F409379
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 328 | 241 | 656 | 153 |
Family's Representative Sequence
| Representative Sequence | 3300046471|Ga0495650_0182711|Ga0495650_0182711_153_701 |
| Length | 182 |
| Sequence | MYRRFAARLPRSSIAPEKRETRAMAYTLNVNGKALSADVDGDTPLLWTLRDALGIVGPKYGCGVAACGACTVHVDGQPMRSCQIPTDSVGKAKITTIEGMAAHPVGKKVQAAWMELDVAQCGYCQPGQIMSATALLAKTPKPTDAQIDEAMNGNICRCATYVRIRAAIKRASGQKEVSDDLS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 4 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 5 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 6 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 34 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 38 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 41 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 42 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 43 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 44 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 45 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 46 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 47 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 48 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 49 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 64 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 65 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 66 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 67 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 103 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 104 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 105 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 106 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 107 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 108 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 109 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 110 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 111 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 112 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 113 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 114 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 115 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 116 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 117 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 118 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 119 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 120 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 121 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 122 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 123 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 124 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 125 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 126 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 127 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 128 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 129 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 130 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 131 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 132 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 133 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 134 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 135 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 136 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 137 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 138 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 139 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 140 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 158 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 159 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 160 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 161 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 162 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 169 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 170 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 171 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 172 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 173 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 176 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 177 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 178 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 184 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 185 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 186 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 187 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 188 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 189 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 190 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 191 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 192 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 