F409383

General Info

Members Datasets Scaffolds Average Seq Length
328 180 656 294

Family's Representative Sequence

Representative Sequence 3300046501|Ga0495607_0129913|Ga0495607_0129913_104_1087
Length 327
Sequence MPALPSCETSHACTLTPHQKKYKPMEIEYMNSDHLILVTGATGATGGYAIDHLLDKGVRVRAFVRSDDARAQKLRERGVDVALGDLVDFHSVRSAMQGVHAAYFVYPIMQPGILNATAFFAEAARESGVQAIVNMSQISARRDAASHAARDHWFSEQVFNWSGIPTTHLRPTFFMEWLLYGFQLPLIAQHGILQVPAGEGRHAPIAAEDQGRLIAAILREPTRHVGKVYPLFGAKEMNHQQIAAAVGEALGREIRYVPESIAGFEQRLSGLGLPEHFIQHVSAVYQDYQNGIFAGHDSLIQDITGLPPMTVQQFVQEKRDRFMPGAN

Samples

Sample ID Description Type Environment
1 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
20 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
44 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
45 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
48 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
68 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
69 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
70 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
73 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
74 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
75 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
76 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
77 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
78 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
79 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
80 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
81 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
82 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
83 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
84 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
85 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
86 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
87 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
88 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
89 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
90 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
91 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
92 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
93 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
94 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
95 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
96 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
97 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
98 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
99 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
100 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
101 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
102 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
103 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
104 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
105 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
106 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
107 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
108 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
109 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
110 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
111 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
112 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
113 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
114 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
115 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
116 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
117 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
118 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
119 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
120 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
121 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
122 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
123 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
124 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
125 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
126 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
127 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
