F409378

General Info

Members Datasets Scaffolds Average Seq Length
328 239 656 325

Family's Representative Sequence

Representative Sequence 3300046461|Ga0495641_0003545|Ga0495641_0003545_2967_4067
Length 366
Sequence VEECLSLYAGLYRAYSLGPYLSQLFALSYRAWSFQLTTLFKMKAIVIERFGGPECLVVQDVPLPEPKQGEVVIRIKAFGVNHAEMHMRRGEWAEWVPISGIECVGMVHRCPGGEFEEGTPVASLMGGLGRTISGSYAEFTRAKASNVVPLGPATLDLRWDQLAALPESYATAWTCLFRNLEIAAGQRLLIRGGTSAFGRAAINLAVQAGVKVTSTTRSEDRVVQLKSLGVEAVLIEGPELSERVQEKFDAVLELIGNSTVIDSLKLVHRGGRVCLAGWLGGLAPISDFNPLLQMASGVHLSFFGSFVFGTPEFPLSDIPFQDIVAMVARKQFNADHWKVFPFQEIQEAHRLMENNEAHGKIVVTVD

Samples

Sample ID Description Type Environment
1 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
67 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
68 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
74 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
100 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
101 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
102 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
105 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
106 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
107 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
108 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
109 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
110 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
112 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
116 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
117 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
118 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
119 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
120 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
121 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
122 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
123 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
127 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
132 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
133 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
134 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
135 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
136 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
137 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
138 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
139 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
140 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
141 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
142 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
145 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
146 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
147 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
148 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
149 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
150 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
155 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
156 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
159 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
160 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
163 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
164 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
167 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
168 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
169 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
170 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
177 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
178 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
179 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
182 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
188 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
189 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
203 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
204 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
207 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
208 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