193 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 194 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 195 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 196 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 197 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 198 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 199 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 200 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 201 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 202 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 203 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 204 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 205 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 206 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 207 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 208 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 209 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 210 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 211 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 212 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 213 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 214 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 215 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 216 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 217 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 218 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 219 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 220 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 221 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 222 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 223 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 224 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 225 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 226 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 227 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 228 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 229 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 230 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 231 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 232 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 233 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 234 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 235 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 236 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 237 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 238 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 239 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 240 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 241 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.28 |
| Metatranscriptomes | 0.3 |
| Isolates | 13.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.06 |
| Nodule | 12.8 |
| Rhizoplane | 1.52 |
| Rhizosphere | 72.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495650_0182711 | 3300046471 | Bacteria | 737 |
| 2 | JGI25406J46586_10004143 | 3300003203 | Bacteria | 6769 |
| 3 | JGI25160J50197_1005469 | 3300003354 | Bacteria | 5282 |
| 4 | JGI25404J52841_10007099 | 3300003659 | Bacteria | 2362 |
| 5 | Ga0055530_10000205 | 3300003791 | Bacteria | 53469 |
| 6 | Ga0055531_10005812 | 3300003794 | Bacteria | 7140 |
| 7 | Ga0055543_1006198 | 3300004625 | Bacteria | 2928 |
| 8 | Ga0065165_1001248 | 3300005262 | Bacteria | 28913 |
| 9 | Ga0065165_1047805 | 3300005262 | Bacteria | 1233 |
| 10 | Ga0065707_10014152 | 3300005295 | Bacteria | 1877 |
| 11 | Ga0070658_10188129 | 3300005327 | Bacteria | 1740 |
| 12 | Ga0070658_10244750 | 3300005327 | Bacteria | 1521 |
| 13 | Ga0070658_10861826 | 3300005327 | Bacteria | 787 |
| 14 | Ga0070690_100536827 | 3300005330 | Bacteria | 880 |
| 15 | Ga0068869_101315851 | 3300005334 | Bacteria | 638 |
| 16 | Ga0070666_10720309 | 3300005335 | Bacteria | 732 |
| 17 | Ga0070680_100003700 | 3300005336 | Bacteria | 11425 |
| 18 | Ga0070682_100745645 | 3300005337 | Bacteria | 790 |
| 19 | Ga0070660_100015877 | 3300005339 | Bacteria | 5451 |
| 20 | Ga0070660_100069339 | 3300005339 | Bacteria | 2749 |
| 21 | Ga0070689_101750425 | 3300005340 | Bacteria | 566 |
| 22 | Ga0070691_10012086 | 3300005341 | Bacteria | 3953 |
| 23 | Ga0070661_100089589 | 3300005344 | Bacteria | 2278 |
| 24 | Ga0070669_100033658 | 3300005353 | Bacteria | 3708 |
| 25 | Ga0070674_100359156 | 3300005356 | Bacteria | 1179 |
| 26 | Ga0070659_100000315 | 3300005366 | Bacteria | 37706 |
| 27 | Ga0070659_100004811 | 3300005366 | Bacteria | 9647 |
| 28 | Ga0070681_10022689 | 3300005458 | Bacteria | 6306 |
| 29 | Ga0070681_10033063 | 3300005458 | Bacteria | 5191 |
| 30 | Ga0068867_100956324 | 3300005459 | Bacteria | 774 |
| 31 | Ga0070698_101751855 | 3300005471 | Bacteria | 574 |
