F409379

General Info

Members Datasets Scaffolds Average Seq Length
328 241 656 153

Family's Representative Sequence

Representative Sequence 3300046471|Ga0495650_0182711|Ga0495650_0182711_153_701
Length 182
Sequence MYRRFAARLPRSSIAPEKRETRAMAYTLNVNGKALSADVDGDTPLLWTLRDALGIVGPKYGCGVAACGACTVHVDGQPMRSCQIPTDSVGKAKITTIEGMAAHPVGKKVQAAWMELDVAQCGYCQPGQIMSATALLAKTPKPTDAQIDEAMNGNICRCATYVRIRAAIKRASGQKEVSDDLS

Samples

Sample ID Description Type Environment
1 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
64 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
65 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
103 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
104 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
123 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
124 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
125 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
126 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
127 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
128 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
129 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
130 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
131 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
132 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
133 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
134 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
135 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
136 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
137 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
138 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
142 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
143 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
144 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
145 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
146 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
147 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
148 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
149 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
150 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
153 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
154 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
155 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
156 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
157 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
162 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
167 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
168 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
169 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
170 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
171 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
172 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
176 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
177 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
180 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
181 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
184 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
185 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
186 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
187 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
188 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
189 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
190 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
191 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
192 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
193 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
194 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
195 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
196 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
197 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
199 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
200 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
201 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
202 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