128 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
129 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
130 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
131 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
132 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
133 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
134 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
135 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
136 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
137 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
138 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
147 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
148 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
149 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
150 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
151 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
152 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
153 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
154 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
155 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
156 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
157 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
158 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
161 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
162 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
163 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
164 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
167 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
168 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
169 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
170 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
171 2643221664 Massilia sp. Root418 Isolate Unclassified
172 2738541280 Massilia sp. GV090 Isolate Unclassified
173 2738541300 Massilia sp. GV016 Isolate Unclassified
174 2738543018 Massilia sp. GV045 Isolate Unclassified
175 2738543030 Massilia sp. GV097 Isolate Unclassified
176 2857558681 Duganella sp. R-74565 Isolate Unclassified
177 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
178 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
179 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
180 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.65
Metatranscriptomes 0
Isolates 3.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.74
Nodule 0.3
Rhizoplane 3.66
Rhizosphere 82.01
Stem 0
Stem Tuber 0
Unclassified 1.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495607_0129913 3300046501 Unclassified 1312
2 rootH1_10145178 3300003316 Bacteria 2766
3 rootH2_10009210 3300003320 Bacteria 76383
4 rootH2_10070197 3300003320 Bacteria 6540
5 rootH1_10219652 3300003323 Bacteria 2726
6 Ga0065714_10015673 3300005288 Bacteria 1808
7 Ga0070658_10112074 3300005327 Bacteria 2261
8 Ga0070660_100052210 3300005339 Bacteria 3151
9 Ga0070669_100018354 3300005353 Bacteria 5000
10 Ga0070671_100010479 3300005355 Bacteria 7438
11 Ga0070713_100041536 3300005436 Bacteria 3748
12 Ga0070713_100225615 3300005436 Bacteria 1701
13 Ga0070708_100373793 3300005445 Bacteria 1344
14 Ga0070698_100271649 3300005471 Bacteria 1627
15 Ga0068853_100002318 3300005539 Bacteria 14257
16 Ga0068853_100112712 3300005539 Bacteria 2417
17 Ga0068855_100013216 3300005563 Bacteria 9959
18 Ga0068855_100095430 3300005563 Unclassified 3428
19 Ga0068856_100088229 3300005614 Bacteria 3084
20 Ga0068852_100011644 3300005616 Bacteria 6635
21 Ga0075364_10187374 3300006051 Bacteria 1401
22 Ga0075367_10037239 3300006178 Bacteria 2826
23 Ga0075369_10057009 3300006186 Bacteria 1698
24 Ga0097621_100274559 3300006237 Bacteria 1482
25 Ga0105251_10000884 3300009011 Bacteria 26850
26 Ga0105240_10000105 3300009093 Bacteria 172035
27 Ga0105240_10006560 3300009093 Bacteria 17087
28 Ga0105240_10010621 3300009093 Bacteria 12935
29 Ga0111539_10219299 3300009094 Bacteria 2216
30 Ga0105245_10043687 3300009098 Bacteria 3997
31 Ga0105247_10044621 3300009101 Bacteria 2719
32 Ga0105243_10048987 3300009148 Bacteria 3332
33 Ga0105241_10034020 3300009174 Bacteria 3828
34 Ga0105241_10354061 3300009174 Bacteria 1276
35 Ga0105248_10021391 3300009177 Bacteria 7167