| 32 | Ga0070679_100000858 | 3300005530 | Bacteria | 26439 |
| 33 | Ga0070679_100070743 | 3300005530 | Bacteria | 3480 |
| 34 | Ga0070679_100882769 | 3300005530 | Bacteria | 838 |
| 35 | Ga0068853_100022571 | 3300005539 | Bacteria | 5257 |
| 36 | Ga0068853_100165122 | 3300005539 | Bacteria | 2000 |
| 37 | Ga0068853_101405639 | 3300005539 | Bacteria | 675 |
| 38 | Ga0070672_100671338 | 3300005543 | Bacteria | 906 |
| 39 | Ga0070696_101461718 | 3300005546 | Bacteria | 584 |
| 40 | Ga0070665_100000593 | 3300005548 | Bacteria | 50386 |
| 41 | Ga0070704_101648439 | 3300005549 | Bacteria | 592 |
| 42 | Ga0068855_100019041 | 3300005563 | Bacteria | 8252 |
| 43 | Ga0068855_100034384 | 3300005563 | Bacteria | 6046 |
| 44 | Ga0068855_100140049 | 3300005563 | Bacteria | 2758 |
| 45 | Ga0068855_100720940 | 3300005563 | Bacteria | 1066 |
| 46 | Ga0068857_100293407 | 3300005577 | Bacteria | 1498 |
| 47 | Ga0068854_101582519 | 3300005578 | Bacteria | 597 |
| 48 | Ga0068852_101570910 | 3300005616 | Bacteria | 680 |
| 49 | Ga0068864_100888306 | 3300005618 | Bacteria | 879 |
| 50 | Ga0068861_100108906 | 3300005719 | Bacteria | 2217 |
| 51 | Ga0068870_10531259 | 3300005840 | Bacteria | 789 |
| 52 | Ga0068863_100560408 | 3300005841 | Bacteria | 1129 |
| 53 | Ga0068862_100050135 | 3300005844 | Bacteria | 3567 |
| 54 | Ga0081540_1049363 | 3300005983 | Bacteria | 2100 |
| 55 | Ga0075362_10015892 | 3300006177 | Bacteria | 3070 |
| 56 | Ga0075370_10032177 | 3300006353 | Bacteria | 2931 |
| 57 | Ga0075428_100014187 | 3300006844 | Bacteria | 8863 |
| 58 | Ga0075428_100200667 | 3300006844 | Bacteria | 2156 |
| 59 | Ga0075430_100007770 | 3300006846 | Bacteria | 9060 |
| 60 | Ga0075431_100001391 | 3300006847 | Bacteria | 22210 |
| 61 | Ga0075431_100008453 | 3300006847 | Bacteria | 10309 |
| 62 | Ga0075431_100025331 | 3300006847 | Bacteria | 6081 |
| 63 | Ga0075434_100227919 | 3300006871 | Bacteria | 1883 |
| 64 | Ga0075429_100002207 | 3300006880 | Bacteria | 16292 |
| 65 | Ga0075429_100018079 | 3300006880 | Bacteria | 6098 |
| 66 | Ga0105240_10036729 | 3300009093 | Bacteria | 6300 |
| 67 | Ga0105240_10094860 | 3300009093 | Bacteria | 3639 |
| 68 | Ga0105240_10307810 | 3300009093 | Bacteria | 1810 |
| 69 | Ga0105240_11392731 | 3300009093 | Bacteria | 737 |
| 70 | Ga0111539_12045656 | 3300009094 | Bacteria | 664 |
| 71 | Ga0105245_10282450 | 3300009098 | Bacteria | 1623 |
| 72 | Ga0114129_11335917 | 3300009147 | Unclassified | 887 |
| 73 | Ga0114129_11563358 | 3300009147 | Bacteria | 809 |
| 74 | Ga0105242_10879630 | 3300009176 | Bacteria | 894 |
| 75 | Ga0105237_10225833 | 3300009545 | Bacteria | 1873 |
| 76 | Ga0105237_10663591 | 3300009545 | Bacteria | 1049 |
| 77 | Ga0105237_11111910 | 3300009545 | Bacteria | 797 |
| 78 | Ga0105238_10018993 | 3300009551 | Bacteria | 7001 |
| 79 | Ga0105238_10103838 | 3300009551 | Bacteria | 2823 |
| 80 | Ga0105238_10128657 | 3300009551 | Bacteria | 2511 |
| 81 | Ga0105238_10129883 | 3300009551 | Bacteria | 2497 |
| 82 | Ga0105238_10874501 | 3300009551 | Bacteria | 916 |
| 83 | Ga0105249_10815622 | 3300009553 | Bacteria | 997 |
| 84 | Ga0105239_11465927 | 3300010375 | Bacteria | 788 |
| 85 | Ga0157370_10147823 | 3300013104 | Bacteria | 2187 |
| 86 | Ga0157378_12554679 | 3300013297 | Bacteria | 563 |
| 87 | Ga0163162_10984263 | 3300013306 | Bacteria | 953 |
| 88 | Ga0157375_12185448 | 3300013308 | Bacteria | 659 |
| 89 | Ga0157375_12629919 | 3300013308 | Bacteria | 601 |
| 90 | Ga0157380_10004303 | 3300014326 | Bacteria | 9871 |
| 91 | Ga0157380_10178971 | 3300014326 | Bacteria | 1861 |
| 92 | Ga0207425_1058694 | 3300025245 | Bacteria | 684 |
| 93 | Ga0209026_1000794 | 3300025250 | Bacteria | 17234 |
| 94 | Ga0209673_1045406 | 3300025273 | Bacteria | 1207 |
| 95 | Ga0209564_1004957 | 3300025295 | Bacteria | 7857 |
| 96 | Ga0209758_1004468 | 3300025297 | Bacteria | 11623 |
| 97 | Ga0209050_1000095 | 3300025298 | Bacteria | 242722 |
| 98 | Ga0209257_1000106 | 3300025304 | Bacteria | 242634 |
| 99 | Ga0209257_1008564 | 3300025304 | Bacteria | 5768 |
| 100 | Ga0207680_10276931 | 3300025903 | Bacteria | 1165 |
| 101 | Ga0207643_10041048 | 3300025908 | Bacteria | 2606 |
| 102 | Ga0207705_10000556 | 3300025909 | Bacteria | 31398 |
| 103 | Ga0207705_10048116 | 3300025909 | Bacteria | 3067 |
| 104 | Ga0207705_10058297 | 3300025909 | Bacteria | 2786 |
| 105 | Ga0207705_10458556 | 3300025909 | Bacteria | 989 |
| 106 | Ga0207705_10622541 | 3300025909 | Bacteria | 839 |
| 107 | Ga0207707_10006630 | 3300025912 | Bacteria | 10102 |
| 108 | Ga0207707_10058918 | 3300025912 | Bacteria | 3341 |
| 109 | Ga0207695_10018667 | 3300025913 | Bacteria | 8011 |
| 110 | Ga0207695_10048341 | 3300025913 | Bacteria | 4493 |
| 111 | Ga0207695_10087845 | 3300025913 | Bacteria | 3131 |
| 112 | Ga0207695_10607232 | 3300025913 | Bacteria | 975 |
| 113 | Ga0207671_10663028 | 3300025914 | Bacteria | 830 |
| 114 | Ga0207660_10000773 | 3300025917 | Bacteria | 21298 |
| 115 | Ga0207657_10000693 | 3300025919 | Bacteria | 35842 |