203 2842694124 Methylopila sp. R-72369 Isolate Unclassified
204 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
205 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
206 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
207 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
208 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
209 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
210 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
211 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
212 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
213 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
214 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
215 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
216 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
217 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
218 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
219 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
220 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
221 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
222 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
223 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
224 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
225 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
226 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
227 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
228 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
229 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
230 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
231 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
232 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
233 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
234 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
235 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
236 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
237 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
238 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
239 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
240 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
241 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.28
Metatranscriptomes 0.3
Isolates 13.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.06
Nodule 12.8
Rhizoplane 1.52
Rhizosphere 72.56
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495650_0182711 3300046471 Bacteria 737
2 JGI25406J46586_10004143 3300003203 Bacteria 6769
3 JGI25160J50197_1005469 3300003354 Bacteria 5282
4 JGI25404J52841_10007099 3300003659 Bacteria 2362
5 Ga0055530_10000205 3300003791 Bacteria 53469
6 Ga0055531_10005812 3300003794 Bacteria 7140
7 Ga0055543_1006198 3300004625 Bacteria 2928
8 Ga0065165_1001248 3300005262 Bacteria 28913
9 Ga0065165_1047805 3300005262 Bacteria 1233
10 Ga0065707_10014152 3300005295 Bacteria 1877
11 Ga0070658_10188129 3300005327 Bacteria 1740
12 Ga0070658_10244750 3300005327 Bacteria 1521
13 Ga0070658_10861826 3300005327 Bacteria 787
14 Ga0070690_100536827 3300005330 Bacteria 880
15 Ga0068869_101315851 3300005334 Bacteria 638
16 Ga0070666_10720309 3300005335 Bacteria 732
17 Ga0070680_100003700 3300005336 Bacteria 11425
18 Ga0070682_100745645 3300005337 Bacteria 790
19 Ga0070660_100015877 3300005339 Bacteria 5451
20 Ga0070660_100069339 3300005339 Bacteria 2749
21 Ga0070689_101750425 3300005340 Bacteria 566
22 Ga0070691_10012086 3300005341 Bacteria 3953
23 Ga0070661_100089589 3300005344 Bacteria 2278
24 Ga0070669_100033658 3300005353 Bacteria 3708
25 Ga0070674_100359156 3300005356 Bacteria 1179
26 Ga0070659_100000315 3300005366 Bacteria 37706
27 Ga0070659_100004811 3300005366 Bacteria 9647
28 Ga0070681_10022689 3300005458 Bacteria 6306
29 Ga0070681_10033063 3300005458 Bacteria 5191
30 Ga0068867_100956324 3300005459 Bacteria 774
31 Ga0070698_101751855 3300005471 Bacteria 574
32 Ga0070679_100000858 3300005530 Bacteria 26439
33 Ga0070679_100070743 3300005530 Bacteria 3480
34 Ga0070679_100882769 3300005530 Bacteria 838
35 Ga0068853_100022571 3300005539 Bacteria 5257
36 Ga0068853_100165122 3300005539 Bacteria 2000