209 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
210 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
211 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
212 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
213 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
214 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
215 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
216 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
217 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
218 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
219 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
220 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
221 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
222 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
223 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
224 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
225 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
226 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
227 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
228 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
229 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
230 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
231 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
232 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
233 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
234 8002775197 Frankia nepalensis CN7 Isolate Nodule
235 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
236 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
237 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
238 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
239 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.77
Metatranscriptomes 0
Isolates 8.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.54
Nodule 6.4
Rhizoplane 0.61
Rhizosphere 79.57
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495641_0003545 3300046461 Eukaryota 11600
2 JGI24741J21665_1000095 3300001915 Bacteria 22931
3 JGI24740J21852_10000562 3300001979 Bacteria 15954
4 JGI25156J39149_1007937 3300002705 Bacteria 2728
5 JGI25159J45721_1001461 3300002987 Bacteria 9740
6 rootH1_10030891 3300003316 Bacteria 2527
7 rootH2_10029516 3300003320 Bacteria 26870
8 Ga0055538_1002454 3300003751 Bacteria 2713
9 Ga0055539_1000095 3300003752 Bacteria 102639
10 Ga0055539_1000198 3300003752 Bacteria 48821
11 Ga0055533_1000008 3300003756 Bacteria 575861
12 Ga0055533_1003885 3300003756 Bacteria 2848
13 Ga0055525_1000281 3300003759 Bacteria 46722
14 Ga0055541_1004348 3300003841 Bacteria 2578
15 Ga0070666_10046890 3300005335 Bacteria 2900
16 Ga0070660_100049920 3300005339 Bacteria 3218
17 Ga0070661_100000301 3300005344 Bacteria 39891
18 Ga0070661_100188820 3300005344 Bacteria 1571
19 Ga0070668_100013220 3300005347 Bacteria 6157
20 Ga0070673_100071927 3300005364 Bacteria 2780
21 Ga0070673_100162669 3300005364 Unclassified 1899
22 Ga0070709_10017593 3300005434 Bacteria 4103
23 Ga0070714_100401543 3300005435 Bacteria 1295
24 Ga0070713_100434580 3300005436 Bacteria 1230
25 Ga0070710_10066882 3300005437 Bacteria 2061
26 Ga0070663_100000025 3300005455 Bacteria 101896
27 Ga0070663_100125960 3300005455 Bacteria 1940
28 Ga0070678_100086688 3300005456 Bacteria 2389
29 Ga0070699_100002556 3300005518 Bacteria 16341
30 Ga0070697_100173498 3300005536 Bacteria 1826
31 Ga0070697_100178276 3300005536 Bacteria 1800
32 Ga0068853_100006217 3300005539 Bacteria 9458
33 Ga0068855_100126946 3300005563 Bacteria 2915
34 Ga0070664_100000020 3300005564 Bacteria 119858
35 Ga0068857_100150880 3300005577 Bacteria 2105
36 Ga0068856_100053049 3300005614 Bacteria 3999
37 Ga0068856_100277413 3300005614 Bacteria 1693
38 Ga0070702_100031655 3300005615 Bacteria 2897
39 Ga0068859_100179153 3300005617 Bacteria 2202
40 Ga0068864_100133290 3300005618 Bacteria 2234
41 Ga0068863_100110774 3300005841 Bacteria 2614
42 Ga0068862_100120833 3300005844 Bacteria 2309
43 Ga0081455_10007078 3300005937 Bacteria 11901
44 Ga0081455_10090105 3300005937 Bacteria 2488
45 Ga0081540_1003695 3300005983 Bacteria 11992