| 116 | Ga0207657_10048705 | 3300025919 | Bacteria | 3698 |
| 117 | Ga0207649_10125427 | 3300025920 | Bacteria | 1737 |
| 118 | Ga0207652_10002139 | 3300025921 | Bacteria | 16935 |
| 119 | Ga0207652_10028567 | 3300025921 | Bacteria | 4655 |
| 120 | Ga0207681_10324400 | 3300025923 | Bacteria | 1225 |
| 121 | Ga0207694_10032045 | 3300025924 | Bacteria | 4021 |
| 122 | Ga0207694_10082540 | 3300025924 | Bacteria | 2526 |
| 123 | Ga0207694_10923491 | 3300025924 | Bacteria | 738 |
| 124 | Ga0207694_10980310 | 3300025924 | Bacteria | 715 |
| 125 | Ga0207650_10854983 | 3300025925 | Bacteria | 772 |
| 126 | Ga0207664_10687441 | 3300025929 | Bacteria | 920 |
| 127 | Ga0207690_10000843 | 3300025932 | Bacteria | 19644 |
| 128 | Ga0207690_10010011 | 3300025932 | Bacteria | 5632 |
| 129 | Ga0207690_10696362 | 3300025932 | Bacteria | 835 |
| 130 | Ga0207669_10091432 | 3300025937 | Bacteria | 1982 |
| 131 | Ga0207689_10442863 | 3300025942 | Bacteria | 1085 |
| 132 | Ga0207689_10526016 | 3300025942 | Bacteria | 992 |
| 133 | Ga0207661_11649140 | 3300025944 | Bacteria | 586 |
| 134 | Ga0207667_10008126 | 3300025949 | Bacteria | 12495 |
| 135 | Ga0207667_10017742 | 3300025949 | Bacteria | 8004 |
| 136 | Ga0207667_10022302 | 3300025949 | Bacteria | 6998 |
| 137 | Ga0207668_10004710 | 3300025972 | Bacteria | 8023 |
| 138 | Ga0207668_11026786 | 3300025972 | Bacteria | 738 |
| 139 | Ga0207639_10040152 | 3300026041 | Bacteria | 3491 |
| 140 | Ga0207639_10049578 | 3300026041 | Bacteria | 3184 |
| 141 | Ga0207639_10680457 | 3300026041 | Bacteria | 953 |
| 142 | Ga0207641_10955810 | 3300026088 | Bacteria | 852 |
| 143 | Ga0207648_10348593 | 3300026089 | Bacteria | 1334 |
| 144 | Ga0207676_11619193 | 3300026095 | Bacteria | 645 |
| 145 | Ga0207674_10106123 | 3300026116 | Bacteria | 2787 |
| 146 | Ga0207674_10231581 | 3300026116 | Bacteria | 1795 |
| 147 | Ga0207675_100221018 | 3300026118 | Bacteria | 1825 |
| 148 | Ga0207675_100246883 | 3300026118 | Bacteria | 1726 |
| 149 | Ga0207683_10398606 | 3300026121 | Bacteria | 1266 |
| 150 | Ga0207698_10706316 | 3300026142 | Bacteria | 1004 |
| 151 | Ga0207698_11424443 | 3300026142 | Bacteria | 708 |
| 152 | Ga0210000_1063002 | 3300027462 | Bacteria | 601 |
| 153 | Ga0209999_1023536 | 3300027543 | Bacteria | 1135 |
| 154 | Ga0268266_10000003 | 3300028379 | Bacteria | 1701703 |
| 155 | Ga0268265_10049291 | 3300028380 | Bacteria | 3166 |
| 156 | Ga0307517_10001755 | 3300028786 | Bacteria | 35724 |
| 157 | Ga0307517_10038145 | 3300028786 | Bacteria | 5335 |
| 158 | Ga0307511_10004748 | 3300030521 | Bacteria | 13890 |
| 159 | Ga0307513_10001025 | 3300031456 | Bacteria | 40478 |
| 160 | Ga0307513_10011358 | 3300031456 | Bacteria | 11074 |
| 161 | Ga0307513_10680049 | 3300031456 | Bacteria | 735 |
| 162 | Ga0307408_100301852 | 3300031548 | Bacteria | 1342 |
| 163 | Ga0307408_100384731 | 3300031548 | Bacteria | 1200 |
| 164 | Ga0316575_10003711 | 3300031665 | Bacteria | 5300 |
| 165 | Ga0307405_10445581 | 3300031731 | Bacteria | 1025 |
| 166 | Ga0307405_11104679 | 3300031731 | Bacteria | 682 |
| 167 | Ga0307413_10352088 | 3300031824 | Bacteria | 1137 |
| 168 | Ga0307406_10425728 | 3300031901 | Bacteria | 1059 |
| 169 | Ga0307406_11084921 | 3300031901 | Bacteria | 691 |
| 170 | Ga0307412_10193223 | 3300031911 | Bacteria | 1540 |
| 171 | Ga0307416_100394269 | 3300032002 | Bacteria | 1419 |
| 172 | Ga0307414_10606454 | 3300032004 | Bacteria | 982 |
| 173 | Ga0307414_11090711 | 3300032004 | Bacteria | 737 |
| 174 | Ga0307411_10170849 | 3300032005 | Bacteria | 1639 |
| 175 | Ga0307411_10259798 | 3300032005 | Bacteria | 1371 |
| 176 | Ga0307411_10377584 | 3300032005 | Bacteria | 1165 |
| 177 | Ga0307415_100343903 | 3300032126 | Bacteria | 1253 |
| 178 | Ga0307415_100929535 | 3300032126 | Bacteria | 804 |
| 179 | Ga0373936_0007158 | 3300035113 | Bacteria | 4199 |
| 180 | Ga0373927_0040469 | 3300035695 | Bacteria | 3023 |
| 181 | Ga0395899_0001363 | 3300037312 | Bacteria | 20958 |
| 182 | Ga0395900_0000072 | 3300037418 | Bacteria | 187428 |
| 183 | Ga0395898_0100789 | 3300037466 | Bacteria | 2773 |
| 184 | Ga0395905_0022752 | 3300037471 | Bacteria | 5926 |
| 185 | Ga0395905_0284544 | 3300037471 | Bacteria | 1540 |
| 186 | Ga0395905_0302855 | 3300037471 | Bacteria | 1486 |
| 187 | Ga0395901_0000032 | 3300038443 | Bacteria | 235172 |
| 188 | Ga0439436_0031185 | 3300041404 | Bacteria | 1547 |
| 189 | Ga0439461_0000413 | 3300041410 | Bacteria | 6168 |
| 190 | Ga0439465_0000195 | 3300041413 | Bacteria | 15884 |
| 191 | Ga0439465_0217357 | 3300041413 | Bacteria | 700 |
| 192 | Ga0439431_0001056 | 3300041997 | Bacteria | 5977 |
| 193 | Ga0439433_0083841 | 3300041999 | Bacteria | 778 |
| 194 | Ga0439433_0110658 | 3300041999 | Bacteria | 687 |
| 195 | Ga0439445_0006530 | 3300042004 | Bacteria | 2682 |
| 196 | Ga0439432_007759 | 3300042006 | Bacteria | 3787 |
| 197 | Ga0439449_0278066 | 3300042007 | Bacteria | 631 |
| 198 | Ga0439452_019317 | 3300042010 | Bacteria | 1804 |