37 Ga0068853_101405639 3300005539 Bacteria 675
38 Ga0070672_100671338 3300005543 Bacteria 906
39 Ga0070696_101461718 3300005546 Bacteria 584
40 Ga0070665_100000593 3300005548 Bacteria 50386
41 Ga0070704_101648439 3300005549 Bacteria 592
42 Ga0068855_100019041 3300005563 Bacteria 8252
43 Ga0068855_100034384 3300005563 Bacteria 6046
44 Ga0068855_100140049 3300005563 Bacteria 2758
45 Ga0068855_100720940 3300005563 Bacteria 1066
46 Ga0068857_100293407 3300005577 Bacteria 1498
47 Ga0068854_101582519 3300005578 Bacteria 597
48 Ga0068852_101570910 3300005616 Bacteria 680
49 Ga0068864_100888306 3300005618 Bacteria 879
50 Ga0068861_100108906 3300005719 Bacteria 2217
51 Ga0068870_10531259 3300005840 Bacteria 789
52 Ga0068863_100560408 3300005841 Bacteria 1129
53 Ga0068862_100050135 3300005844 Bacteria 3567
54 Ga0081540_1049363 3300005983 Bacteria 2100
55 Ga0075362_10015892 3300006177 Bacteria 3070
56 Ga0075370_10032177 3300006353 Bacteria 2931
57 Ga0075428_100014187 3300006844 Bacteria 8863
58 Ga0075428_100200667 3300006844 Bacteria 2156
59 Ga0075430_100007770 3300006846 Bacteria 9060
60 Ga0075431_100001391 3300006847 Bacteria 22210
61 Ga0075431_100008453 3300006847 Bacteria 10309
62 Ga0075431_100025331 3300006847 Bacteria 6081
63 Ga0075434_100227919 3300006871 Bacteria 1883
64 Ga0075429_100002207 3300006880 Bacteria 16292
65 Ga0075429_100018079 3300006880 Bacteria 6098
66 Ga0105240_10036729 3300009093 Bacteria 6300
67 Ga0105240_10094860 3300009093 Bacteria 3639
68 Ga0105240_10307810 3300009093 Bacteria 1810
69 Ga0105240_11392731 3300009093 Bacteria 737
70 Ga0111539_12045656 3300009094 Bacteria 664
71 Ga0105245_10282450 3300009098 Bacteria 1623
72 Ga0114129_11335917 3300009147 Unclassified 887
73 Ga0114129_11563358 3300009147 Bacteria 809
74 Ga0105242_10879630 3300009176 Bacteria 894
75 Ga0105237_10225833 3300009545 Bacteria 1873
76 Ga0105237_10663591 3300009545 Bacteria 1049
77 Ga0105237_11111910 3300009545 Bacteria 797
78 Ga0105238_10018993 3300009551 Bacteria 7001
79 Ga0105238_10103838 3300009551 Bacteria 2823
80 Ga0105238_10128657 3300009551 Bacteria 2511
81 Ga0105238_10129883 3300009551 Bacteria 2497
82 Ga0105238_10874501 3300009551 Bacteria 916
83 Ga0105249_10815622 3300009553 Bacteria 997
84 Ga0105239_11465927 3300010375 Bacteria 788
85 Ga0157370_10147823 3300013104 Bacteria 2187
86 Ga0157378_12554679 3300013297 Bacteria 563
87 Ga0163162_10984263 3300013306 Bacteria 953
88 Ga0157375_12185448 3300013308 Bacteria 659
89 Ga0157375_12629919 3300013308 Bacteria 601
90 Ga0157380_10004303 3300014326 Bacteria 9871
91 Ga0157380_10178971 3300014326 Bacteria 1861
92 Ga0207425_1058694 3300025245 Bacteria 684
93 Ga0209026_1000794 3300025250 Bacteria 17234
94 Ga0209673_1045406 3300025273 Bacteria 1207
95 Ga0209564_1004957 3300025295 Bacteria 7857
96 Ga0209758_1004468 3300025297 Bacteria 11623
97 Ga0209050_1000095 3300025298 Bacteria 242722
98 Ga0209257_1000106 3300025304 Bacteria 242634
99 Ga0209257_1008564 3300025304 Bacteria 5768
100 Ga0207680_10276931 3300025903 Bacteria 1165
101 Ga0207643_10041048 3300025908 Bacteria 2606
102 Ga0207705_10000556 3300025909 Bacteria 31398
103 Ga0207705_10048116 3300025909 Bacteria 3067
104 Ga0207705_10058297 3300025909 Bacteria 2786
105 Ga0207705_10458556 3300025909 Bacteria 989
106 Ga0207705_10622541 3300025909 Bacteria 839
107 Ga0207707_10006630 3300025912 Bacteria 10102
108 Ga0207707_10058918 3300025912 Bacteria 3341
109 Ga0207695_10018667 3300025913 Bacteria 8011
110 Ga0207695_10048341 3300025913 Bacteria 4493
111 Ga0207695_10087845 3300025913 Bacteria 3131
112 Ga0207695_10607232 3300025913 Bacteria 975
113 Ga0207671_10663028 3300025914 Bacteria 830
114 Ga0207660_10000773 3300025917 Bacteria 21298
115 Ga0207657_10000693 3300025919 Bacteria 35842
116 Ga0207657_10048705 3300025919 Bacteria 3698
117 Ga0207649_10125427 3300025920 Bacteria 1737
118 Ga0207652_10002139 3300025921 Bacteria 16935
119 Ga0207652_10028567 3300025921 Bacteria 4655
120 Ga0207681_10324400 3300025923 Bacteria 1225
121 Ga0207694_10032045 3300025924 Bacteria 4021
122 Ga0207694_10082540 3300025924 Bacteria 2526
123 Ga0207694_10923491 3300025924 Bacteria 738
124 Ga0207694_10980310 3300025924 Bacteria 715
