteria 59664
227 Ga0466959_0078296 3300045049 Bacteria 2384
228 Ga0466959_0092840 3300045049 Bacteria 2166
229 Ga0466959_0226045 3300045049 Bacteria 1297
230 Ga0466958_0031411 3300045836 Bacteria 3156
231 Ga0495638_0000019 3300046460 Bacteria 384671
232 Ga0495638_0000082 3300046460 Bacteria 153986
233 Ga0495638_0000104 3300046460 Bacteria 135059
234 Ga0495650_0000443 3300046471 Bacteria 66631
235 Ga0495607_0000020 3300046501 Bacteria 164851
236 Ga0495606_0000113 3300046507 Bacteria 136805
237 Ga0495622_0009386 3300046557 Bacteria 4526
238 Ga0495633_0112446 3300046558 Bacteria 1262
239 Ga0495625_0277918 3300046660 Bacteria 1078
240 Ga0495649_0000812 3300046694 Bacteria 25187
241 Ga0495686_0000050 3300047472 Bacteria 269010
242 Ga0495686_0003286 3300047472 Bacteria 14136
243 Ga0496101_0012515 3300048904 Bacteria 5663
244 Ga0496103_0191044 3300048906 Bacteria 1316
245 Ga0496104_0007925 3300048907 Bacteria 9421
246 Ga0496104_0628208 3300048907 Bacteria 983
247 Ga0496105_0010444 3300048908 Bacteria 7299
248 Ga0496106_0044992 3300048909 Bacteria 3315
249 Ga0496112_0121705 3300048915 Bacteria 2580
250 Ga0496113_0001974 3300048916 Bacteria 11753
251 Ga0496114_0686713 3300048917 Bacteria 898
252 Ga0496115_0000247 3300048918 Bacteria 48853
253 Ga0496115_0000642 3300048918 Bacteria 26294
254 Ga0496115_0009183 3300048918 Bacteria 7340
255 Ga0496115_0022033 3300048918 Bacteria 4929
256 Ga0496115_0028959 3300048918 Bacteria 4345
257 Ga0496116_0044342 3300048919 Bacteria 3022
258 Ga0496116_0105097 3300048919 Bacteria 1676
259 Ga0496117_0007794 3300048920 Bacteria 10321
260 Ga0496117_0022078 3300048920 Bacteria 5114
261 Ga0496117_0061857 3300048920 Bacteria 2570
262 Ga0496117_0085933 3300048920 Bacteria 2045
263 Ga0496117_0095520 3300048920 Bacteria 1899
264 Ga0496118_0000576 3300048921 Bacteria 60656
265 Ga0496118_0001308 3300048921 Bacteria 37895
266 Ga0496118_0002040 3300048921 Bacteria 28541
267 Ga0496118_0002883 3300048921 Bacteria 22404
268 Ga0496118_0014166 3300048921 Bacteria 7478
269 Ga0496118_0041798 3300048921 Bacteria 3625
270 Ga0496118_0058634 3300048921 Bacteria 2875
271 Ga0496118_0275284 3300048921 Bacteria 940
272 Ga0496119_0000306 3300048922 Bacteria 68399
273 Ga0496119_0010142 3300048922 Bacteria 7958
274 Ga0496120_0000145 3300048923 Bacteria 119265
275 Ga0496120_0001207 3300048923 Bacteria 32733
276 Ga0496121_0000449 3300048924 Bacteria 81130
277 Ga0496121_0024343 3300048924 Bacteria 5793
278 Ga0496121_0142168 3300048924 Bacteria 1778
279 Ga0496121_0325198 3300048924 Bacteria 1034
280 Ga0496121_0371762 3300048924 Bacteria 945
281 Ga0496122_0000126 3300048925 Bacteria 178362
282 Ga0496122_0038207 3300048925 Bacteria 3851
283 Ga0496123_0000357 3300048926 Bacteria 85815
284 Ga0496123_0041844 3300048926 Bacteria 3170
285 Ga0496124_0102079 3300048927 Bacteria 2322
286 Ga0496125_0000239 3300048928 Bacteria 112926
287 Ga0496125_0011924 3300048928 Bacteria 8660
288 Ga0496125_0168696 3300048928 Bacteria 1475
289 Ga0496126_0003204 3300048929 Bacteria 20984
290 Ga0496126_0023689 3300048929 Bacteria 5946
291 Ga0496126_0043996 3300048929 Bacteria 4115
292 Ga0496126_0046020 3300048929 Bacteria 4006
293 Ga0496126_0197120 3300048929 Bacteria 1702
294 Ga0495678_022387 3300049459 Bacteria 2763
295 Ga0501031_0785683 3300049568 Bacteria 610
296 Ga0501032_0179067 3300049569 Bacteria 1388
297 Ga0501033_0016039 3300049570 Bacteria 5673
298 Ga0501034_0452690 3300049571 Bacteria 1201