36 Ga0105237_10000184 3300009545 Bacteria 88328
37 Ga0105237_10091654 3300009545 Bacteria 3029
38 Ga0105237_10096594 3300009545 Bacteria 2945
39 Ga0105238_10001313 3300009551 Bacteria 24953
40 Ga0105238_10007866 3300009551 Bacteria 10665
41 Ga0105249_10878643 3300009553 Bacteria 963
42 Ga0105239_10002247 3300010375 Bacteria 24690
43 Ga0105239_10671454 3300010375 Bacteria 1184
44 Ga0157371_10000992 3300013102 Bacteria 31395
45 Ga0157370_10001546 3300013104 Bacteria 28479
46 Ga0157370_10003553 3300013104 Bacteria 18251
47 Ga0157370_10006567 3300013104 Bacteria 12810
48 Ga0157369_10001815 3300013105 Bacteria 25847
49 Ga0157369_10192692 3300013105 Bacteria 2141
50 Ga0157374_10253255 3300013296 Bacteria 1733
51 Ga0157378_10003911 3300013297 Bacteria 13200
52 Ga0163162_10068287 3300013306 Bacteria 3606
53 Ga0157375_10024566 3300013308 Bacteria 5580
54 Ga0163163_10657948 3300014325 Bacteria 1111
55 Ga0182008_10018821 3300014497 Bacteria 3573
56 Ga0182008_10024179 3300014497 Bacteria 3095
57 Ga0182008_10045853 3300014497 Bacteria 2174
58 Ga0182008_10111498 3300014497 Bacteria 1356
59 Ga0157376_10169087 3300014969 Bacteria 1989
60 Ga0182006_1014417 3300015261 Bacteria 3409
61 Ga0182007_10004009 3300015262 Bacteria 6794
62 Ga0182007_10004400 3300015262 Bacteria 6390
63 Ga0182007_10027900 3300015262 Bacteria 1943
64 Ga0182007_10041862 3300015262 Bacteria 1526
65 Ga0182005_1009293 3300015265 Bacteria 2864
66 Ga0182005_1014909 3300015265 Bacteria 2171
67 Ga0182005_1014920 3300015265 Bacteria 2170
68 Ga0182005_1021838 3300015265 Bacteria 1754
69 Ga0163161_10002296 3300017792 Bacteria 13710
70 Ga0163161_10018159 3300017792 Bacteria 4931
71 Ga0213875_10034958 3300021388 Bacteria 2372
72 Ga0209051_1000466 3300025303 Bacteria 53034
73 Ga0207713_1000705 3300025735 Bacteria 31261
74 Ga0207710_10062085 3300025900 Bacteria 1697
75 Ga0207705_10006642 3300025909 Bacteria 8559
76 Ga0207695_10000193 3300025913 Bacteria 172070
77 Ga0207695_10001845 3300025913 Bacteria 33224
78 Ga0207695_10003177 3300025913 Bacteria 23406
79 Ga0207671_10000190 3300025914 Bacteria 95031
80 Ga0207681_10000385 3300025923 Bacteria 30919
81 Ga0207694_10001321 3300025924 Bacteria 21324
82 Ga0207644_10060265 3300025931 Bacteria 2746
83 Ga0207709_10041938 3300025935 Bacteria 2749
84 Ga0207665_10210248 3300025939 Bacteria 1421
85 Ga0207711_10076063 3300025941 Bacteria 2923
86 Ga0207667_10003116 3300025949 Bacteria 20514
87 Ga0207667_10158457 3300025949 Bacteria 2329
88 Ga0207639_10226392 3300026041 Bacteria 1618
89 Ga0207702_10091891 3300026078 Bacteria 2658
90 Ga0207676_10245044 3300026095 Bacteria 1610
91 Ga0207683_10448310 3300026121 Bacteria 1190
92 Ga0207698_10044803 3300026142 Bacteria 3327
93 Ga0207428_10158517 3300027907 Bacteria 1719
94 Ga0307408_100271768 3300031548 Bacteria 1407
95 Ga0307405_10151481 3300031731 Bacteria 1631
96 Ga0307407_10062412 3300031903 Bacteria 2182
97 Ga0307412_10002580 3300031911 Bacteria 10065
98 Ga0307412_10037057 3300031911 Bacteria 3130
99 Ga0307416_100077902 3300032002 Bacteria 2786
100 Ga0395900_0140040 3300037418 Bacteria 2478
101 Ga0436364_0072478 3300037853 Bacteria 4058
102 Ga0439438_006513 3300041405 Bacteria 4108
103 Ga0439447_001705 3300041407 Bacteria 8068
104 Ga0439447_033520 3300041407 Bacteria 1280
105 Ga0439466_0000144 3300041411 Bacteria 28352
106 Ga0439466_0001952 3300041411 Bacteria 8086
107 Ga0439466_0015239 3300041411 Bacteria 2793
108 Ga0439466_0057312 3300041411 Bacteria 1262
109 Ga0439465_0006220 3300041413 Bacteria 3793
110 Ga0439465_0008389 3300041413 Bacteria 3261
111 Ga0439431_0019179 3300041997 Bacteria 1623
112 Ga0439442_006681 3300042002 Bacteria 2318
113 Ga0439445_0005876 3300042004 Bacteria 2807
114 Ga0439451_004336 3300042009 Bacteria 2880
115 Ga0439452_001012 3300042010 Bacteria 12440
116 Ga0439452_007480 3300042010 Bacteria 3343
117 Ga0439456_036094 3300042013 Bacteria 1066
118 Ga0439463_019208 3300042016 Bacteria 1702
119 Ga0450911_000009 3300042115 Bacteria 162968
120 Ga0450905_000011 3300042142 Bacteria 19765
121 Ga0439434_0015039 3300042435 Bacteria 2305
122 Ga0466959_0116091 3300045049 Bacteria 1906
123 Ga0466967_0219083 3300045976 Bacteria 1808
124 Ga0495617_000643 3300046452 Bacteria 17487