125 Ga0207650_10854983 3300025925 Bacteria 772
126 Ga0207664_10687441 3300025929 Bacteria 920
127 Ga0207690_10000843 3300025932 Bacteria 19644
128 Ga0207690_10010011 3300025932 Bacteria 5632
129 Ga0207690_10696362 3300025932 Bacteria 835
130 Ga0207669_10091432 3300025937 Bacteria 1982
131 Ga0207689_10442863 3300025942 Bacteria 1085
132 Ga0207689_10526016 3300025942 Bacteria 992
133 Ga0207661_11649140 3300025944 Bacteria 586
134 Ga0207667_10008126 3300025949 Bacteria 12495
135 Ga0207667_10017742 3300025949 Bacteria 8004
136 Ga0207667_10022302 3300025949 Bacteria 6998
137 Ga0207668_10004710 3300025972 Bacteria 8023
138 Ga0207668_11026786 3300025972 Bacteria 738
139 Ga0207639_10040152 3300026041 Bacteria 3491
140 Ga0207639_10049578 3300026041 Bacteria 3184
141 Ga0207639_10680457 3300026041 Bacteria 953
142 Ga0207641_10955810 3300026088 Bacteria 852
143 Ga0207648_10348593 3300026089 Bacteria 1334
144 Ga0207676_11619193 3300026095 Bacteria 645
145 Ga0207674_10106123 3300026116 Bacteria 2787
146 Ga0207674_10231581 3300026116 Bacteria 1795
147 Ga0207675_100221018 3300026118 Bacteria 1825
148 Ga0207675_100246883 3300026118 Bacteria 1726
149 Ga0207683_10398606 3300026121 Bacteria 1266
150 Ga0207698_10706316 3300026142 Bacteria 1004
151 Ga0207698_11424443 3300026142 Bacteria 708
152 Ga0210000_1063002 3300027462 Bacteria 601
153 Ga0209999_1023536 3300027543 Bacteria 1135
154 Ga0268266_10000003 3300028379 Bacteria 1701703
155 Ga0268265_10049291 3300028380 Bacteria 3166
156 Ga0307517_10001755 3300028786 Bacteria 35724
157 Ga0307517_10038145 3300028786 Bacteria 5335
158 Ga0307511_10004748 3300030521 Bacteria 13890
159 Ga0307513_10001025 3300031456 Bacteria 40478
160 Ga0307513_10011358 3300031456 Bacteria 11074
161 Ga0307513_10680049 3300031456 Bacteria 735
162 Ga0307408_100301852 3300031548 Bacteria 1342
163 Ga0307408_100384731 3300031548 Bacteria 1200
164 Ga0316575_10003711 3300031665 Bacteria 5300
165 Ga0307405_10445581 3300031731 Bacteria 1025
166 Ga0307405_11104679 3300031731 Bacteria 682
167 Ga0307413_10352088 3300031824 Bacteria 1137
168 Ga0307406_10425728 3300031901 Bacteria 1059
169 Ga0307406_11084921 3300031901 Bacteria 691
170 Ga0307412_10193223 3300031911 Bacteria 1540
171 Ga0307416_100394269 3300032002 Bacteria 1419
172 Ga0307414_10606454 3300032004 Bacteria 982
173 Ga0307414_11090711 3300032004 Bacteria 737
174 Ga0307411_10170849 3300032005 Bacteria 1639
175 Ga0307411_10259798 3300032005 Bacteria 1371
176 Ga0307411_10377584 3300032005 Bacteria 1165
177 Ga0307415_100343903 3300032126 Bacteria 1253
178 Ga0307415_100929535 3300032126 Bacteria 804
179 Ga0373936_0007158 3300035113 Bacteria 4199
180 Ga0373927_0040469 3300035695 Bacteria 3023
181 Ga0395899_0001363 3300037312 Bacteria 20958
182 Ga0395900_0000072 3300037418 Bacteria 187428
183 Ga0395898_0100789 3300037466 Bacteria 2773
184 Ga0395905_0022752 3300037471 Bacteria 5926
185 Ga0395905_0284544 3300037471 Bacteria 1540
186 Ga0395905_0302855 3300037471 Bacteria 1486
187 Ga0395901_0000032 3300038443 Bacteria 235172
188 Ga0439436_0031185 3300041404 Bacteria 1547
189 Ga0439461_0000413 3300041410 Bacteria 6168
190 Ga0439465_0000195 3300041413 Bacteria 15884
191 Ga0439465_0217357 3300041413 Bacteria 700
192 Ga0439431_0001056 3300041997 Bacteria 5977
193 Ga0439433_0083841 3300041999 Bacteria 778
194 Ga0439433_0110658 3300041999 Bacteria 687
195 Ga0439445_0006530 3300042004 Bacteria 2682
196 Ga0439432_007759 3300042006 Bacteria 3787
197 Ga0439449_0278066 3300042007 Bacteria 631
198 Ga0439452_019317 3300042010 Bacteria 1804
199 Ga0439462_0000744 3300042015 Bacteria 6738
200 Ga0439434_0001078 3300042435 Bacteria 7916
201 Ga0439459_0198479 3300042438 Bacteria 547
202 Ga0451577_0241438 3300042876 Bacteria 1635
203 Ga0466965_0076787 3300044683 Bacteria 1686
204 Ga0453684_0331670 3300044712 Bacteria 1720
205 Ga0466971_0333899 3300044719 Bacteria 732
206 Ga0466959_0717203 3300045049 Bacteria 670
207 Ga0466958_0343703 3300045836 Bacteria 960
208 Ga0466958_0688324 3300045836 Bacteria 666
209 Ga0495629_0173503 3300046459 Bacteria 1496
210 Ga0495596_0000095 3300046500 Bacteria 62707
211 Ga0495606_0537409 3300046507 Bacteria 584
212 Ga0495616_0218891 3300046513 Bacteria 830