299 Ga0501042_0158667 3300049578 Bacteria 1632
300 Ga0501043_0004971 3300049579 Bacteria 10756
301 Ga0501043_0096840 3300049579 Bacteria 2319
302 Ga0501043_0315482 3300049579 Bacteria 1192
303 Ga0501046_0030348 3300049580 Bacteria 4387
304 Ga0501047_0124665 3300049581 Bacteria 2456
305 Ga0501047_0661838 3300049581 Bacteria 863
306 Ga0501048_0090128 3300049582 Bacteria 2163
307 Ga0501070_0088438 3300049586 Bacteria 2564
308 Ga0501275_000098 3300049772 Bacteria 9101
309 Ga0501035_0002732 3300049822 Bacteria 17120
310 Ga0501035_0038459 3300049822 Bacteria 4331
311 Ga0501035_0150042 3300049822 Bacteria 2023
312 Ga0501044_0036617 3300049823 Bacteria 5133
313 Ga0501044_0042642 3300049823 Bacteria 4718
314 Ga0501044_0057135 3300049823 Bacteria 4004
315 Ga0501044_0239749 3300049823 Bacteria 1757
316 Ga0500597_000127 3300053120 Bacteria 15671
317 Ga0500634_0000887 3300053161 Bacteria 10674
318 Ga0466962_0009105 3300061719 Bacteria 4755
319 Ga0466962_0011224 3300061719 Bacteria 4314
320 2595449191 2593339238 Bacteria 4182970
321 2595450477 2593339239 Bacteria 4124669
322 2644477830 2643221685 Bacteria 3673288
323 2739226372 2738543009 Bacteria 4944499
324 2739732432 2739367700 Bacteria 4747630
325 2884342410 2884338543 Bacteria 4610696
326 2884411661 2884411467 Bacteria 5246714
327 2928965110 2928963466 Bacteria 5165703
328 2941474968 2941471342 Bacteria 5018624
329 Ga0439459_0011646
330 JGI24736J21556_1000945
331 JGI24740J21852_10043095
332 JGI24737J22298_10007214
333 JGI24735J21928_10005341
334 JGI24735J21928_10043711
335 JGI24735J21928_10044892
336 JGI25156J39149_1016672
337 JGI25162J39368_1000666
338 JGI25162J39368_1001197
339 JGI25157J39369_1000579
340 JGI25157J39369_1001556
341 JGI25157J39369_1022196
342 JGI25163J39215_1000216
343 JGI25164J39214_1000030
344 JGI25164J39214_1000093
345 JGI25152J39213_1019278
346 JGI25165J46597_1000057
347 JGI25165J46597_1000759
348 rootH1_10033986
349 rootH2_10032037
350 rootH2_10214272
351 rootL2_10053837
352 rootH1_10152318
353 Ga0006562J51391_1038928
354 Ga0006562J51391_1038931
355 Ga0055538_1000881
356 Ga0055539_1002887
357 Ga0055533_1002229
358 Ga0055525_1000093
359 Ga0055527_1000245
360 Ga0055527_1000491
361 Ga0055527_1004210
362 Ga0055535_1000152
363 Ga0055535_1000901
364 Ga0055535_1001247
365 Ga0055535_1002739
366 Ga0055542_1000544
367 Ga0055542_1000753
368 Ga0055542_1000769
369 Ga0055542_1001155
370 Ga0055542_1001236
371 Ga0055529_1000082
372 Ga0055529_1000588
373 Ga0055529_1000941
374 Ga0055529_1000982
375 Ga0065165_1006031
376 Ga0070689_100000610
377 Ga0070661_100204277
378 Ga0070663_100000263
379 Ga0070663_100038583
380 Ga0070663_100084923
381 Ga0070662_100418885
382 Ga0068853_100000138
383 Ga0068853_100000391
384 Ga0070665_100017248
385 Ga0068855_100005293
386 Ga0068855_100010686
387 Ga0068855_100069657
388 Ga0070664_100238422
389 Ga0068857_100002273
390 Ga0068857_100041080
391 Ga0068854_100002661
392 Ga0068854_100006581
393 Ga0068856_100007414
394 Ga0068856_100467310
395 Ga0068856_100733378
396 Ga0068852_100066732
397 Ga0068851_10000797
398 Ga0068863_100299164
399 Ga0068858_100097602
400 Ga0068860_100029071
401 Ga0105240_10001218
402 Ga0105240_10001540
403 Ga0105240_10004902
404 Ga0105240_10029602
405 Ga0105240_10062132
406 Ga0105240_10291786
407 Ga0105241_10567277
408 Ga0105248_10000693
409 Ga0105237_10000084
410 Ga0105237_10005674
411 Ga0105237_10116457
412 Ga0105237_10293874
413 Ga0105238_10179473
414 Ga0105249_10000158