125 Ga0495617_066537 3300046452 Unclassified 1187
126 Ga0495627_019920 3300046453 Bacteria 2243
127 Ga0495603_0013296 3300046455 Bacteria 4976
128 Ga0495590_0013948 3300046457 Bacteria 2945
129 Ga0495590_0086258 3300046457 Unclassified 1108
130 Ga0495591_000739 3300046458 Bacteria 23615
131 Ga0495591_006547 3300046458 Bacteria 5127
132 Ga0495591_007970 3300046458 Bacteria 4406
133 Ga0495591_019409 3300046458 Bacteria 2275
134 Ga0495629_0288999 3300046459 Bacteria 1124
135 Ga0495638_0012338 3300046460 Bacteria 5860
136 Ga0495638_0034484 3300046460 Bacteria 3230
137 Ga0495638_0146670 3300046460 Bacteria 1372
138 Ga0495650_0000896 3300046471 Bacteria 35106
139 Ga0495650_0004671 3300046471 Bacteria 9249
140 Ga0495605_0000011 3300046474 Bacteria 314856
141 Ga0495605_0000128 3300046474 Bacteria 100439
142 Ga0495605_0000148 3300046474 Bacteria 90877
143 Ga0495605_0003905 3300046474 Bacteria 8834
144 Ga0495605_0025475 3300046474 Bacteria 3082
145 Ga0495584_0001137 3300046491 Bacteria 16464
146 Ga0495584_0019748 3300046491 Bacteria 3423
147 Ga0495594_0003210 3300046499 Bacteria 8469
148 Ga0495594_0017721 3300046499 Bacteria 3765
149 Ga0495607_0000313 3300046501 Bacteria 50578
150 Ga0495607_0001991 3300046501 Bacteria 17191
151 Ga0495607_0002696 3300046501 Bacteria 14172
152 Ga0495607_0003894 3300046501 Bacteria 11246
153 Ga0495607_0005644 3300046501 Bacteria 8922
154 Ga0495607_0012335 3300046501 Bacteria 5648
155 Ga0495583_0000047 3300046506 Bacteria 217720
156 Ga0495583_0003911 3300046506 Bacteria 11025
157 Ga0495583_0004769 3300046506 Bacteria 9517
158 Ga0495583_0017298 3300046506 Bacteria 3832
159 Ga0495606_0000088 3300046507 Bacteria 155985
160 Ga0495606_0000754 3300046507 Bacteria 49732
161 Ga0495606_0001407 3300046507 Bacteria 32362
162 Ga0495606_0002882 3300046507 Bacteria 19013
163 Ga0495606_0006579 3300046507 Bacteria 10685
164 Ga0495606_0023965 3300046507 Bacteria 4410
165 Ga0495606_0025815 3300046507 Bacteria 4198
166 Ga0495606_0117567 3300046507 Bacteria 1595
167 Ga0495606_0131480 3300046507 Bacteria 1487
168 Ga0495610_0004195 3300046512 Bacteria 10762
169 Ga0495610_0014667 3300046512 Bacteria 4593
170 Ga0495616_0000150 3300046513 Bacteria 60876
171 Ga0495616_0040795 3300046513 Bacteria 2370
172 Ga0495620_0000086 3300046515 Bacteria 76675
173 Ga0495620_0000225 3300046515 Bacteria 42537
174 Ga0495620_0000540 3300046515 Bacteria 24076
175 Ga0495620_0000592 3300046515 Bacteria 22694
176 Ga0495631_0000150 3300046518 Bacteria 47394
177 Ga0495631_0000337 3300046518 Bacteria 32281
178 Ga0495631_0002627 3300046518 Bacteria 10031
179 Ga0495631_0012068 3300046518 Bacteria 4233
180 Ga0495631_0051903 3300046518 Bacteria 1791
181 Ga0495632_0000467 3300046519 Bacteria 38367
182 Ga0495632_0001763 3300046519 Bacteria 17503
183 Ga0495632_0005659 3300046519 Bacteria 8216
184 Ga0495632_0072107 3300046519 Bacteria 1658
185 Ga0495637_0016593 3300046520 Bacteria 3441
186 Ga0495637_0058660 3300046520 Bacteria 1586
187 Ga0495643_0000134 3300046522 Bacteria 119143
188 Ga0495643_0005508 3300046522 Bacteria 8542
189 Ga0495643_0028287 3300046522 Bacteria 3144
190 Ga0495643_0098608 3300046522 Bacteria 1500
191 Ga0495648_0000085 3300046524 Bacteria 119901
192 Ga0495648_0012473 3300046524 Bacteria 6337
193 Ga0495648_0034798 3300046524 Bacteria 3273
194 Ga0495642_0000225 3300046528 Bacteria 32370
195 Ga0495654_0000866 3300046530 Bacteria 22797
196 Ga0495654_0037880 3300046530 Bacteria 2414
197 Ga0495609_0000004 3300046538 Bacteria 697346
198 Ga0495609_0008497 3300046538 Bacteria 5026
199 Ga0495597_0004471 3300046542 Bacteria 7673
200 Ga0495597_0019192 3300046542 Bacteria 3201
201 Ga0495597_0094132 3300046542 Bacteria 1269
202 Ga0495633_0000206 3300046558 Bacteria 74675
203 Ga0495656_0110275 3300046615 Unclassified 1286
204 Ga0495668_0024992 3300046616 Bacteria 3395
205 Ga0495611_0001735 3300046648 Bacteria 10550
206 Ga0495611_0001867 3300046648 Bacteria 10038
207 Ga0495611_0002187 3300046648 Bacteria 9108
208 Ga0495625_0004633 3300046660 Bacteria 12925
209 Ga0495625_0081954 3300046660 Bacteria 2245
210 Ga0495659_0002528 3300046664 Bacteria 5904
211 Ga0495661_0000005 3300046665 Bacteria 433622
212 Ga0495661_0001046 3300046665 Bacteria 24531
213 Ga0495661_0002090 3300046665 Bacteria 15676