213 Ga0495631_0324233 3300046518 Bacteria 655
214 Ga0495632_0324162 3300046519 Bacteria 680
215 Ga0495598_0024982 3300046537 Bacteria 1625
216 Ga0495621_0093793 3300046539 Bacteria 1134
217 Ga0495621_0319423 3300046539 Bacteria 647
218 Ga0495597_0278988 3300046542 Bacteria 651
219 Ga0495633_0414271 3300046558 Bacteria 609
220 Ga0495668_0022696 3300046616 Bacteria 3586
221 Ga0495668_0037384 3300046616 Bacteria 2716
222 Ga0495668_0161315 3300046616 Bacteria 1228
223 Ga0495668_0207967 3300046616 Bacteria 1071
224 Ga0495668_0296354 3300046616 Bacteria 886
225 Ga0495668_0321191 3300046616 Bacteria 849
226 Ga0495668_0536744 3300046616 Bacteria 645
227 Ga0495625_0136356 3300046660 Bacteria 1659
228 Ga0495625_0183132 3300046660 Bacteria 1391
229 Ga0495669_0123475 3300046684 Bacteria 1215
230 Ga0495672_0118471 3300047320 Bacteria 1411
231 Ga0495677_0336618 3300047445 Bacteria 595
232 Ga0495681_0148281 3300047470 Bacteria 986
233 Ga0495686_0047582 3300047472 Bacteria 2707
234 Ga0495686_0236177 3300047472 Bacteria 1033
235 Ga0495686_0539486 3300047472 Bacteria 610
236 Ga0496103_0990198 3300048906 Bacteria 524
237 Ga0496105_1278181 3300048908 Bacteria 537
238 Ga0496113_1267162 3300048916 Bacteria 574
239 Ga0496115_0001656 3300048918 Bacteria 16024
240 Ga0496115_0125920 3300048918 Bacteria 2110
241 Ga0496118_0029634 3300048921 Bacteria 4586
242 Ga0501032_0263883 3300049569 Bacteria 1116
243 Ga0501034_0981866 3300049571 Bacteria 729
244 Ga0501047_0130793 3300049581 Bacteria 2391
245 Ga0501047_0681338 3300049581 Bacteria 846
246 Ga0501048_0114842 3300049582 Bacteria 1902
247 Ga0501048_0601065 3300049582 Bacteria 790
248 Ga0501071_0972470 3300049587 Bacteria 655
249 Ga0501076_1023544 3300049592 Bacteria 680
250 Ga0501236_024192 3300049670 Bacteria 920
251 Ga0501253_032159 3300049683 Bacteria 1008
252 Ga0501257_243022 3300049686 Bacteria 531
253 Ga0501264_002030 3300049761 Bacteria 1946
254 Ga0501283_006983 3300049779 Bacteria 1597
255 Ga0501035_1067651 3300049822 Bacteria 632
256 Ga0501044_0544946 3300049823 Bacteria 1058
257 nmdc:mga03683_268977_c1 3300050489 Bacteria 795
258 nmdc:mga0yw44_137203_c1 3300050492 Bacteria 1587
259 nmdc:mga0k408_624647_c1 3300050493 Bacteria 634
260 nmdc:mga05p37_1306481_c1 3300050507 Bacteria 739
261 nmdc:mga05p37_8609_c1 3300050507 Bacteria 12062
262 nmdc:mga09592_10367_c1 3300050508 Bacteria 7582
263 nmdc:mga09592_537_c1 3300050508 Bacteria 28691
264 nmdc:mga0qj67_1600_c1 3300050509 Bacteria 15931
265 nmdc:mga06r32_1739_c1 3300050510 Bacteria 19582
266 nmdc:mga06r32_1784_c1 3300050510 Bacteria 19318
267 nmdc:mga06r32_37189_c1 3300050510 Bacteria 4605
268 nmdc:mga08y16_195618_c1 3300050511 Bacteria 2096
269 Ga0500583_0096359 3300053092 Bacteria 1445
270 Ga0500641_0001909 3300053096 Bacteria 7404
271 Ga0500555_016683 3300053103 Bacteria 2117
272 Ga0500556_0149778 3300053104 Bacteria 919
273 Ga0500562_000312 3300053108 Bacteria 11780
274 Ga0500593_197991 3300053117 Bacteria 728
275 Ga0500594_0101762 3300053118 Bacteria 885
276 Ga0500595_021851 3300053119 Bacteria 2277
277 Ga0500617_089981 3300053124 Bacteria 1315
278 Ga0500628_071775 3300053129 Bacteria 869
279 Ga0500568_0014335 3300053139 Bacteria 3582
280 Ga0500568_0053247 3300053139 Bacteria 1587
281 Ga0500604_0127103 3300053151 Bacteria 855
282 Ga0500622_0002197 3300053156 Bacteria 14416
283 Ga0500645_001174 3300053730 Bacteria 13991
284 Ga0587111_0053532 3300060346 Bacteria 898
285 2513892680 2513237141 Bacteria 8496279
286 2517103973 2517093001 Bacteria 9002274
287 2528849231 2528768022 Bacteria 10457665
288 2824775944 2824773399 Bacteria 8360218
289 2841959847 2841957949 Bacteria 8652217
290 2842695997 2842694124 Bacteria 4063419
291 2879109058 2879099564 Bacteria 10442239
292 2908741902 2908739725 Bacteria 8628932
293 2932813784 2932809354 Bacteria 9135765
294 2932822247 2932818245 Bacteria 9955613
295 2935620736 2935616580 Bacteria 9032984
296 2935639815 2935638405 Bacteria 10015038
297 2935650446 2935648319 Bacteria 8801166
298 2935658593 2935656913 Bacteria 8965014
299 2935667348 2935665750 Bacteria 9571747
300 2935697204 2935694250 Bacteria 9291695
301 2935705088 2935703347 Bacteria 10242284