| 199 | Ga0439462_0000744 | 3300042015 | Bacteria | 6738 |
| 200 | Ga0439434_0001078 | 3300042435 | Bacteria | 7916 |
| 201 | Ga0439459_0198479 | 3300042438 | Bacteria | 547 |
| 202 | Ga0451577_0241438 | 3300042876 | Bacteria | 1635 |
| 203 | Ga0466965_0076787 | 3300044683 | Bacteria | 1686 |
| 204 | Ga0453684_0331670 | 3300044712 | Bacteria | 1720 |
| 205 | Ga0466971_0333899 | 3300044719 | Bacteria | 732 |
| 206 | Ga0466959_0717203 | 3300045049 | Bacteria | 670 |
| 207 | Ga0466958_0343703 | 3300045836 | Bacteria | 960 |
| 208 | Ga0466958_0688324 | 3300045836 | Bacteria | 666 |
| 209 | Ga0495629_0173503 | 3300046459 | Bacteria | 1496 |
| 210 | Ga0495596_0000095 | 3300046500 | Bacteria | 62707 |
| 211 | Ga0495606_0537409 | 3300046507 | Bacteria | 584 |
| 212 | Ga0495616_0218891 | 3300046513 | Bacteria | 830 |
| 213 | Ga0495631_0324233 | 3300046518 | Bacteria | 655 |
| 214 | Ga0495632_0324162 | 3300046519 | Bacteria | 680 |
| 215 | Ga0495598_0024982 | 3300046537 | Bacteria | 1625 |
| 216 | Ga0495621_0093793 | 3300046539 | Bacteria | 1134 |
| 217 | Ga0495621_0319423 | 3300046539 | Bacteria | 647 |
| 218 | Ga0495597_0278988 | 3300046542 | Bacteria | 651 |
| 219 | Ga0495633_0414271 | 3300046558 | Bacteria | 609 |
| 220 | Ga0495668_0022696 | 3300046616 | Bacteria | 3586 |
| 221 | Ga0495668_0037384 | 3300046616 | Bacteria | 2716 |
| 222 | Ga0495668_0161315 | 3300046616 | Bacteria | 1228 |
| 223 | Ga0495668_0207967 | 3300046616 | Bacteria | 1071 |
| 224 | Ga0495668_0296354 | 3300046616 | Bacteria | 886 |
| 225 | Ga0495668_0321191 | 3300046616 | Bacteria | 849 |
| 226 | Ga0495668_0536744 | 3300046616 | Bacteria | 645 |
| 227 | Ga0495625_0136356 | 3300046660 | Bacteria | 1659 |
| 228 | Ga0495625_0183132 | 3300046660 | Bacteria | 1391 |
| 229 | Ga0495669_0123475 | 3300046684 | Bacteria | 1215 |
| 230 | Ga0495672_0118471 | 3300047320 | Bacteria | 1411 |
| 231 | Ga0495677_0336618 | 3300047445 | Bacteria | 595 |
| 232 | Ga0495681_0148281 | 3300047470 | Bacteria | 986 |
| 233 | Ga0495686_0047582 | 3300047472 | Bacteria | 2707 |
| 234 | Ga0495686_0236177 | 3300047472 | Bacteria | 1033 |
| 235 | Ga0495686_0539486 | 3300047472 | Bacteria | 610 |
| 236 | Ga0496103_0990198 | 3300048906 | Bacteria | 524 |
| 237 | Ga0496105_1278181 | 3300048908 | Bacteria | 537 |
| 238 | Ga0496113_1267162 | 3300048916 | Bacteria | 574 |
| 239 | Ga0496115_0001656 | 3300048918 | Bacteria | 16024 |
| 240 | Ga0496115_0125920 | 3300048918 | Bacteria | 2110 |
| 241 | Ga0496118_0029634 | 3300048921 | Bacteria | 4586 |
| 242 | Ga0501032_0263883 | 3300049569 | Bacteria | 1116 |
| 243 | Ga0501034_0981866 | 3300049571 | Bacteria | 729 |
| 244 | Ga0501047_0130793 | 3300049581 | Bacteria | 2391 |
| 245 | Ga0501047_0681338 | 3300049581 | Bacteria | 846 |
| 246 | Ga0501048_0114842 | 3300049582 | Bacteria | 1902 |
| 247 | Ga0501048_0601065 | 3300049582 | Bacteria | 790 |
| 248 | Ga0501071_0972470 | 3300049587 | Bacteria | 655 |
| 249 | Ga0501076_1023544 | 3300049592 | Bacteria | 680 |
| 250 | Ga0501236_024192 | 3300049670 | Bacteria | 920 |
| 251 | Ga0501253_032159 | 3300049683 | Bacteria | 1008 |
| 252 | Ga0501257_243022 | 3300049686 | Bacteria | 531 |
| 253 | Ga0501264_002030 | 3300049761 | Bacteria | 1946 |
| 254 | Ga0501283_006983 | 3300049779 | Bacteria | 1597 |
| 255 | Ga0501035_1067651 | 3300049822 | Bacteria | 632 |
| 256 | Ga0501044_0544946 | 3300049823 | Bacteria | 1058 |
| 257 | nmdc:mga03683_268977_c1 | 3300050489 | Bacteria | 795 |
| 258 | nmdc:mga0yw44_137203_c1 | 3300050492 | Bacteria | 1587 |
| 259 | nmdc:mga0k408_624647_c1 | 3300050493 | Bacteria | 634 |
| 260 | nmdc:mga05p37_1306481_c1 | 3300050507 | Bacteria | 739 |
| 261 | nmdc:mga05p37_8609_c1 | 3300050507 | Bacteria | 12062 |
| 262 | nmdc:mga09592_10367_c1 | 3300050508 | Bacteria | 7582 |
| 263 | nmdc:mga09592_537_c1 | 3300050508 | Bacteria | 28691 |
| 264 | nmdc:mga0qj67_1600_c1 | 3300050509 | Bacteria | 15931 |
| 265 | nmdc:mga06r32_1739_c1 | 3300050510 | Bacteria | 19582 |
| 266 | nmdc:mga06r32_1784_c1 | 3300050510 | Bacteria | 19318 |
| 267 | nmdc:mga06r32_37189_c1 | 3300050510 | Bacteria | 4605 |
| 268 | nmdc:mga08y16_195618_c1 | 3300050511 | Bacteria | 2096 |
| 269 | Ga0500583_0096359 | 3300053092 | Bacteria | 1445 |
| 270 | Ga0500641_0001909 | 3300053096 | Bacteria | 7404 |
| 271 | Ga0500555_016683 | 3300053103 | Bacteria | 2117 |
| 272 | Ga0500556_0149778 | 3300053104 | Bacteria | 919 |
| 273 | Ga0500562_000312 | 3300053108 | Bacteria | 11780 |
| 274 | Ga0500593_197991 | 3300053117 | Bacteria | 728 |
| 275 | Ga0500594_0101762 | 3300053118 | Bacteria | 885 |
| 276 | Ga0500595_021851 | 3300053119 | Bacteria | 2277 |
| 277 | Ga0500617_089981 | 3300053124 | Bacteria | 1315 |
| 278 | Ga0500628_071775 | 3300053129 | Bacteria | 869 |
| 279 | Ga0500568_0014335 | 3300053139 | Bacteria | 3582 |
| 280 | Ga0500568_0053247 | 3300053139 | Bacteria | 1587 |
| 281 | Ga0500604_0127103 | 3300053151 | Bacteria | 855 |