214 Ga0495661_0002327 3300046665 Bacteria 14648
215 Ga0495661_0124216 3300046665 Bacteria 1422
216 Ga0495599_0021242 3300046678 Bacteria 4049
217 Ga0495671_0000089 3300046692 Bacteria 85775
218 Ga0495671_0001779 3300046692 Bacteria 13940
219 Ga0495671_0007600 3300046692 Bacteria 6162
220 Ga0495671_0043733 3300046692 Bacteria 2248
221 Ga0495671_0055928 3300046692 Bacteria 1954
222 Ga0495649_0009463 3300046694 Bacteria 5791
223 Ga0495649_0061952 3300046694 Bacteria 2011
224 Ga0495649_0077496 3300046694 Bacteria 1779
225 Ga0495589_0000046 3300046794 Bacteria 122544
226 Ga0495589_0000470 3300046794 Bacteria 29417
227 Ga0495589_0006076 3300046794 Bacteria 6379
228 Ga0495660_0000040 3300046810 Bacteria 172614
229 Ga0495660_0012815 3300046810 Bacteria 4863
230 Ga0495660_0046355 3300046810 Bacteria 2384
231 Ga0495636_0049480 3300047318 Bacteria 1757
232 Ga0495672_0000468 3300047320 Bacteria 47770
233 Ga0495672_0000489 3300047320 Bacteria 46184
234 Ga0495672_0003962 3300047320 Bacteria 12393
235 Ga0495672_0016123 3300047320 Bacteria 5048
236 Ga0495672_0061413 3300047320 Bacteria 2166
237 Ga0495676_0011804 3300047321 Bacteria 7880
238 Ga0495683_0000031 3300047323 Bacteria 150363
239 Ga0495683_0003536 3300047323 Bacteria 9093
240 Ga0495683_0009617 3300047323 Bacteria 5147
241 Ga0495687_000100 3300047443 Bacteria 130324
242 Ga0495687_022553 3300047443 Bacteria 3020
243 Ga0495687_056224 3300047443 Bacteria 1642
244 Ga0495677_0000371 3300047445 Bacteria 19395
245 Ga0495677_0007418 3300047445 Bacteria 4100
246 Ga0495677_0021294 3300047445 Bacteria 2349
247 Ga0495679_000154 3300047446 Bacteria 61634
248 Ga0495685_002019 3300047447 Bacteria 6304
249 Ga0495673_0000112 3300047469 Bacteria 164434
250 Ga0495673_0000118 3300047469 Bacteria 147670
251 Ga0495673_0000197 3300047469 Bacteria 94703
252 Ga0495673_0000383 3300047469 Bacteria 52691
253 Ga0495673_0001071 3300047469 Bacteria 23989
254 Ga0495673_0005907 3300047469 Bacteria 7308
255 Ga0495673_0010536 3300047469 Bacteria 5018
256 Ga0495673_0020151 3300047469 Bacteria 3325
257 Ga0495673_0109964 3300047469 Bacteria 1103
258 Ga0495681_0011414 3300047470 Bacteria 5291
259 Ga0495681_0019160 3300047470 Bacteria 3744
260 Ga0495681_0023174 3300047470 Bacteria 3303
261 Ga0495686_0130182 3300047472 Bacteria 1492
262 Ga0495686_0135656 3300047472 Bacteria 1455
263 Ga0495626_0000328 3300048091 Bacteria 50162
264 Ga0495626_0000765 3300048091 Bacteria 29625
265 Ga0495626_0040619 3300048091 Bacteria 2196
266 Ga0496100_0004952 3300048903 Bacteria 7120
267 Ga0496101_0000102 3300048904 Bacteria 88779
268 Ga0496102_0000037 3300048905 Bacteria 199368
269 Ga0496102_0164327 3300048905 Bacteria 2088
270 Ga0496102_0646893 3300048905 Bacteria 980
271 Ga0496103_0000004 3300048906 Bacteria 510080
272 Ga0496106_0000946 3300048909 Bacteria 21168
273 Ga0496106_0003736 3300048909 Bacteria 11359
274 Ga0496110_0424037 3300048913 Bacteria 1213
275 Ga0496112_0198914 3300048915 Bacteria 1964
276 Ga0496112_0225128 3300048915 Bacteria 1831
277 Ga0496112_0467258 3300048915 Bacteria 1199
278 Ga0496116_0000276 3300048919 Bacteria 89506
279 Ga0496116_0026862 3300048919 Bacteria 4200
280 Ga0496117_0000003 3300048920 Bacteria 1881097
281 Ga0496118_0000001 3300048921 Bacteria 1881100
282 Ga0496118_0027189 3300048921 Bacteria 4849
283 Ga0496119_0050491 3300048922 Bacteria 2563
284 Ga0496120_0029160 3300048923 Bacteria 3370
285 Ga0496121_0000338 3300048924 Bacteria 97703
286 Ga0496121_0000907 3300048924 Bacteria 53390
287 Ga0496121_0001087 3300048924 Bacteria 48027
288 Ga0496122_0135402 3300048925 Unclassified 1554
289 Ga0496122_0167788 3300048925 Bacteria 1328
290 Ga0496123_0002152 3300048926 Bacteria 25168
291 Ga0496123_0005126 3300048926 Bacteria 13374
292 Ga0496123_0030325 3300048926 Bacteria 3961
293 Ga0496124_0000261 3300048927 Bacteria 101660
294 Ga0496124_0000423 3300048927 Bacteria 75679
295 Ga0496124_0037234 3300048927 Bacteria 4233
296 Ga0496125_0006557 3300048928 Bacteria 12542
297 Ga0496125_0114571 3300048928 Bacteria 1942
298 Ga0496126_0000439 3300048929 Bacteria 82909
299 Ga0496126_0000551 3300048929 Bacteria 72093
300 Ga0496126_0028032 3300048929 Bacteria 5371
301 Ga0496126_0047726 3300048929 Bacteria 3919