46 Ga0081540_1050335 3300005983 Bacteria 2070
47 Ga0075365_10056339 3300006038 Bacteria 2613
48 Ga0070715_10015037 3300006163 Bacteria 2879
49 Ga0070716_100264715 3300006173 Bacteria 1178
50 Ga0070716_100286309 3300006173 Bacteria 1140
51 Ga0070712_100081234 3300006175 Bacteria 2348
52 Ga0097621_100011572 3300006237 Bacteria 6503
53 Ga0097621_100043625 3300006237 Bacteria 3615
54 Ga0075430_100000103 3300006846 Bacteria 51038
55 Ga0075430_100301746 3300006846 Bacteria 1325
56 Ga0075431_100047408 3300006847 Bacteria 4430
57 Ga0075431_100159906 3300006847 Bacteria 2316
58 Ga0075431_100305820 3300006847 Bacteria 1606
59 Ga0075433_10004526 3300006852 Bacteria 10842
60 Ga0075434_100002179 3300006871 Bacteria 17077
61 Ga0075434_100041910 3300006871 Bacteria 4537
62 Ga0075429_100083425 3300006880 Bacteria 2786
63 Ga0075436_100008918 3300006914 Bacteria 6866
64 Ga0097620_100179152 3300006931 Bacteria 2202
65 Ga0075435_100172842 3300007076 Bacteria 1823
66 Ga0105240_10440037 3300009093 Bacteria 1461
67 Ga0111539_10325442 3300009094 Bacteria 1789
68 Ga0105245_10121116 3300009098 Bacteria 2444
69 Ga0114129_10003672 3300009147 Bacteria 21588
70 Ga0114129_10013512 3300009147 Bacteria 11636
71 Ga0114129_10209027 3300009147 Bacteria 2639
72 Ga0105248_10017622 3300009177 Bacteria 7878
73 Ga0105248_10028706 3300009177 Bacteria 6200
74 Ga0157373_10011170 3300013100 Bacteria 6608
75 Ga0157371_10000082 3300013102 Bacteria 149981
76 Ga0157370_10000423 3300013104 Bacteria 53080
77 Ga0157369_10051414 3300013105 Bacteria 4459
78 Ga0157374_10015445 3300013296 Bacteria 6697
79 Ga0157378_10040549 3300013297 Bacteria 4129
80 Ga0163162_10036214 3300013306 Bacteria 4916
81 Ga0157372_10000122 3300013307 Bacteria 83503
82 Ga0163163_10071488 3300014325 Bacteria 3458
83 Ga0157376_10006945 3300014969 Bacteria 8027
84 Ga0213873_10013951 3300021358 Bacteria 1773
85 Ga0213872_10006196 3300021361 Bacteria 6039
86 Ga0213872_10006306 3300021361 Bacteria 5978
87 Ga0209784_100055 3300025224 Bacteria 177507
88 Ga0209784_100466 3300025224 Bacteria 16871
89 Ga0209566_100002 3300025225 Bacteria 2614868
90 Ga0209674_100015 3300025226 Bacteria 697299
91 Ga0209674_100090 3300025226 Bacteria 175563
92 Ga0209563_100017 3300025230 Bacteria 796449
93 Ga0209563_100095 3300025230 Bacteria 165592
94 Ga0209563_100198 3300025230 Bacteria 33000
95 Ga0209677_100037 3300025253 Bacteria 286702
96 Ga0209677_100069 3300025253 Bacteria 144999
97 Ga0209759_1000546 3300025256 Bacteria 38996
98 Ga0209759_1010266 3300025256 Bacteria 2756
99 Ga0209759_1015604 3300025256 Bacteria 1953
100 Ga0207426_1038755 3300025302 Bacteria 1499
101 Ga0207688_10022796 3300025901 Bacteria 3429
102 Ga0207685_10026547 3300025905 Bacteria 2016
103 Ga0207684_10042604 3300025910 Bacteria 3848
104 Ga0207684_10111646 3300025910 Bacteria 2340
105 Ga0207695_10377586 3300025913 Bacteria 1303
106 Ga0207693_10195988 3300025915 Bacteria 1589
107 Ga0207663_10034967 3300025916 Bacteria 3010
108 Ga0207657_10075456 3300025919 Bacteria 2845
109 Ga0207649_10000065 3300025920 Bacteria 94778
110 Ga0207687_10024189 3300025927 Bacteria 4055
111 Ga0207700_10168001 3300025928 Bacteria 1827
112 Ga0207664_10455706 3300025929 Bacteria 1142
113 Ga0207690_10028947 3300025932 Bacteria 3516
114 Ga0207665_10004853 3300025939 Bacteria 8952
115 Ga0207665_10139496 3300025939 Bacteria 1727
116 Ga0207689_10045660 3300025942 Bacteria 3621
117 Ga0207679_10000028 3300025945 Bacteria 187787
118 Ga0207679_10080306 3300025945 Bacteria 2490
119 Ga0207651_10031448 3300025960 Bacteria 3393
120 Ga0207668_10008929 3300025972 Bacteria 5995
121 Ga0207639_10133149 3300026041 Bacteria 2061
122 Ga0207678_10000136 3300026067 Bacteria 61264
123 Ga0207678_10004789 3300026067 Bacteria 12146
124 Ga0207702_10000149 3300026078 Bacteria 81592
125 Ga0207702_10574806 3300026078 Bacteria 1104
126 Ga0207676_10053739 3300026095 Bacteria 3153
127 Ga0207674_10323681 3300026116 Bacteria 1491
128 Ga0207674_10372623 3300026116 Bacteria 1380
129 Ga0207683_10074757 3300026121 Bacteria 2998
130 Ga0207428_10290922 3300027907 Bacteria 1211
131 Ga0307517_10165535 3300028786 Eukaryota 1470
132 Ga0373926_0018747 3300035083 Bacteria 2382