302 2935762012 2935760218 Bacteria 9817913
303 2935803511 2935801545 Bacteria 9301974
304 2935829298 2935827899 Bacteria 10038562
305 2935842724 2935837841 Bacteria 9454360
306 2935858544 2935855204 Bacteria 9035059
307 2935867035 2935864058 Bacteria 9784707
308 2935877165 2935873716 Bacteria 9632195
309 2935908654 2935908558 Bacteria 8568796
310 2935917799 2935916978 Bacteria 9113783
311 2935926773 2935926038 Bacteria 8601059
312 2935935222 2935934488 Bacteria 8602579
313 2935943673 2935942939 Bacteria 8599779
314 2935952110 2935951376 Bacteria 8602333
315 2935968235 2935967501 Bacteria 8603075
316 2935995199 2935992306 Bacteria 9802711
317 2936004086 2936002035 Bacteria 9362176
318 2936012995 2936011229 Bacteria 8801034
319 2936021918 2936019824 Bacteria 8804134
320 2936030288 2936028420 Bacteria 8965941
321 2936048112 2936046547 Bacteria 8903709
322 2936059745 2936055302 Bacteria 8785755
323 2941544427 2941538514 Bacteria 9402094
324 8019579328 8019576017 Bacteria 10049540
325 8019597383 8019586578 Bacteria 10212056
326 8019604302 8019597564 Bacteria 10041141
327 8019614230 8019608314 Bacteria 10042931
328 8019690553 8019687851 Bacteria 8712826
329 Ga0495650_0182711
330 JGI25406J46586_10004143
331 JGI25160J50197_1005469
332 JGI25404J52841_10007099
333 Ga0055530_10000205
334 Ga0055531_10005812
335 Ga0055543_1006198
336 Ga0065165_1001248
337 Ga0065165_1047805
338 Ga0065707_10014152
339 Ga0070658_10188129
340 Ga0070658_10244750
341 Ga0070658_10861826
342 Ga0070690_100536827
343 Ga0068869_101315851
344 Ga0070666_10720309
345 Ga0070680_100003700
346 Ga0070682_100745645
347 Ga0070660_100015877
348 Ga0070660_100069339
349 Ga0070689_101750425
350 Ga0070691_10012086
351 Ga0070661_100089589
352 Ga0070669_100033658
353 Ga0070674_100359156
354 Ga0070659_100000315
355 Ga0070659_100004811
356 Ga0070681_10022689
357 Ga0070681_10033063
358 Ga0068867_100956324
359 Ga0070698_101751855
360 Ga0070679_100000858
361 Ga0070679_100070743
362 Ga0070679_100882769
363 Ga0068853_100022571
364 Ga0068853_100165122
365 Ga0068853_101405639
366 Ga0070672_100671338
367 Ga0070696_101461718
368 Ga0070665_100000593
369 Ga0070704_101648439
370 Ga0068855_100019041
371 Ga0068855_100034384
372 Ga0068855_100140049
373 Ga0068855_100720940
374 Ga0068857_100293407
375 Ga0068854_101582519
376 Ga0068852_101570910
377 Ga0068864_100888306
378 Ga0068861_100108906
379 Ga0068870_10531259
380 Ga0068863_100560408
381 Ga0068862_100050135
382 Ga0081540_1049363
383 Ga0075362_10015892
384 Ga0075370_10032177
385 Ga0075428_100014187
386 Ga0075428_100200667
387 Ga0075430_100007770
388 Ga0075431_100001391
389 Ga0075431_100008453
390 Ga0075431_100025331
391 Ga0075434_100227919
392 Ga0075429_100002207
393 Ga0075429_100018079
394 Ga0105240_10036729
395 Ga0105240_10094860
396 Ga0105240_10307810
397 Ga0105240_11392731
398 Ga0111539_12045656
399 Ga0105245_10282450
400 Ga0114129_11335917
401 Ga0114129_11563358
402 Ga0105242_10879630
403 Ga0105237_10225833
404 Ga0105237_10663591
405 Ga0105237_11111910
406 Ga0105238_10018993
407 Ga0105238_10103838
408 Ga0105238_10128657
409 Ga0105238_10129883
410 Ga0105238_10874501
411 Ga0105249_10815622
412 Ga0105239_11465927
413 Ga0157370_10147823
414 Ga0157378_12554679
415 Ga0163162_10984263
416 Ga0157375_12185448
417 Ga0157375_12629919
418 Ga0157380_10004303
419 Ga0157380_10178971
420 Ga0207425_1058694
421 Ga0209026_1000794
422 Ga0209673_1045406
423 Ga0209564_1004957
424 Ga0209758_1004468
425 Ga0209050_1000095
426 Ga0209257_1000106
427 Ga0209257_1008564
428 Ga0207680_10276931
429 Ga0207643_10041048
430 Ga0207705_10000556
431 Ga0207705_10048116
432 Ga0207705_10058297
433 Ga0207705_10458556
434 Ga0207705_10622541
435 Ga0207707_10006630
436 Ga0207707_10058918
437 Ga0207695_10018667
438 Ga0207695_10048341
439 Ga0207695_10087845
440 Ga0207695_10607232
441 Ga0207671_10663028
442 Ga0207660_10000773
443 Ga0207657_10000693
444 Ga0207657_10048705
445 Ga0207649_10125427
446 Ga0207652_10002139
447 Ga0207652_10028567
448 Ga0207681_10324400
449 Ga0207694_10032045
450 Ga0207694_10082540
451 Ga0207694_10923491
452 Ga0207694_10980310
453 Ga0207650_10854983
454 Ga0207664_10687441
455 Ga0207690_10000843
456 Ga0207690_10010011
457 Ga0207690_10696362