302 Ga0495678_000060 3300049459 Bacteria 142851
303 Ga0495678_000119 3300049459 Bacteria 92516
304 Ga0495678_000186 3300049459 Bacteria 72357
305 Ga0495678_057249 3300049459 Bacteria 1478
306 Ga0495682_0000035 3300049460 Bacteria 126349
307 Ga0501034_0339492 3300049571 Bacteria 1432
308 Ga0501227_005390 3300049665 Bacteria 2739
309 Ga0501235_001586 3300049669 Bacteria 4873
310 Ga0501247_009907 3300049677 Bacteria 1130
311 Ga0501245_011095 3300049708 Bacteria 1307
312 nmdc:mga00v17_159341_c1 3300050491 Bacteria 1452
313 nmdc:mga08y16_762192_c1 3300050511 Bacteria 963
314 nmdc:mga0sz30_53939_c1 3300050516 Bacteria 1709
315 Ga0500594_0031665 3300053118 Bacteria 1396
316 Ga0500618_014949 3300053125 Bacteria 1971
317 Ga0500645_009461 3300053730 Bacteria 3272
318 2643844865 2643221565 Bacteria 6216018
319 2644355850 2643221664 Bacteria 7272945
320 2738740652 2738541280 Bacteria 6630198
321 2738844973 2738541300 Bacteria 6675882
322 2739277388 2738543018 Bacteria 6718814
323 2739346431 2738543030 Bacteria 6719714
324 2857558690 2857558681 Bacteria 6617694
325 2878030490 2878029506 Bacteria 6418441
326 2931399182 2931396565 Bacteria 7251677
327 3007862752 3007861166 Bacteria 6045338
328 8055272313 8055266321 Bacteria 7999742
329 Ga0495607_0129913
330 rootH1_10145178
331 rootH2_10009210
332 rootH2_10070197
333 rootH1_10219652
334 Ga0065714_10015673
335 Ga0070658_10112074
336 Ga0070660_100052210
337 Ga0070669_100018354
338 Ga0070671_100010479
339 Ga0070713_100041536
340 Ga0070713_100225615
341 Ga0070708_100373793
342 Ga0070698_100271649
343 Ga0068853_100002318
344 Ga0068853_100112712
345 Ga0068855_100013216
346 Ga0068855_100095430
347 Ga0068856_100088229
348 Ga0068852_100011644
349 Ga0075364_10187374
350 Ga0075367_10037239
351 Ga0075369_10057009
352 Ga0097621_100274559
353 Ga0105251_10000884
354 Ga0105240_10000105
355 Ga0105240_10006560
356 Ga0105240_10010621
357 Ga0111539_10219299
358 Ga0105245_10043687
359 Ga0105247_10044621
360 Ga0105243_10048987
361 Ga0105241_10034020
362 Ga0105241_10354061
363 Ga0105248_10021391
364 Ga0105237_10000184
365 Ga0105237_10091654
366 Ga0105237_10096594
367 Ga0105238_10001313
368 Ga0105238_10007866
369 Ga0105249_10878643
370 Ga0105239_10002247
371 Ga0105239_10671454
372 Ga0157371_10000992
373 Ga0157370_10001546
374 Ga0157370_10003553
375 Ga0157370_10006567
376 Ga0157369_10001815
377 Ga0157369_10192692
378 Ga0157374_10253255
379 Ga0157378_10003911
380 Ga0163162_10068287
381 Ga0157375_10024566
382 Ga0163163_10657948
383 Ga0182008_10018821
384 Ga0182008_10024179
385 Ga0182008_10045853
386 Ga0182008_10111498
387 Ga0157376_10169087
388 Ga0182006_1014417
389 Ga0182007_10004009
390 Ga0182007_10004400
391 Ga0182007_10027900
392 Ga0182007_10041862
393 Ga0182005_1009293
394 Ga0182005_1014909
395 Ga0182005_1014920
396 Ga0182005_1021838
397 Ga0163161_10002296
398 Ga0163161_10018159
399 Ga0213875_10034958
400 Ga0209051_1000466
401 Ga0207713_1000705
402 Ga0207710_10062085
403 Ga0207705_10006642
404 Ga0207695_10000193
405 Ga0207695_10001845
406 Ga0207695_10003177
407 Ga0207671_10000190
408 Ga0207681_10000385
409 Ga0207694_10001321
410 Ga0207644_10060265
411 Ga0207709_10041938
412 Ga0207665_10210248
413 Ga0207711_10076063
414 Ga0207667_10003116
415 Ga0207667_10158457
416 Ga0207639_10226392
417 Ga0207702_10091891
418 Ga0207676_10245044
419 Ga0207683_10448310
420 Ga0207698_10044803
421 Ga0207428_10158517
422 Ga0307408_100271768
423 Ga0307405_10151481
424 Ga0307407_10062412
425 Ga0307412_10002580
426 Ga0307412_10037057
427 Ga0307416_100077902
428 Ga0395900_0140040
429 Ga0436364_0072478
430 Ga0439438_006513
431 Ga0439447_001705
432 Ga0439447_033520
433 Ga0439466_0000144
434 Ga0439466_0001952
435 Ga0439466_0015239
436 Ga0439466_0057312
437 Ga0439465_0006220
438 Ga0439465_0008389
439 Ga0439431_0019179
440 Ga0439442_006681
441 Ga0439445_0005876
442 Ga0439451_004336
443 Ga0439452_001012
444 Ga0439452_007480
445 Ga0439456_036094
446 Ga0439463_019208
447 Ga0450911_000009
448 Ga0450905_000011
449 Ga0439434_0015039
450 Ga0466959_0116091
451 Ga0466967_0219083
452 Ga0495617_000643
453 Ga0495617_066537
454 Ga0495627_019920
455 Ga0495603_0013296
456 Ga0495590_0013948
457 Ga0495590_0086258
458 Ga0495591_000739
459 Ga0495591_006547
460 Ga0495591_007970
461 Ga0495591_019409