133 Ga0373934_0001299 3300035086 Bacteria 9100
134 Ga0373923_0002539 3300035111 Bacteria 5643
135 Ga0373936_0005503 3300035113 Bacteria 4778
136 Ga0373936_0006741 3300035113 Bacteria 4321
137 Ga0373953_0008528 3300035117 Bacteria 3485
138 Ga0373953_0021818 3300035117 Bacteria 2407
139 Ga0373954_0007777 3300035118 Bacteria 4691
140 Ga0373954_0024699 3300035118 Bacteria 2741
141 Ga0373956_0006192 3300035119 Bacteria 4786
142 Ga0373957_0002784 3300035120 Bacteria 5036
143 Ga0373955_0004202 3300035172 Bacteria 6354
144 Ga0373924_0007436 3300035410 Bacteria 3956
145 Ga0373935_0023905 3300035692 Bacteria 3755
146 Ga0373935_0167448 3300035692 Bacteria 1501
147 Ga0373927_0000681 3300035695 Bacteria 25866
148 Ga0373933_0002554 3300035724 Bacteria 10210
149 Ga0373933_0005054 3300035724 Bacteria 7197
150 Ga0373937_0014930 3300036401 Bacteria 6859
151 Ga0373937_0037885 3300036401 Bacteria 4394
152 Ga0395905_0000484 3300037471 Bacteria 54907
153 Ga0436361_0234917 3300039447 Bacteria 14328
154 Ga0436361_0608376 3300039447 Bacteria 19212
155 Ga0436361_0655142 3300039447 Bacteria 1953
156 Ga0436361_1092317 3300039447 Bacteria 1255
157 Ga0439461_0007096 3300041410 Bacteria 1973
158 Ga0439465_0047137 3300041413 Bacteria 1404
159 Ga0439431_0008242 3300041997 Bacteria 2339
160 Ga0466972_0006924 3300044658 Bacteria 5685
161 Ga0466966_0002962 3300044684 Bacteria 11175
162 Ga0466961_0004789 3300044693 Bacteria 8521
163 Ga0466964_0027080 3300044706 Bacteria 2248
164 Ga0466970_0017793 3300044765 Bacteria 3674
165 Ga0466959_0027154 3300045049 Bacteria 4246
166 Ga0466959_0031575 3300045049 Bacteria 3919
167 Ga0466967_0036695 3300045976 Bacteria 4187
168 Ga0495592_0001819 3300046454 Bacteria 14986
169 Ga0495592_0099783 3300046454 Bacteria 2070
170 Ga0495591_003781 3300046458 Bacteria 7651
171 Ga0495629_0008830 3300046459 Bacteria 7412
172 Ga0495641_0009415 3300046461 Bacteria 5802
173 Ga0495651_0007548 3300046462 Bacteria 8319
174 Ga0495651_0023758 3300046462 Bacteria 4765
175 Ga0495651_0054388 3300046462 Eukaryota 3079
176 Ga0495580_0004987 3300046472 Bacteria 11082
177 Ga0495580_0006191 3300046472 Bacteria 9784
178 Ga0495580_0031706 3300046472 Bacteria 3817
179 Ga0495580_0111660 3300046472 Bacteria 1898
180 Ga0495582_0082424 3300046473 Bacteria 1787
181 Ga0495662_0013524 3300046476 Bacteria 3973
182 Ga0495662_0028414 3300046476 Bacteria 2699
183 Ga0495664_0012693 3300046477 Bacteria 4771
184 Ga0495664_0035470 3300046477 Bacteria 2937
185 Ga0495584_0025245 3300046491 Bacteria 3013
186 Ga0495596_0012280 3300046500 Bacteria 3671
187 Ga0495607_0080098 3300046501 Bacteria 1797
188 Ga0495583_0000324 3300046506 Bacteria 75413
189 Ga0495606_0000487 3300046507 Bacteria 64941
190 Ga0495608_0001297 3300046511 Bacteria 17779
191 Ga0495608_0023894 3300046511 Bacteria 4181
192 Ga0495608_0120055 3300046511 Eukaryota 1686
193 Ga0495608_0187056 3300046511 Eukaryota 1309
194 Ga0495618_0001439 3300046514 Bacteria 15961
195 Ga0495618_0024796 3300046514 Eukaryota 3718
196 Ga0495618_0049214 3300046514 Bacteria 2661
197 Ga0495620_0036898 3300046515 Eukaryota 2182
198 Ga0495628_0006405 3300046516 Bacteria 10282
199 Ga0495628_0014087 3300046516 Bacteria 6712
200 Ga0495630_0000680 3300046517 Bacteria 24316
201 Ga0495630_0009569 3300046517 Bacteria 6968
202 Ga0495648_0002735 3300046524 Bacteria 15929
203 Ga0495666_0000120 3300046526 Bacteria 32561
204 Ga0495666_0008970 3300046526 Bacteria 5004
205 Ga0495652_0000053 3300046529 Eukaryota 117054
206 Ga0495652_0010056 3300046529 Eukaryota 8577
207 Ga0495652_0084959 3300046529 Bacteria 2602
208 Ga0495665_0005605 3300046531 Bacteria 6765
209 Ga0495640_0004132 3300046533 Bacteria 11616
210 Ga0495640_0044716 3300046533 Bacteria 3077
211 Ga0495586_0050930 3300046535 Bacteria 2240
212 Ga0495587_0002451 3300046536 Bacteria 12378
213 Ga0495587_0006299 3300046536 Bacteria 7742
214 Ga0495645_0010992 3300046543 Eukaryota 6359
215 Ga0495645_0065319 3300046543 Bacteria 2632
216 Ga0495622_0035604 3300046557 Bacteria 2321
217 Ga0495667_0008689 3300046559 Bacteria 6895
218 Ga0495668_0015708 3300046616 Bacteria 4413
219 Ga0495668_0135124 3300046616 Bacteria 1350