458 Ga0207669_10091432
459 Ga0207689_10442863
460 Ga0207689_10526016
461 Ga0207661_11649140
462 Ga0207667_10008126
463 Ga0207667_10017742
464 Ga0207667_10022302
465 Ga0207668_10004710
466 Ga0207668_11026786
467 Ga0207639_10040152
468 Ga0207639_10049578
469 Ga0207639_10680457
470 Ga0207641_10955810
471 Ga0207648_10348593
472 Ga0207676_11619193
473 Ga0207674_10106123
474 Ga0207674_10231581
475 Ga0207675_100221018
476 Ga0207675_100246883
477 Ga0207683_10398606
478 Ga0207698_10706316
479 Ga0207698_11424443
480 Ga0210000_1063002
481 Ga0209999_1023536
482 Ga0268266_10000003
483 Ga0268265_10049291
484 Ga0307517_10001755
485 Ga0307517_10038145
486 Ga0307511_10004748
487 Ga0307513_10001025
488 Ga0307513_10011358
489 Ga0307513_10680049
490 Ga0307408_100301852
491 Ga0307408_100384731
492 Ga0316575_10003711
493 Ga0307405_10445581
494 Ga0307405_11104679
495 Ga0307413_10352088
496 Ga0307406_10425728
497 Ga0307406_11084921
498 Ga0307412_10193223
499 Ga0307416_100394269
500 Ga0307414_10606454
501 Ga0307414_11090711
502 Ga0307411_10170849
503 Ga0307411_10259798
504 Ga0307411_10377584
505 Ga0307415_100343903
506 Ga0307415_100929535
507 Ga0373936_0007158
508 Ga0373927_0040469
509 Ga0395899_0001363
510 Ga0395900_0000072
511 Ga0395898_0100789
512 Ga0395905_0022752
513 Ga0395905_0284544
514 Ga0395905_0302855
515 Ga0395901_0000032
516 Ga0439436_0031185
517 Ga0439461_0000413
518 Ga0439465_0000195
519 Ga0439465_0217357
520 Ga0439431_0001056
521 Ga0439433_0083841
522 Ga0439433_0110658
523 Ga0439445_0006530
524 Ga0439432_007759
525 Ga0439449_0278066
526 Ga0439452_019317
527 Ga0439462_0000744
528 Ga0439434_0001078
529 Ga0439459_0198479
530 Ga0451577_0241438
531 Ga0466965_0076787
532 Ga0453684_0331670
533 Ga0466971_0333899
534 Ga0466959_0717203
535 Ga0466958_0343703
536 Ga0466958_0688324
537 Ga0495629_0173503
538 Ga0495596_0000095
539 Ga0495606_0537409
540 Ga0495616_0218891
541 Ga0495631_0324233
542 Ga0495632_0324162
543 Ga0495598_0024982
544 Ga0495621_0093793
545 Ga0495621_0319423
546 Ga0495597_0278988
547 Ga0495633_0414271
548 Ga0495668_0022696
549 Ga0495668_0037384
550 Ga0495668_0161315
551 Ga0495668_0207967
552 Ga0495668_0296354
553 Ga0495668_0321191
554 Ga0495668_0536744
555 Ga0495625_0136356
556 Ga0495625_0183132
557 Ga0495669_0123475
558 Ga0495672_0118471
559 Ga0495677_0336618
560 Ga0495681_0148281
561 Ga0495686_0047582
562 Ga0495686_0236177
563 Ga0495686_0539486
564 Ga0496103_0990198
565 Ga0496105_1278181
566 Ga0496113_1267162
567 Ga0496115_0001656
568 Ga0496115_0125920
569 Ga0496118_0029634
570 Ga0501032_0263883
571 Ga0501034_0981866
572 Ga0501047_0130793
573 Ga0501047_0681338
574 Ga0501048_0114842
575 Ga0501048_0601065
576 Ga0501071_0972470
577 Ga0501076_1023544
578 Ga0501236_024192
579 Ga0501253_032159
580 Ga0501257_243022
581 Ga0501264_002030
582 Ga0501283_006983
583 Ga0501035_1067651
584 Ga0501044_0544946
585 nmdc:mga03683_268977_c1
586 nmdc:mga0yw44_137203_c1
587 nmdc:mga0k408_624647_c1
588 nmdc:mga05p37_1306481_c1
589 nmdc:mga05p37_8609_c1
590 nmdc:mga09592_10367_c1
591 nmdc:mga09592_537_c1
592 nmdc:mga0qj67_1600_c1
593 nmdc:mga06r32_1739_c1
594 nmdc:mga06r32_1784_c1
595 nmdc:mga06r32_37189_c1
596 nmdc:mga08y16_195618_c1
597 Ga0500583_0096359
598 Ga0500641_0001909
599 Ga0500555_016683
600 Ga0500556_0149778
601 Ga0500562_000312
602 Ga0500593_197991
603 Ga0500594_0101762
604 Ga0500595_021851
605 Ga0500617_089981
606 Ga0500628_071775
607 Ga0500568_0014335
608 Ga0500568_0053247
609 Ga0500604_0127103
610 Ga0500622_0002197
611 Ga0500645_001174
612 Ga0587111_0053532
613 2513892680
614 2517103973
615 2528849231
616 2824775944
617 2841959847
618 2842695997
619 2879109058
620 2908741902
621 2932813784
622 2932822247
623 2935620736
624 2935639815
625 2935650446
626 2935658593
627 2935667348
628 2935697204
629 2935705088
630 2935762012
631 2935803511
632 2935829298
633 2935842724
634 2935858544
635 2935867035
636 2935877165
637 2935908654
638 2935917799
639 2935926773
640 2935935222
641 2935943673
642 2935952110
643 2935968235
644 2935995199
645 2936004086
646 2936012995
647 2936021918
648 2936030288
649 2936048112
650 2936059745
651 2941544427
652 8019579328
653 8019597383
654 8019604302
655 8019614230
656 8019690553