462 Ga0495629_0288999
463 Ga0495638_0012338
464 Ga0495638_0034484
465 Ga0495638_0146670
466 Ga0495650_0000896
467 Ga0495650_0004671
468 Ga0495605_0000011
469 Ga0495605_0000128
470 Ga0495605_0000148
471 Ga0495605_0003905
472 Ga0495605_0025475
473 Ga0495584_0001137
474 Ga0495584_0019748
475 Ga0495594_0003210
476 Ga0495594_0017721
477 Ga0495607_0000313
478 Ga0495607_0001991
479 Ga0495607_0002696
480 Ga0495607_0003894
481 Ga0495607_0005644
482 Ga0495607_0012335
483 Ga0495583_0000047
484 Ga0495583_0003911
485 Ga0495583_0004769
486 Ga0495583_0017298
487 Ga0495606_0000088
488 Ga0495606_0000754
489 Ga0495606_0001407
490 Ga0495606_0002882
491 Ga0495606_0006579
492 Ga0495606_0023965
493 Ga0495606_0025815
494 Ga0495606_0117567
495 Ga0495606_0131480
496 Ga0495610_0004195
497 Ga0495610_0014667
498 Ga0495616_0000150
499 Ga0495616_0040795
500 Ga0495620_0000086
501 Ga0495620_0000225
502 Ga0495620_0000540
503 Ga0495620_0000592
504 Ga0495631_0000150
505 Ga0495631_0000337
506 Ga0495631_0002627
507 Ga0495631_0012068
508 Ga0495631_0051903
509 Ga0495632_0000467
510 Ga0495632_0001763
511 Ga0495632_0005659
512 Ga0495632_0072107
513 Ga0495637_0016593
514 Ga0495637_0058660
515 Ga0495643_0000134
516 Ga0495643_0005508
517 Ga0495643_0028287
518 Ga0495643_0098608
519 Ga0495648_0000085
520 Ga0495648_0012473
521 Ga0495648_0034798
522 Ga0495642_0000225
523 Ga0495654_0000866
524 Ga0495654_0037880
525 Ga0495609_0000004
526 Ga0495609_0008497
527 Ga0495597_0004471
528 Ga0495597_0019192
529 Ga0495597_0094132
530 Ga0495633_0000206
531 Ga0495656_0110275
532 Ga0495668_0024992
533 Ga0495611_0001735
534 Ga0495611_0001867
535 Ga0495611_0002187
536 Ga0495625_0004633
537 Ga0495625_0081954
538 Ga0495659_0002528
539 Ga0495661_0000005
540 Ga0495661_0001046
541 Ga0495661_0002090
542 Ga0495661_0002327
543 Ga0495661_0124216
544 Ga0495599_0021242
545 Ga0495671_0000089
546 Ga0495671_0001779
547 Ga0495671_0007600
548 Ga0495671_0043733
549 Ga0495671_0055928
550 Ga0495649_0009463
551 Ga0495649_0061952
552 Ga0495649_0077496
553 Ga0495589_0000046
554 Ga0495589_0000470
555 Ga0495589_0006076
556 Ga0495660_0000040
557 Ga0495660_0012815
558 Ga0495660_0046355
559 Ga0495636_0049480
560 Ga0495672_0000468
561 Ga0495672_0000489
562 Ga0495672_0003962
563 Ga0495672_0016123
564 Ga0495672_0061413
565 Ga0495676_0011804
566 Ga0495683_0000031
567 Ga0495683_0003536
568 Ga0495683_0009617
569 Ga0495687_000100
570 Ga0495687_022553
571 Ga0495687_056224
572 Ga0495677_0000371
573 Ga0495677_0007418
574 Ga0495677_0021294
575 Ga0495679_000154
576 Ga0495685_002019
577 Ga0495673_0000112
578 Ga0495673_0000118
579 Ga0495673_0000197
580 Ga0495673_0000383
581 Ga0495673_0001071
582 Ga0495673_0005907
583 Ga0495673_0010536
584 Ga0495673_0020151
585 Ga0495673_0109964
586 Ga0495681_0011414
587 Ga0495681_0019160
588 Ga0495681_0023174
589 Ga0495686_0130182
590 Ga0495686_0135656
591 Ga0495626_0000328
592 Ga0495626_0000765
593 Ga0495626_0040619
594 Ga0496100_0004952
595 Ga0496101_0000102
596 Ga0496102_0000037
597 Ga0496102_0164327
598 Ga0496102_0646893
599 Ga0496103_0000004
600 Ga0496106_0000946
601 Ga0496106_0003736
602 Ga0496110_0424037
603 Ga0496112_0198914
604 Ga0496112_0225128
605 Ga0496112_0467258
606 Ga0496116_0000276
607 Ga0496116_0026862
608 Ga0496117_0000003
609 Ga0496118_0000001
610 Ga0496118_0027189
611 Ga0496119_0050491
612 Ga0496120_0029160
613 Ga0496121_0000338
614 Ga0496121_0000907
615 Ga0496121_0001087
616 Ga0496122_0135402
617 Ga0496122_0167788
618 Ga0496123_0002152
619 Ga0496123_0005126
620 Ga0496123_0030325
621 Ga0496124_0000261
622 Ga0496124_0000423
623 Ga0496124_0037234
624 Ga0496125_0006557
625 Ga0496125_0114571
626 Ga0496126_0000439
627 Ga0496126_0000551
628 Ga0496126_0028032
629 Ga0496126_0047726
630 Ga0495678_000060
631 Ga0495678_000119
632 Ga0495678_000186
633 Ga0495678_057249
634 Ga0495682_0000035
635 Ga0501034_0339492
636 Ga0501227_005390
637 Ga0501235_001586
638 Ga0501247_009907
639 Ga0501245_011095
640 nmdc:mga00v17_159341_c1
641 nmdc:mga08y16_762192_c1
642 nmdc:mga0sz30_53939_c1
643 Ga0500594_0031665
644 Ga0500618_014949
645 Ga0500645_009461
646 2643844865
647 2644355850
648 2738740652
649 2738844973
650 2739277388
651 2739346431
652 2857558690
653 2878030490
654 2931399182
655 3007862752
656 8055272313