220 Ga0495634_0013209 3300046642 Bacteria 5969
221 Ga0495634_0039485 3300046642 Bacteria 3213
222 Ga0495611_0028480 3300046648 Eukaryota 2446
223 Ga0495625_0008790 3300046660 Bacteria 8553
224 Ga0495635_0007446 3300046663 Bacteria 7640
225 Ga0495661_0002143 3300046665 Bacteria 15471
226 Ga0495657_0021121 3300046675 Bacteria 4673
227 Ga0495657_0096933 3300046675 Eukaryota 1884
228 Ga0495599_0008117 3300046678 Bacteria 6375
229 Ga0495599_0010321 3300046678 Bacteria 5713
230 Ga0495623_0001410 3300046679 Eukaryota 16310
231 Ga0495646_0012954 3300046680 Bacteria 5302
232 Ga0495647_0006453 3300046681 Bacteria 3884
233 Ga0495658_0066405 3300046683 Bacteria 2083
234 Ga0495613_0002556 3300046689 Bacteria 13692
235 Ga0495613_0044380 3300046689 Bacteria 3289
236 Ga0495624_0006337 3300046690 Bacteria 8408
237 Ga0495624_0037871 3300046690 Eukaryota 3101
238 Ga0495671_0048255 3300046692 Bacteria 2125
239 Ga0495649_0000207 3300046694 Bacteria 51510
240 Ga0495589_0004958 3300046794 Bacteria 7052
241 Ga0495600_0001350 3300046809 Bacteria 13532
242 Ga0495600_0008438 3300046809 Bacteria 6328
243 Ga0495604_0014415 3300047317 Bacteria 6305
244 Ga0495604_0033153 3300047317 Bacteria 4089
245 Ga0495674_0021493 3300047319 Bacteria 5968
246 Ga0495674_0085728 3300047319 Bacteria 2697
247 Ga0495676_0007408 3300047321 Bacteria 10070
248 Ga0495680_0037221 3300047322 Bacteria 3899
249 Ga0495680_0040854 3300047322 Bacteria 3691
250 Ga0495680_0053803 3300047322 Eukaryota 3130
251 Ga0495683_0004809 3300047323 Bacteria 7576
252 Ga0495683_0043337 3300047323 Bacteria 2266
253 Ga0495675_0014478 3300047444 Bacteria 4985
254 Ga0495675_0247893 3300047444 Bacteria 1070
255 Ga0495679_001038 3300047446 Bacteria 16983
256 Ga0495673_0005575 3300047469 Bacteria 7587
257 Ga0495684_0007374 3300047471 Bacteria 8524
258 Ga0495686_0001489 3300047472 Bacteria 25384
259 Ga0495593_0001773 3300047673 Bacteria 12782
260 Ga0495602_0001531 3300048088 Eukaryota 23000
261 Ga0495602_0008341 3300048088 Eukaryota 10823
262 Ga0495602_0025460 3300048088 Eukaryota 5726
263 Ga0495602_0128577 3300048088 Bacteria 2024
264 Ga0495614_0004342 3300048089 Bacteria 6391
265 Ga0496106_0077201 3300048909 Bacteria 2554
266 Ga0496112_0081541 3300048915 Bacteria 3199
267 Ga0496117_0137436 3300048920 Bacteria 1470
268 Ga0496118_0010703 3300048921 Bacteria 9043
269 Ga0496118_0024599 3300048921 Bacteria 5193
270 Ga0496121_0000031 3300048924 Bacteria 384119
271 Ga0496121_0026825 3300048924 Bacteria 5412
272 Ga0496125_0015121 3300048928 Bacteria 7483
273 Ga0496126_0000248 3300048929 Bacteria 116557
274 Ga0495682_0011031 3300049460 Bacteria 3483
275 Ga0501047_0039140 3300049581 Bacteria 4587
276 nmdc:mga05p37_287_c1 3300050507 Bacteria 52760
277 nmdc:mga05p37_47997_c1 3300050507 Bacteria 5251
278 nmdc:mga05p37_524828_c1 3300050507 Bacteria 1354
279 nmdc:mga09592_36965_c1 3300050508 Bacteria 4092
280 nmdc:mga06r32_133646_c1 3300050510 Bacteria 2455
281 nmdc:mga06r32_16650_c1 3300050510 Bacteria 6700
282 nmdc:mga06r32_99223_c1 3300050510 Bacteria 2856
283 nmdc:mga08y16_312459_c1 3300050511 Bacteria 1618
284 nmdc:mga0n895_3093_c1 3300050512 Bacteria 13247
285 nmdc:mga0n895_624138_c1 3300050512 Bacteria 1078
286 nmdc:mga0n895_82262_c1 3300050512 Bacteria 3209
287 nmdc:mga0rr50_580_c1 3300050513 Bacteria 19575
288 nmdc:mga08x19_3433_c1 3300050514 Bacteria 9446
289 nmdc:mga0a205_234875_c1 3300050515 Bacteria 1716
290 nmdc:mga0a205_5267_c1 3300050515 Bacteria 11649
291 Ga0495601_0091723 3300053077 Bacteria 1956
292 Ga0500635_0000041 3300053080 Bacteria 90865
293 Ga0495595_0016594 3300053084 Bacteria 3154
294 Ga0495619_0013478 3300053085 Bacteria 5150
295 Ga0500578_0074417 3300053086 Bacteria 2164
296 Ga0500651_0003992 3300053093 Bacteria 8182
297 Ga0500555_054662 3300053103 Bacteria 1085
298 Ga0500595_024699 3300053119 Bacteria 2094
299 Ga0500642_0012984 3300053130 Bacteria 3043
300 Ga0500616_0053332 3300053153 Bacteria 2122
301 Ga0500661_003427 3300055283 Bacteria 2976
302 2510247223 2510065045 Bacteria 7761063
303 2513894975 2513237141 Bacteria 8496279
304 2719637760 2718217991 Bacteria 7829542
305 2808967809 2808606384 Bacteria 8474373