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

96

169

0.94

PF13085

Fer2_3

2Fe-2S iron-sulfur cluster binding domain

45

112

0.92

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

28

95

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9752 2 150
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9563 2 150
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.9553 2 150
1dgj-assembly1.cif.gz_A crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 0.9525 1 150
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9501 1 150
ID Description Score Start End Superfamily
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9633 84 150 1.10.150.120
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9579 2 76 3.10.20.30
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9537 2 74 3.10.20.30
3hrdH02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9535 85 150 1.10.150.120
1n60A02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9533 85 150 1.10.150.120
ID Description Score Start End GO Terms
AF-A0A4Q1C9E9-F1-model_v4 (2Fe-2S)-binding protein 0.9923 1 150 GO:0016491
GO:0046872
GO:0051537
AF-A0A521UQF3-F1-model_v4 (2Fe-2S)-binding protein 0.9907 1 150 GO:0016491
GO:0046872
GO:0051537
AF-A0A3D8YFZ6-F1-model_v4 (2Fe-2S)-binding protein 0.9904 1 151 GO:0016491
GO:0046872
GO:0051537
AF-A0A1I2BQ61-F1-model_v4 Isoquinoline 1-oxidoreductase, alpha subunit 0.9888 1 151 GO:0016491
GO:0046872
GO:0051537
AF-A0A1H6Q4U8-F1-model_v4 Isoquinoline 1-oxidoreductase, alpha subunit 0.9878 1 150 GO:0016491
GO:0046872
GO:0051537

Map