| 282 | Ga0500622_0002197 | 3300053156 | Bacteria | 14416 |
| 283 | Ga0500645_001174 | 3300053730 | Bacteria | 13991 |
| 284 | Ga0587111_0053532 | 3300060346 | Bacteria | 898 |
| 285 | 2513892680 | 2513237141 | Bacteria | 8496279 |
| 286 | 2517103973 | 2517093001 | Bacteria | 9002274 |
| 287 | 2528849231 | 2528768022 | Bacteria | 10457665 |
| 288 | 2824775944 | 2824773399 | Bacteria | 8360218 |
| 289 | 2841959847 | 2841957949 | Bacteria | 8652217 |
| 290 | 2842695997 | 2842694124 | Bacteria | 4063419 |
| 291 | 2879109058 | 2879099564 | Bacteria | 10442239 |
| 292 | 2908741902 | 2908739725 | Bacteria | 8628932 |
| 293 | 2932813784 | 2932809354 | Bacteria | 9135765 |
| 294 | 2932822247 | 2932818245 | Bacteria | 9955613 |
| 295 | 2935620736 | 2935616580 | Bacteria | 9032984 |
| 296 | 2935639815 | 2935638405 | Bacteria | 10015038 |
| 297 | 2935650446 | 2935648319 | Bacteria | 8801166 |
| 298 | 2935658593 | 2935656913 | Bacteria | 8965014 |
| 299 | 2935667348 | 2935665750 | Bacteria | 9571747 |
| 300 | 2935697204 | 2935694250 | Bacteria | 9291695 |
| 301 | 2935705088 | 2935703347 | Bacteria | 10242284 |
| 302 | 2935762012 | 2935760218 | Bacteria | 9817913 |
| 303 | 2935803511 | 2935801545 | Bacteria | 9301974 |
| 304 | 2935829298 | 2935827899 | Bacteria | 10038562 |
| 305 | 2935842724 | 2935837841 | Bacteria | 9454360 |
| 306 | 2935858544 | 2935855204 | Bacteria | 9035059 |
| 307 | 2935867035 | 2935864058 | Bacteria | 9784707 |
| 308 | 2935877165 | 2935873716 | Bacteria | 9632195 |
| 309 | 2935908654 | 2935908558 | Bacteria | 8568796 |
| 310 | 2935917799 | 2935916978 | Bacteria | 9113783 |
| 311 | 2935926773 | 2935926038 | Bacteria | 8601059 |
| 312 | 2935935222 | 2935934488 | Bacteria | 8602579 |
| 313 | 2935943673 | 2935942939 | Bacteria | 8599779 |
| 314 | 2935952110 | 2935951376 | Bacteria | 8602333 |
| 315 | 2935968235 | 2935967501 | Bacteria | 8603075 |
| 316 | 2935995199 | 2935992306 | Bacteria | 9802711 |
| 317 | 2936004086 | 2936002035 | Bacteria | 9362176 |
| 318 | 2936012995 | 2936011229 | Bacteria | 8801034 |
| 319 | 2936021918 | 2936019824 | Bacteria | 8804134 |
| 320 | 2936030288 | 2936028420 | Bacteria | 8965941 |
| 321 | 2936048112 | 2936046547 | Bacteria | 8903709 |
| 322 | 2936059745 | 2936055302 | Bacteria | 8785755 |
| 323 | 2941544427 | 2941538514 | Bacteria | 9402094 |
| 324 | 8019579328 | 8019576017 | Bacteria | 10049540 |
| 325 | 8019597383 | 8019586578 | Bacteria | 10212056 |
| 326 | 8019604302 | 8019597564 | Bacteria | 10041141 |
| 327 | 8019614230 | 8019608314 | Bacteria | 10042931 |
| 328 | 8019690553 | 8019687851 | Bacteria | 8712826 |
| 329 | Ga0495650_0182711 | |||
| 330 | JGI25406J46586_10004143 | |||
| 331 | JGI25160J50197_1005469 | |||
| 332 | JGI25404J52841_10007099 | |||
| 333 | Ga0055530_10000205 | |||
| 334 | Ga0055531_10005812 | |||
| 335 | Ga0055543_1006198 | |||
| 336 | Ga0065165_1001248 | |||
| 337 | Ga0065165_1047805 | |||
| 338 | Ga0065707_10014152 | |||
| 339 | Ga0070658_10188129 | |||
| 340 | Ga0070658_10244750 | |||
| 341 | Ga0070658_10861826 | |||
| 342 | Ga0070690_100536827 | |||
| 343 | Ga0068869_101315851 | |||
| 344 | Ga0070666_10720309 | |||
| 345 | Ga0070680_100003700 | |||
| 346 | Ga0070682_100745645 | |||
| 347 | Ga0070660_100015877 | |||
| 348 | Ga0070660_100069339 | |||
| 349 | Ga0070689_101750425 | |||
| 350 | Ga0070691_10012086 | |||
| 351 | Ga0070661_100089589 | |||
| 352 | Ga0070669_100033658 | |||
| 353 | Ga0070674_100359156 | |||
| 354 | Ga0070659_100000315 | |||
| 355 | Ga0070659_100004811 | |||
| 356 | Ga0070681_10022689 | |||
| 357 | Ga0070681_10033063 | |||
| 358 | Ga0068867_100956324 | |||
| 359 | Ga0070698_101751855 | |||
| 360 | Ga0070679_100000858 | |||
| 361 | Ga0070679_100070743 | |||
| 362 | Ga0070679_100882769 | |||
| 363 | Ga0068853_100022571 | |||
| 364 | Ga0068853_100165122 | |||
| 365 | Ga0068853_101405639 | |||
| 366 | Ga0070672_100671338 | |||
| 367 | Ga0070696_101461718 | |||
| 368 | Ga0070665_100000593 | |||
| 369 | Ga0070704_101648439 | |||
| 370 | Ga0068855_100019041 | |||
| 371 | Ga0068855_100034384 | |||
| 372 | Ga0068855_100140049 | |||
| 373 | Ga0068855_100720940 | |||
| 374 | Ga0068857_100293407 | |||
| 375 | Ga0068854_101582519 | |||
| 376 | Ga0068852_101570910 | |||
| 377 | Ga0068864_100888306 | |||
| 378 | Ga0068861_100108906 | |||
| 379 | Ga0068870_10531259 | |||
| 380 | Ga0068863_100560408 | |||
| 381 | Ga0068862_100050135 | |||
| 382 | Ga0081540_1049363 | |||
| 383 | Ga0075362_10015892 | |||
| 384 | Ga0075370_10032177 | |||
| 385 | Ga0075428_100014187 | |||
| 386 | Ga0075428_100200667 | |||
| 387 | Ga0075430_100007770 | |||
| 388 | Ga0075431_100001391 | |||
| 389 | Ga0075431_100008453 | |||
| 390 | Ga0075431_100025331 | |||
| 391 | Ga0075434_100227919 | |||
| 392 | Ga0075429_100002207 | |||
| 393 | Ga0075429_100018079 | |||
| 394 | Ga0105240_10036729 | |||
| 395 | Ga0105240_10094860 | |||
| 396 | Ga0105240_10307810 | |||
| 397 | Ga0105240_11392731 | |||
| 398 | Ga0111539_12045656 | |||