306 2809002640 2808606390 Bacteria 8476311
307 2809009918 2808606391 Bacteria 8308166
308 2884338576 2884338543 Bacteria 4610696
309 2884698378 2884693830 Bacteria 11273186
310 2895450973 2895442618 Bacteria 11027144
311 2932788015 2932784394 Bacteria 9704911
312 2932832849 2932828146 Bacteria 9745859
313 2935640658 2935638405 Bacteria 10015038
314 2935668851 2935665750 Bacteria 9571747
315 2935696871 2935694250 Bacteria 9291695
316 2935709038 2935703347 Bacteria 10242284
317 2935804768 2935801545 Bacteria 9301974
318 2935832165 2935827899 Bacteria 10038562
319 2935841005 2935837841 Bacteria 9454360
320 2935995781 2935992306 Bacteria 9802711
321 2936005692 2936002035 Bacteria 9362176
322 2941541733 2941538514 Bacteria 9402094
323 8002779042 8002775197 Bacteria 10728764
324 8016517363 8016511872 Bacteria 9921665
325 8017059243 8017057580 Bacteria 10023680
326 8019576389 8019576017 Bacteria 10049540
327 8019594264 8019586578 Bacteria 10212056
328 8019611216 8019608314 Bacteria 10042931
329 Ga0495641_0003545
330 JGI24741J21665_1000095
331 JGI24740J21852_10000562
332 JGI25156J39149_1007937
333 JGI25159J45721_1001461
334 rootH1_10030891
335 rootH2_10029516
336 Ga0055538_1002454
337 Ga0055539_1000095
338 Ga0055539_1000198
339 Ga0055533_1000008
340 Ga0055533_1003885
341 Ga0055525_1000281
342 Ga0055541_1004348
343 Ga0070666_10046890
344 Ga0070660_100049920
345 Ga0070661_100000301
346 Ga0070661_100188820
347 Ga0070668_100013220
348 Ga0070673_100071927
349 Ga0070673_100162669
350 Ga0070709_10017593
351 Ga0070714_100401543
352 Ga0070713_100434580
353 Ga0070710_10066882
354 Ga0070663_100000025
355 Ga0070663_100125960
356 Ga0070678_100086688
357 Ga0070699_100002556
358 Ga0070697_100173498
359 Ga0070697_100178276
360 Ga0068853_100006217
361 Ga0068855_100126946
362 Ga0070664_100000020
363 Ga0068857_100150880
364 Ga0068856_100053049
365 Ga0068856_100277413
366 Ga0070702_100031655
367 Ga0068859_100179153
368 Ga0068864_100133290
369 Ga0068863_100110774
370 Ga0068862_100120833
371 Ga0081455_10007078
372 Ga0081455_10090105
373 Ga0081540_1003695
374 Ga0081540_1050335
375 Ga0075365_10056339
376 Ga0070715_10015037
377 Ga0070716_100264715
378 Ga0070716_100286309
379 Ga0070712_100081234
380 Ga0097621_100011572
381 Ga0097621_100043625
382 Ga0075430_100000103
383 Ga0075430_100301746
384 Ga0075431_100047408
385 Ga0075431_100159906
386 Ga0075431_100305820
387 Ga0075433_10004526
388 Ga0075434_100002179
389 Ga0075434_100041910
390 Ga0075429_100083425
391 Ga0075436_100008918
392 Ga0097620_100179152
393 Ga0075435_100172842
394 Ga0105240_10440037
395 Ga0111539_10325442
396 Ga0105245_10121116
397 Ga0114129_10003672
398 Ga0114129_10013512
399 Ga0114129_10209027
400 Ga0105248_10017622
401 Ga0105248_10028706
402 Ga0157373_10011170
403 Ga0157371_10000082
404 Ga0157370_10000423
405 Ga0157369_10051414
406 Ga0157374_10015445
407 Ga0157378_10040549
408 Ga0163162_10036214
409 Ga0157372_10000122
410 Ga0163163_10071488
411 Ga0157376_10006945
412 Ga0213873_10013951
413 Ga0213872_10006196
414 Ga0213872_10006306
415 Ga0209784_100055
416 Ga0209784_100466
417 Ga0209566_100002
418 Ga0209674_100015
419 Ga0209674_100090
420 Ga0209563_100017
421 Ga0209563_100095
422 Ga0209563_100198
423 Ga0209677_100037
424 Ga0209677_100069
425 Ga0209759_1000546
426 Ga0209759_1010266
427 Ga0209759_1015604
428 Ga0207426_1038755
429 Ga0207688_10022796
430 Ga0207685_10026547
431 Ga0207684_10042604
432 Ga0207684_10111646
433 Ga0207695_10377586
434 Ga0207693_10195988
435 Ga0207663_10034967
436 Ga0207657_10075456
437 Ga0207649_10000065
438 Ga0207687_10024189
439 Ga0207700_10168001
440 Ga0207664_10455706
441 Ga0207690_10028947
442 Ga0207665_10004853
443 Ga0207665_10139496
444 Ga0207689_10045660
445 Ga0207679_10000028
446 Ga0207679_10080306
447 Ga0207651_10031448
448 Ga0207668_10008929
449 Ga0207639_10133149
450 Ga0207678_10000136
451 Ga0207678_10004789
452 Ga0207702_10000149
453 Ga0207702_10574806
454 Ga0207676_10053739
455 Ga0207674_10323681
456 Ga0207674_10372623
457 Ga0207683_10074757
458 Ga0207428_10290922
459 Ga0307517_10165535
460 Ga0373926_0018747
461 Ga0373934_0001299
462 Ga0373923_0002539
463 Ga0373936_0005503