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

36

148

0.87

PF05368

NmrA

NmrA-like family

36

258

0.85

PF13460

NAD_binding_10

NAD(P)H-binding

40

221

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1i8t-assembly1.cif.gz_B structure of udp-galactopyranose mutase from e.coli 0.9059 3 35
3e48-assembly1.cif.gz_A crystal structure of a nucleoside-diphosphate-sugar epimerase (sav0421) from staphylococcus aureus, northeast structural genomics consortium target zr319 0.899 4 284
3e48-assembly1.cif.gz_A crystal structure of a nucleoside-diphosphate-sugar epimerase (sav0421) from staphylococcus aureus, northeast structural genomics consortium target zr319 0.8899 4 284
2zcv-assembly1.cif.gz_A crystal structure of nadph-dependent quinone oxidoreductase qor2 complexed with nadph from escherichia coli 0.8879 5 285
2zcu-assembly1.cif.gz_A crystal structure of a new type of nadph-dependent quinone oxidoreductase (qor2) from escherichia coli 0.8774 5 285
ID Description Score Start End Superfamily
af_P9WNY9_4_366_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9252 3 32 3.50.50.60
5xgvB01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.925 3 35 3.50.50.60
af_Q54LX4_3_401_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9195 3 34 3.50.50.60
3zdnC01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.915 3 35 3.50.50.60
af_A0A1D6IP12_4_87_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9097 4 71 3.40.50.20
ID Description Score Start End GO Terms
AF-A0A6I1Z0D5-F1-model_v4 NAD(P)H azoreductase (EC 1.7.-.-) 0.9765 1 291 GO:0016491
AF-A0A6I1Z0D5-F1-model_v4 NAD(P)H azoreductase (EC 1.7.-.-) 0.9732 1 291 GO:0016491
AF-D7C9H2-F1-model_v4 NmrA family protein 0.9707 1 290
AF-A0A2A4Y6L1-F1-model_v4 NmrA family transcriptional regulator 0.9697 1 291
AF-A0A090T8P3-F1-model_v4 NAD(P)-binding domain-containing protein 0.9672 69 291

Map