| 399 | Ga0105245_10282450 | |||
| 400 | Ga0114129_11335917 | |||
| 401 | Ga0114129_11563358 | |||
| 402 | Ga0105242_10879630 | |||
| 403 | Ga0105237_10225833 | |||
| 404 | Ga0105237_10663591 | |||
| 405 | Ga0105237_11111910 | |||
| 406 | Ga0105238_10018993 | |||
| 407 | Ga0105238_10103838 | |||
| 408 | Ga0105238_10128657 | |||
| 409 | Ga0105238_10129883 | |||
| 410 | Ga0105238_10874501 | |||
| 411 | Ga0105249_10815622 | |||
| 412 | Ga0105239_11465927 | |||
| 413 | Ga0157370_10147823 | |||
| 414 | Ga0157378_12554679 | |||
| 415 | Ga0163162_10984263 | |||
| 416 | Ga0157375_12185448 | |||
| 417 | Ga0157375_12629919 | |||
| 418 | Ga0157380_10004303 | |||
| 419 | Ga0157380_10178971 | |||
| 420 | Ga0207425_1058694 | |||
| 421 | Ga0209026_1000794 | |||
| 422 | Ga0209673_1045406 | |||
| 423 | Ga0209564_1004957 | |||
| 424 | Ga0209758_1004468 | |||
| 425 | Ga0209050_1000095 | |||
| 426 | Ga0209257_1000106 | |||
| 427 | Ga0209257_1008564 | |||
| 428 | Ga0207680_10276931 | |||
| 429 | Ga0207643_10041048 | |||
| 430 | Ga0207705_10000556 | |||
| 431 | Ga0207705_10048116 | |||
| 432 | Ga0207705_10058297 | |||
| 433 | Ga0207705_10458556 | |||
| 434 | Ga0207705_10622541 | |||
| 435 | Ga0207707_10006630 | |||
| 436 | Ga0207707_10058918 | |||
| 437 | Ga0207695_10018667 | |||
| 438 | Ga0207695_10048341 | |||
| 439 | Ga0207695_10087845 | |||
| 440 | Ga0207695_10607232 | |||
| 441 | Ga0207671_10663028 | |||
| 442 | Ga0207660_10000773 | |||
| 443 | Ga0207657_10000693 | |||
| 444 | Ga0207657_10048705 | |||
| 445 | Ga0207649_10125427 | |||
| 446 | Ga0207652_10002139 | |||
| 447 | Ga0207652_10028567 | |||
| 448 | Ga0207681_10324400 | |||
| 449 | Ga0207694_10032045 | |||
| 450 | Ga0207694_10082540 | |||
| 451 | Ga0207694_10923491 | |||
| 452 | Ga0207694_10980310 | |||
| 453 | Ga0207650_10854983 | |||
| 454 | Ga0207664_10687441 | |||
| 455 | Ga0207690_10000843 | |||
| 456 | Ga0207690_10010011 | |||
| 457 | Ga0207690_10696362 | |||
| 458 | Ga0207669_10091432 | |||
| 459 | Ga0207689_10442863 | |||
| 460 | Ga0207689_10526016 | |||
| 461 | Ga0207661_11649140 | |||
| 462 | Ga0207667_10008126 | |||
| 463 | Ga0207667_10017742 | |||
| 464 | Ga0207667_10022302 | |||
| 465 | Ga0207668_10004710 | |||
| 466 | Ga0207668_11026786 | |||
| 467 | Ga0207639_10040152 | |||
| 468 | Ga0207639_10049578 | |||
| 469 | Ga0207639_10680457 | |||
| 470 | Ga0207641_10955810 | |||
| 471 | Ga0207648_10348593 | |||
| 472 | Ga0207676_11619193 | |||
| 473 | Ga0207674_10106123 | |||
| 474 | Ga0207674_10231581 | |||
| 475 | Ga0207675_100221018 | |||
| 476 | Ga0207675_100246883 | |||
| 477 | Ga0207683_10398606 | |||
| 478 | Ga0207698_10706316 | |||
| 479 | Ga0207698_11424443 | |||
| 480 | Ga0210000_1063002 | |||
| 481 | Ga0209999_1023536 | |||
| 482 | Ga0268266_10000003 | |||
| 483 | Ga0268265_10049291 | |||
| 484 | Ga0307517_10001755 | |||
| 485 | Ga0307517_10038145 | |||
| 486 | Ga0307511_10004748 | |||
| 487 | Ga0307513_10001025 | |||
| 488 | Ga0307513_10011358 | |||
| 489 | Ga0307513_10680049 | |||
| 490 | Ga0307408_100301852 | |||
| 491 | Ga0307408_100384731 | |||
| 492 | Ga0316575_10003711 | |||
| 493 | Ga0307405_10445581 | |||
| 494 | Ga0307405_11104679 | |||
| 495 | Ga0307413_10352088 | |||
| 496 | Ga0307406_10425728 | |||
| 497 | Ga0307406_11084921 | |||
| 498 | Ga0307412_10193223 | |||
| 499 | Ga0307416_100394269 | |||
| 500 | Ga0307414_10606454 | |||
| 501 | Ga0307414_11090711 | |||
| 502 | Ga0307411_10170849 | |||
| 503 | Ga0307411_10259798 | |||
| 504 | Ga0307411_10377584 | |||
| 505 | Ga0307415_100343903 | |||
| 506 | Ga0307415_100929535 | |||
| 507 | Ga0373936_0007158 | |||
| 508 | Ga0373927_0040469 | |||
| 509 | Ga0395899_0001363 | |||
| 510 | Ga0395900_0000072 | |||
| 511 | Ga0395898_0100789 | |||
| 512 | Ga0395905_0022752 | |||
| 513 | Ga0395905_0284544 | |||
| 514 | Ga0395905_0302855 | |||
| 515 | Ga0395901_0000032 | |||
| 516 | Ga0439436_0031185 | |||
| 517 | Ga0439461_0000413 | |||
| 518 | Ga0439465_0000195 | |||
| 519 | Ga0439465_0217357 | |||
| 520 | Ga0439431_0001056 | |||
| 521 | Ga0439433_0083841 | |||
| 522 | Ga0439433_0110658 | |||
| 523 | Ga0439445_0006530 | |||
| 524 | Ga0439432_007759 | |||
| 525 | Ga0439449_0278066 | |||
| 526 | Ga0439452_019317 | |||
| 527 | Ga0439462_0000744 | |||
| 528 | Ga0439434_0001078 | |||
| 529 | Ga0439459_0198479 | |||
| 530 | Ga0451577_0241438 | |||
| 531 | Ga0466965_0076787 | |||
| 532 | Ga0453684_0331670 | |||
| 533 | Ga0466971_0333899 | |||
| 534 | Ga0466959_0717203 | |||
| 535 | Ga0466958_0343703 | |||
| 536 | Ga0466958_0688324 | |||
| 537 | Ga0495629_0173503 | |||
| 538 | Ga0495596_0000095 | |||
| 539 | Ga0495606_0537409 | |||
| 540 | Ga0495616_0218891 | |||
| 541 | Ga0495631_0324233 | |||
| 542 | Ga0495632_0324162 | |||
| 543 | Ga0495598_0024982 | |||
| 544 | Ga0495621_0093793 | |||
| 545 | Ga0495621_0319423 | |||
| 546 | Ga0495597_0278988 | |||
| 547 | Ga0495633_0414271 | |||
| 548 | Ga0495668_0022696 | |||
| 549 | Ga0495668_0037384 | |||