415 Ga0105029_100382
416 Ga0105239_10000174
417 Ga0105239_10025526
418 Ga0105239_11014096
419 Ga0157314_1000668
420 Ga0157373_10106471
421 Ga0157370_10060736
422 Ga0157369_10091186
423 Ga0163162_11246943
424 Ga0163163_10316890
425 Ga0157376_10583071
426 Ga0182005_1016412
427 Ga0183369_1013
428 Ga0183368_1003
429 Ga0209435_108470
430 Ga0209760_101067
431 Ga0209784_100011
432 Ga0209674_100012
433 Ga0209674_100107
434 Ga0209674_100375
435 Ga0209674_100892
436 Ga0209672_100005
437 Ga0209672_100055
438 Ga0209672_100124
439 Ga0209672_100621
440 Ga0209672_103864
441 Ga0209563_100045
442 Ga0207427_100026
443 Ga0207427_100053
444 Ga0209437_100108
445 Ga0209437_100241
446 Ga0209437_100340
447 Ga0209437_101214
448 Ga0209258_100006
449 Ga0209258_100012
450 Ga0209258_100027
451 Ga0209258_100055
452 Ga0209258_100892
453 Ga0209646_1000776
454 Ga0209646_1002993
455 Ga0209026_1000018
456 Ga0209026_1000172
457 Ga0209026_1002761
458 Ga0209026_1004676
459 Ga0209026_1018271
460 Ga0209677_100363
461 Ga0209677_101139
462 Ga0209148_1000001
463 Ga0209148_1000002
464 Ga0209148_1000012
465 Ga0209148_1000014
466 Ga0209148_1000058
467 Ga0209148_1001134
468 Ga0209759_1000211
469 Ga0209759_1001436
470 Ga0209759_1001635
471 Ga0209759_1002469
472 Ga0209759_1003934
473 Ga0209129_1003050
474 Ga0209129_1004016
475 Ga0209233_1000002
476 Ga0209233_1000125
477 Ga0209233_1009349
478 Ga0209455_1000008
479 Ga0209455_1000014
480 Ga0209455_1000018
481 Ga0209455_1000019
482 Ga0209455_1005366
483 Ga0209025_1036469
484 Ga0209758_1000862
485 Ga0209758_1015223
486 Ga0209256_1007070
487 Ga0207426_1115466
488 Ga0207656_10054960
489 Ga0207647_10000005
490 Ga0207654_10576513
491 Ga0207695_10000683
492 Ga0207695_10000897
493 Ga0207695_10001448
494 Ga0207695_10017664
495 Ga0207695_10047363
496 Ga0207671_10000011
497 Ga0207671_10009734
498 Ga0207671_10293031
499 Ga0207649_10078779
500 Ga0207706_10096574
501 Ga0207670_10108105
502 Ga0207711_10000994
503 Ga0207667_10000578
504 Ga0207667_10001421
505 Ga0207667_10585267
506 Ga0207712_10000246
507 Ga0207712_10380063
508 Ga0207640_10000091
509 Ga0207640_10002486
510 Ga0207658_10000174
511 Ga0207703_10022892
512 Ga0207639_10037774
513 Ga0207678_10001727
514 Ga0207678_10314571
515 Ga0207702_10000154
516 Ga0207702_10632344
517 Ga0207641_10043689
518 Ga0207674_10000217
519 Ga0207674_10052467
520 Ga0207698_10446745
521 Ga0268266_10029897
522 Ga0395899_0000076
523 Ga0395899_0122857
524 Ga0395900_0000024
525 Ga0395898_0000044
526 Ga0395898_0000311
527 Ga0395901_0019164
528 Ga0395901_0038678
529 Ga0451847_0861860
530 Ga0439449_0024535
531 Ga0466982_0000018
532 Ga0466965_0024505
533 Ga0466965_0084103
534 Ga0466966_0012070
535 Ga0466966_0683161
536 Ga0466961_0000688
537 Ga0466961_0004138
538 Ga0466961_0017474
539 Ga0466964_0043181
540 Ga0466964_0064772
541 Ga0466971_0003730
542 Ga0466971_0013497
543 Ga0466971_0049263
544 Ga0466971_0268694
545 Ga0466968_0115845
546 Ga0466970_0006501
547 Ga0466970_0062403
548 Ga0466970_0095564
549 Ga0466970_0214694
550 Ga0466957_0044591
551 Ga0466957_0096551
552 Ga0466957_0111387
553 Ga0466960_0016247
554 Ga0466959_0000082
555 Ga0466959_0078296
556 Ga0466959_0092840
557 Ga0466959_0226045
558 Ga0466958_0031411
559 Ga0495638_0000019
560 Ga0495638_0000082
561 Ga0495638_0000104
562 Ga0495650_0000443
563 Ga0495607_0000020
564 Ga0495606_0000113
565 Ga0495622_0009386
566 Ga0495633_0112446
567 Ga0495625_0277918
568 Ga0495649_0000812
569 Ga0495686_0000050