464 Ga0373936_0006741
465 Ga0373953_0008528
466 Ga0373953_0021818
467 Ga0373954_0007777
468 Ga0373954_0024699
469 Ga0373956_0006192
470 Ga0373957_0002784
471 Ga0373955_0004202
472 Ga0373924_0007436
473 Ga0373935_0023905
474 Ga0373935_0167448
475 Ga0373927_0000681
476 Ga0373933_0002554
477 Ga0373933_0005054
478 Ga0373937_0014930
479 Ga0373937_0037885
480 Ga0395905_0000484
481 Ga0436361_0234917
482 Ga0436361_0608376
483 Ga0436361_0655142
484 Ga0436361_1092317
485 Ga0439461_0007096
486 Ga0439465_0047137
487 Ga0439431_0008242
488 Ga0466972_0006924
489 Ga0466966_0002962
490 Ga0466961_0004789
491 Ga0466964_0027080
492 Ga0466970_0017793
493 Ga0466959_0027154
494 Ga0466959_0031575
495 Ga0466967_0036695
496 Ga0495592_0001819
497 Ga0495592_0099783
498 Ga0495591_003781
499 Ga0495629_0008830
500 Ga0495641_0009415
501 Ga0495651_0007548
502 Ga0495651_0023758
503 Ga0495651_0054388
504 Ga0495580_0004987
505 Ga0495580_0006191
506 Ga0495580_0031706
507 Ga0495580_0111660
508 Ga0495582_0082424
509 Ga0495662_0013524
510 Ga0495662_0028414
511 Ga0495664_0012693
512 Ga0495664_0035470
513 Ga0495584_0025245
514 Ga0495596_0012280
515 Ga0495607_0080098
516 Ga0495583_0000324
517 Ga0495606_0000487
518 Ga0495608_0001297
519 Ga0495608_0023894
520 Ga0495608_0120055
521 Ga0495608_0187056
522 Ga0495618_0001439
523 Ga0495618_0024796
524 Ga0495618_0049214
525 Ga0495620_0036898
526 Ga0495628_0006405
527 Ga0495628_0014087
528 Ga0495630_0000680
529 Ga0495630_0009569
530 Ga0495648_0002735
531 Ga0495666_0000120
532 Ga0495666_0008970
533 Ga0495652_0000053
534 Ga0495652_0010056
535 Ga0495652_0084959
536 Ga0495665_0005605
537 Ga0495640_0004132
538 Ga0495640_0044716
539 Ga0495586_0050930
540 Ga0495587_0002451
541 Ga0495587_0006299
542 Ga0495645_0010992
543 Ga0495645_0065319
544 Ga0495622_0035604
545 Ga0495667_0008689
546 Ga0495668_0015708
547 Ga0495668_0135124
548 Ga0495634_0013209
549 Ga0495634_0039485
550 Ga0495611_0028480
551 Ga0495625_0008790
552 Ga0495635_0007446
553 Ga0495661_0002143
554 Ga0495657_0021121
555 Ga0495657_0096933
556 Ga0495599_0008117
557 Ga0495599_0010321
558 Ga0495623_0001410
559 Ga0495646_0012954
560 Ga0495647_0006453
561 Ga0495658_0066405
562 Ga0495613_0002556
563 Ga0495613_0044380
564 Ga0495624_0006337
565 Ga0495624_0037871
566 Ga0495671_0048255
567 Ga0495649_0000207
568 Ga0495589_0004958
569 Ga0495600_0001350
570 Ga0495600_0008438
571 Ga0495604_0014415
572 Ga0495604_0033153
573 Ga0495674_0021493
574 Ga0495674_0085728
575 Ga0495676_0007408
576 Ga0495680_0037221
577 Ga0495680_0040854
578 Ga0495680_0053803
579 Ga0495683_0004809
580 Ga0495683_0043337
581 Ga0495675_0014478
582 Ga0495675_0247893
583 Ga0495679_001038
584 Ga0495673_0005575
585 Ga0495684_0007374
586 Ga0495686_0001489
587 Ga0495593_0001773
588 Ga0495602_0001531
589 Ga0495602_0008341
590 Ga0495602_0025460
591 Ga0495602_0128577
592 Ga0495614_0004342
593 Ga0496106_0077201
594 Ga0496112_0081541
595 Ga0496117_0137436
596 Ga0496118_0010703
597 Ga0496118_0024599
598 Ga0496121_0000031
599 Ga0496121_0026825
600 Ga0496125_0015121
601 Ga0496126_0000248
602 Ga0495682_0011031
603 Ga0501047_0039140
604 nmdc:mga05p37_287_c1
605 nmdc:mga05p37_47997_c1
606 nmdc:mga05p37_524828_c1
607 nmdc:mga09592_36965_c1
608 nmdc:mga06r32_133646_c1
609 nmdc:mga06r32_16650_c1
610 nmdc:mga06r32_99223_c1
611 nmdc:mga08y16_312459_c1
612 nmdc:mga0n895_3093_c1
613 nmdc:mga0n895_624138_c1
614 nmdc:mga0n895_82262_c1
615 nmdc:mga0rr50_580_c1
616 nmdc:mga08x19_3433_c1
617 nmdc:mga0a205_234875_c1
618 nmdc:mga0a205_5267_c1
619 Ga0495601_0091723
620 Ga0500635_0000041
621 Ga0495595_0016594
622 Ga0495619_0013478
623 Ga0500578_0074417
624 Ga0500651_0003992
625 Ga0500555_054662
626 Ga0500595_024699
627 Ga0500642_0012984
628 Ga0500616_0053332
629 Ga0500661_003427
630 2510247223
631 2513894975
632 2719637760
633 2808967809
634 2809002640
635 2809009918
636 2884338576
637 2884698378
638 2895450973
639 2932788015
640 2932832849
641 2935640658
642 2935668851
643 2935696871
644 2935709038
645 2935804768
646 2935832165
647 2935841005
648 2935995781
649 2936005692
650 2941541733
651 8002779042
652 8016517363
653 8017059243
654 8019576389
655 8019594264
656 8019611216

