F409410
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 328 | 220 | 297 | 340 |
Family's Representative Sequence
| Representative Sequence | 3300048918|Ga0496115_0077907|Ga0496115_0077907_334_1347 |
| Length | 321 |
| Sequence | VSDAFKPLLSRLANGEILTDAETGEFFAACLRGEPTPAQVAAAVTAMRVRGELKLEHDFDVIDTCGTGGDGAHTYNISTAAAFVAAGAGLKVAKHGTRSLSSKSGSSDVLAALGVNIEATREQSQRALTEAGICFMFAPAYHGAMRHVTPVRAELGFRTVFNLMGPLSNPAGAKRQVLGVYASHLIEPLAEVLGRLGATRAWVVHGSGLDEITTTGPTEVAEWRDGTLRRFQVTPEEAGLQRVELKALRGGDPAKNARALRDVLAGKPGPYRDVVLMSAAAALIVSDRAETLREGVEIASAAIADGRAQAALDKLVEASHA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 2 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 3 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 4 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 5 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 6 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 7 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 8 | 2643221574 | Brevundimonas sp. Root608 | Isolate | Unclassified |
| 9 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 10 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 11 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 12 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 13 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 14 | 2643221663 | Brevundimonas sp. Root1279 | Isolate | Unclassified |
| 15 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 16 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 17 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 18 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 19 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 20 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 21 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 22 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 23 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 24 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 25 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 26 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 27 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 28 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 29 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 30 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
| 31 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 32 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 33 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 34 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 35 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 36 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 37 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 38 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 39 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 40 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 58 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 59 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 60 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 61 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 62 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 63 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 79 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 80 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 81 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 82 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 83 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 85 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 88 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 117 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 118 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 119 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 120 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 121 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 122 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 123 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 124 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 125 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 126 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 127 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 128 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 129 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 130 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 131 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 132 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 133 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 134 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 135 