570 Ga0495686_0003286
571 Ga0496101_0012515
572 Ga0496103_0191044
573 Ga0496104_0007925
574 Ga0496104_0628208
575 Ga0496105_0010444
576 Ga0496106_0044992
577 Ga0496112_0121705
578 Ga0496113_0001974
579 Ga0496114_0686713
580 Ga0496115_0000247
581 Ga0496115_0000642
582 Ga0496115_0009183
583 Ga0496115_0022033
584 Ga0496115_0028959
585 Ga0496116_0044342
586 Ga0496116_0105097
587 Ga0496117_0007794
588 Ga0496117_0022078
589 Ga0496117_0061857
590 Ga0496117_0085933
591 Ga0496117_0095520
592 Ga0496118_0000576
593 Ga0496118_0001308
594 Ga0496118_0002040
595 Ga0496118_0002883
596 Ga0496118_0014166
597 Ga0496118_0041798
598 Ga0496118_0058634
599 Ga0496118_0275284
600 Ga0496119_0000306
601 Ga0496119_0010142
602 Ga0496120_0000145
603 Ga0496120_0001207
604 Ga0496121_0000449
605 Ga0496121_0024343
606 Ga0496121_0142168
607 Ga0496121_0325198
608 Ga0496121_0371762
609 Ga0496122_0000126
610 Ga0496122_0038207
611 Ga0496123_0000357
612 Ga0496123_0041844
613 Ga0496124_0102079
614 Ga0496125_0000239
615 Ga0496125_0011924
616 Ga0496125_0168696
617 Ga0496126_0003204
618 Ga0496126_0023689
619 Ga0496126_0043996
620 Ga0496126_0046020
621 Ga0496126_0197120
622 Ga0495678_022387
623 Ga0501031_0785683
624 Ga0501032_0179067
625 Ga0501033_0016039
626 Ga0501034_0452690
627 Ga0501042_0158667
628 Ga0501043_0004971
629 Ga0501043_0096840
630 Ga0501043_0315482
631 Ga0501046_0030348
632 Ga0501047_0124665
633 Ga0501047_0661838
634 Ga0501048_0090128
635 Ga0501070_0088438
636 Ga0501275_000098
637 Ga0501035_0002732
638 Ga0501035_0038459
639 Ga0501035_0150042
640 Ga0501044_0036617
641 Ga0501044_0042642
642 Ga0501044_0057135
643 Ga0501044_0239749
644 Ga0500597_000127
645 Ga0500634_0000887
646 Ga0466962_0009105
647 Ga0466962_0011224
648 2595449191
649 2595450477
650 2644477830
651 2739226372
652 2739732432
653 2884342410
654 2884411661
655 2928965110
656 2941474968

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

5

183

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ij5-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase from <i>hydrogenobacter thermophilus</i> tk-6 0.9256 2 174
4ij6-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from <i>hydrogenobacter thermophilus</i> tk-6 in complex with l-phosphoserine 0.9196 2 179
4ij6-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from <i>hydrogenobacter thermophilus</i> tk-6 in complex with l-phosphoserine 0.91 2 179
6s2q-assembly2.cif.gz_C mycobacterial hydrolase 1 0.8983 2 174
4qih-assembly1.cif.gz_A the structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c complexes with vo3 0.8976 2 176
ID Description Score Start End Superfamily
4ij6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9196 2 179 3.40.50.1240
4ij6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.91 2 179 3.40.50.1240
af_P0A7A2_1_211_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8991 1 179 3.40.50.1240
af_P9WLH5_165_364_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8979 1 174 3.40.50.1240
af_P0A7A2_1_211_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8944 1 179 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A7W5J0Z6-F1-model_v4 Alpha-ribazole phosphatase (EC 3.1.3.73) 0.9992 3 177 GO:0005737
GO:0043755
AF-A0A561H5X2-F1-model_v4 deleted 0.9966 1 179
AF-A0A1J1E6D9-F1-model_v4 deleted 0.9966 2 179
AF-B0RPV0-F1-model_v4 Alpha-ribazole phosphatase (EC 3.1.3.73) 0.9952 2 178 GO:0005737
GO:0043755
AF-A0A1J1E6D9-F1-model_v4 deleted 0.9855 2 179

Map