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

67

152

0.89

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

196

320

0.81

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

220

363

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dup-assembly1.cif.gz_B crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42 0.8909 1 325
1wly-assembly1.cif.gz_A crystal structure of 2-haloacrylate reductase 0.8793 1 328
1wly-assembly1.cif.gz_A crystal structure of 2-haloacrylate reductase 0.8768 1 328
4dup-assembly1.cif.gz_A crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42 0.8761 1 325
8j6e-assembly1.cif.gz_A structure insights into the nadph quinone oxidoreductase from leishmania donovani 0.8754 2 328
ID Description Score Start End Superfamily
af_Q75JT6_127_265_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.905 127 249 3.40.50.720
4rvuB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9034 126 265 3.40.50.720
af_I1LVH0_176_320_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9032 126 265 3.40.50.720
af_P96826_2_321_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9006 2 325 3.30.360.10
af_P00332_5_156_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.8996 2 115 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A427Y2Z1-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9675 2 325 GO:0016651
GO:0070402
AF-A0A4V2NFX9-F1-model_v4 Alcohol dehydrogenase-like C-terminal domain-containing protein 0.954 124 235 GO:0016491
AF-A0A428U2E7-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9504 1 325 GO:0016491
AF-A0A6I8LGR2-F1-model_v4 NADPH:quinone reductase related Zn-dependent oxidoreductase 0.945 1 325 GO:0016651
GO:0070402
AF-A0A427Y2Z1-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9445 2 325 GO:0016651
GO:0070402

Map