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 136 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 137 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 138 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 139 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 140 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 141 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 169 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 170 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 171 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 172 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 173 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 174 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 175 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 176 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 177 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 178 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 179 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 180 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 181 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 182 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 187 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 189 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 190 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 191 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 192 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 193 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 194 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 195 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 196 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 197 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 198 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 199 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 200 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 201 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 202 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 203 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 204 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 205 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 206 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 207 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 208 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 209 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 210 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 211 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 212 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 213 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 214 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 215 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 216 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 217 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 218 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 219 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 220 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.24 |
| Metatranscriptomes | 0.3 |
| Isolates | 9.45 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 26.83 |
| Nodule | 0 |
| Rhizoplane | 3.66 |
| Rhizosphere | 57.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.89 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10019310 | 3300003215 | Bacteria | 2616 |
| 2 | rootH1_10010156 | 3300003323 | Bacteria | 5803 |
| 3 | rootH1_10294932 | 3300003323 | Bacteria | 1873 |
| 4 | Ga0006562J51391_1161223 | 3300003578 | Bacteria | 5430 |
| 5 | Ga0055537_1002170 | 3300003773 | Bacteria | 6850 |
| 6 | Ga0055536_1001278 | 3300003781 | Bacteria | 15504 |
| 7 | Ga0055536_1003888 | 3300003781 | Bacteria | 7843 |
| 8 | Ga0055528_1019189 | 3300003790 | Bacteria | 2282 |
| 9 | Ga0055530_10004385 | 3300003791 | Bacteria | 7295 |
| 10 | Ga0055530_10004852 | 3300003791 | Bacteria | 6715 |
| 11 | Ga0055531_10001195 | 3300003794 | Bacteria | 19919 |
| 12 | Ga0055531_10001530 | 3300003794 | Bacteria | 16948 |
| 13 | Ga0055531_10021297 | 3300003794 | Bacteria | 2521 |
| 14 | Ga0065165_1005110 | 3300005262 | Bacteria | 7611 |
| 15 | Ga0070691_10039781 | 3300005341 | Bacteria | 2222 |
| 16 | Ga0070668_100000097 | 3300005347 | Bacteria | 53800 |
| 17 | Ga0070668_100015206 | 3300005347 | Bacteria | 5750 |
| 18 | Ga0070669_100039406 | 3300005353 | Bacteria | 3433 |
| 19 | Ga0070671_100000342 | 3300005355 | Bacteria | 32006 |
| 20 | Ga0070673_100087553 | 3300005364 | Bacteria | 2539 |
| 21 | Ga0070667_100000083 | 3300005367 | Bacteria | 118261 |
| 22 | Ga0070667_100175304 | 3300005367 | Bacteria | 1895 |