| 550 | Ga0495668_0161315 | |||
| 551 | Ga0495668_0207967 | |||
| 552 | Ga0495668_0296354 | |||
| 553 | Ga0495668_0321191 | |||
| 554 | Ga0495668_0536744 | |||
| 555 | Ga0495625_0136356 | |||
| 556 | Ga0495625_0183132 | |||
| 557 | Ga0495669_0123475 | |||
| 558 | Ga0495672_0118471 | |||
| 559 | Ga0495677_0336618 | |||
| 560 | Ga0495681_0148281 | |||
| 561 | Ga0495686_0047582 | |||
| 562 | Ga0495686_0236177 | |||
| 563 | Ga0495686_0539486 | |||
| 564 | Ga0496103_0990198 | |||
| 565 | Ga0496105_1278181 | |||
| 566 | Ga0496113_1267162 | |||
| 567 | Ga0496115_0001656 | |||
| 568 | Ga0496115_0125920 | |||
| 569 | Ga0496118_0029634 | |||
| 570 | Ga0501032_0263883 | |||
| 571 | Ga0501034_0981866 | |||
| 572 | Ga0501047_0130793 | |||
| 573 | Ga0501047_0681338 | |||
| 574 | Ga0501048_0114842 | |||
| 575 | Ga0501048_0601065 | |||
| 576 | Ga0501071_0972470 | |||
| 577 | Ga0501076_1023544 | |||
| 578 | Ga0501236_024192 | |||
| 579 | Ga0501253_032159 | |||
| 580 | Ga0501257_243022 | |||
| 581 | Ga0501264_002030 | |||
| 582 | Ga0501283_006983 | |||
| 583 | Ga0501035_1067651 | |||
| 584 | Ga0501044_0544946 | |||
| 585 | nmdc:mga03683_268977_c1 | |||
| 586 | nmdc:mga0yw44_137203_c1 | |||
| 587 | nmdc:mga0k408_624647_c1 | |||
| 588 | nmdc:mga05p37_1306481_c1 | |||
| 589 | nmdc:mga05p37_8609_c1 | |||
| 590 | nmdc:mga09592_10367_c1 | |||
| 591 | nmdc:mga09592_537_c1 | |||
| 592 | nmdc:mga0qj67_1600_c1 | |||
| 593 | nmdc:mga06r32_1739_c1 | |||
| 594 | nmdc:mga06r32_1784_c1 | |||
| 595 | nmdc:mga06r32_37189_c1 | |||
| 596 | nmdc:mga08y16_195618_c1 | |||
| 597 | Ga0500583_0096359 | |||
| 598 | Ga0500641_0001909 | |||
| 599 | Ga0500555_016683 | |||
| 600 | Ga0500556_0149778 | |||
| 601 | Ga0500562_000312 | |||
| 602 | Ga0500593_197991 | |||
| 603 | Ga0500594_0101762 | |||
| 604 | Ga0500595_021851 | |||
| 605 | Ga0500617_089981 | |||
| 606 | Ga0500628_071775 | |||
| 607 | Ga0500568_0014335 | |||
| 608 | Ga0500568_0053247 | |||
| 609 | Ga0500604_0127103 | |||
| 610 | Ga0500622_0002197 | |||
| 611 | Ga0500645_001174 | |||
| 612 | Ga0587111_0053532 | |||
| 613 | 2513892680 | |||
| 614 | 2517103973 | |||
| 615 | 2528849231 | |||
| 616 | 2824775944 | |||
| 617 | 2841959847 | |||
| 618 | 2842695997 | |||
| 619 | 2879109058 | |||
| 620 | 2908741902 | |||
| 621 | 2932813784 | |||
| 622 | 2932822247 | |||
| 623 | 2935620736 | |||
| 624 | 2935639815 | |||
| 625 | 2935650446 | |||
| 626 | 2935658593 | |||
| 627 | 2935667348 | |||
| 628 | 2935697204 | |||
| 629 | 2935705088 | |||
| 630 | 2935762012 | |||
| 631 | 2935803511 | |||
| 632 | 2935829298 | |||
| 633 | 2935842724 | |||
| 634 | 2935858544 | |||
| 635 | 2935867035 | |||
| 636 | 2935877165 | |||
| 637 | 2935908654 | |||
| 638 | 2935917799 | |||
| 639 | 2935926773 | |||
| 640 | 2935935222 | |||
| 641 | 2935943673 | |||
| 642 | 2935952110 | |||
| 643 | 2935968235 | |||
| 644 | 2935995199 | |||
| 645 | 2936004086 | |||
| 646 | 2936012995 | |||
| 647 | 2936021918 | |||
| 648 | 2936030288 | |||
| 649 | 2936048112 | |||
| 650 | 2936059745 | |||
| 651 | 2941544427 | |||
| 652 | 8019579328 | |||
| 653 | 8019597383 | |||
| 654 | 8019604302 | |||
| 655 | 8019614230 | |||
| 656 | 8019690553 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8gy3-assembly1.cif.gz_B | cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans | 0.9752 | 2 | 150 |
| 8gy3-assembly1.cif.gz_B | cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans | 0.9563 | 2 | 150 |
| 1rm6-assembly1.cif.gz_C | structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica | 0.9553 | 2 | 150 |
| 1dgj-assembly1.cif.gz_A | crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 | 0.9525 | 1 | 150 |
| 1n5w-assembly1.cif.gz_D | crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form | 0.9501 | 1 | 150 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4zohC02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9633 | 84 | 150 | 1.10.150.120 |
| 5y6qA01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9579 | 2 | 76 | 3.10.20.30 |
| af_Q46801_1_79_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9537 | 2 | 74 | 3.10.20.30 |
| 3hrdH02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9535 | 85 | 150 | 1.10.150.120 |
| 1n60A02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9533 | 85 | 150 | 1.10.150.120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q1C9E9-F1-model_v4 | (2Fe-2S)-binding protein | 0.9923 | 1 | 150 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A521UQF3-F1-model_v4 | (2Fe-2S)-binding protein | 0.9907 | 1 | 150 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A3D8YFZ6-F1-model_v4 | (2Fe-2S)-binding protein | 0.9904 | 1 | 151 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A1I2BQ61-F1-model_v4 | Isoquinoline 1-oxidoreductase, alpha subunit | 0.9888 | 1 | 151 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A1H6Q4U8-F1-model_v4 | Isoquinoline 1-oxidoreductase, alpha subunit | 0.9878 | 1 | 150 |
GO:0016491
GO:0046872 GO:0051537 |