| 23 | Ga0070678_100124118 | 3300005456 | Bacteria | 2041 |
| 24 | Ga0070681_10042690 | 3300005458 | Bacteria | 4543 |
| 25 | Ga0070679_100008769 | 3300005530 | Bacteria | 9540 |
| 26 | Ga0068853_100042350 | 3300005539 | Bacteria | 3893 |
| 27 | Ga0068853_100262808 | 3300005539 | Bacteria | 1587 |
| 28 | Ga0070665_100000483 | 3300005548 | Bacteria | 57237 |
| 29 | Ga0068856_100085847 | 3300005614 | Bacteria | 3127 |
| 30 | Ga0068859_100000435 | 3300005617 | Bacteria | 41931 |
| 31 | Ga0068863_100000007 | 3300005841 | Bacteria | 257578 |
| 32 | Ga0068863_100001697 | 3300005841 | Bacteria | 21819 |
| 33 | Ga0068863_100006190 | 3300005841 | Bacteria | 11736 |
| 34 | Ga0068858_100000031 | 3300005842 | Bacteria | 143397 |
| 35 | Ga0068858_100178655 | 3300005842 | Bacteria | 2003 |
| 36 | Ga0068860_100000128 | 3300005843 | Bacteria | 122731 |
| 37 | Ga0068862_100001627 | 3300005844 | Bacteria | 20442 |
| 38 | Ga0068862_100154567 | 3300005844 | Bacteria | 2044 |
| 39 | Ga0068862_100199887 | 3300005844 | Bacteria | 1802 |
| 40 | Ga0075368_10000575 | 3300006042 | Bacteria | 11047 |
| 41 | Ga0075363_100129284 | 3300006048 | Bacteria | 1416 |
| 42 | Ga0075364_10000306 | 3300006051 | Bacteria | 23963 |
| 43 | Ga0075367_10015263 | 3300006178 | Bacteria | 4170 |
| 44 | Ga0075369_10040957 | 3300006186 | Bacteria | 1982 |
| 45 | Ga0075366_10005124 | 3300006195 | Bacteria | 7088 |
| 46 | Ga0075366_10035857 | 3300006195 | Bacteria | 2924 |
| 47 | Ga0075370_10048091 | 3300006353 | Bacteria | 2416 |
| 48 | Ga0075370_10101080 | 3300006353 | Bacteria | 1669 |
| 49 | Ga0075370_10103895 | 3300006353 | Bacteria | 1646 |
| 50 | Ga0068871_100102350 | 3300006358 | Bacteria | 2401 |
| 51 | Ga0068865_100000711 | 3300006881 | Bacteria | 18707 |
| 52 | Ga0097620_100000435 | 3300006931 | Bacteria | 41931 |
| 53 | Ga0105240_10044492 | 3300009093 | Bacteria | 5641 |
| 54 | Ga0105240_10110071 | 3300009093 | Bacteria | 3335 |
| 55 | Ga0105248_10023180 | 3300009177 | Bacteria | 6894 |
| 56 | Ga0105248_10065422 | 3300009177 | Bacteria | 4082 |
| 57 | Ga0105248_10289191 | 3300009177 | Bacteria | 1845 |
| 58 | Ga0105238_10017833 | 3300009551 | Bacteria | 7217 |
| 59 | Ga0105249_10008103 | 3300009553 | Bacteria | 9161 |
| 60 | Ga0105239_10172338 | 3300010375 | Bacteria | 2420 |
| 61 | Ga0157373_10001429 | 3300013100 | Bacteria | 18213 |
| 62 | Ga0157373_10008774 | 3300013100 | Bacteria | 7490 |
| 63 | Ga0157369_10079745 | 3300013105 | Bacteria | 3506 |
| 64 | Ga0157369_10197726 | 3300013105 | Bacteria | 2110 |
| 65 | Ga0163162_10019316 | 3300013306 | Bacteria | 6682 |
| 66 | Ga0163162_10121750 | 3300013306 | Bacteria | 2714 |
| 67 | Ga0157375_10054144 | 3300013308 | Bacteria | 3951 |
| 68 | Ga0163163_10015019 | 3300014325 | Bacteria | 7139 |
| 69 | Ga0163163_10112597 | 3300014325 | Bacteria | 2751 |
| 70 | Ga0157379_10006808 | 3300014968 | Bacteria | 9879 |
| 71 | Ga0157379_10007773 | 3300014968 | Bacteria | 9288 |
| 72 | Ga0157379_10181345 | 3300014968 | Bacteria | 1902 |
| 73 | Ga0183365_10002 | 3300015684 | Bacteria | 545891 |
| 74 | Ga0213872_10024810 | 3300021361 | Bacteria | 2757 |
| 75 | Ga0209026_1009226 | 3300025250 | Bacteria | 1960 |
| 76 | Ga0209565_1000781 | 3300025263 | Bacteria | 18468 |
| 77 | Ga0209673_1000523 | 3300025273 | Bacteria | 62816 |
| 78 | Ga0209676_1000061 | 3300025292 | Bacteria | 332674 |
| 79 | Ga0209676_1000327 | 3300025292 | Bacteria | 91596 |
| 80 | Ga0209676_1000409 | 3300025292 | Bacteria | 77127 |
| 81 | Ga0209564_1003963 | 3300025295 | Bacteria | 9422 |
| 82 | Ga0209758_1003805 | 3300025297 | Bacteria | 13286 |
| 83 | Ga0209050_1001093 | 3300025298 | Bacteria | 32922 |
| 84 | Ga0209050_1001133 | 3300025298 | Bacteria | 32110 |
| 85 | Ga0209050_1004203 | 3300025298 | Bacteria | 9958 |
| 86 | Ga0209256_1004896 | 3300025299 | Bacteria | 8048 |
| 87 | Ga0209256_1006065 | 3300025299 | Bacteria | 6590 |
| 88 | Ga0209051_1000338 | 3300025303 | Bacteria | 70301 |
| 89 | Ga0209257_1000178 | 3300025304 | Bacteria | 160969 |
| 90 | Ga0209257_1000609 | 3300025304 | Bacteria | 58413 |
| 91 | Ga0209257_1000944 | 3300025304 | Bacteria | 40166 |
| 92 | Ga0209257_1003210 | 3300025304 | Bacteria | 14461 |
| 93 | Ga0207680_10191715 | 3300025903 | Bacteria | 1388 |
| 94 | Ga0207705_10190540 | 3300025909 | Bacteria | 1550 |
| 95 | Ga0207707_10065129 | 3300025912 | Bacteria | 3174 |
| 96 | Ga0207695_10001229 | 3300025913 | Bacteria | 43850 |
| 97 | Ga0207695_10014530 | 3300025913 | Bacteria | 9319 |
| 98 | Ga0207695_10234955 | 3300025913 | Bacteria | 1736 |
| 99 | Ga0207657_10127482 | 3300025919 | Bacteria | 2089 |
| 100 | Ga0207681_10024635 | 3300025923 | Bacteria | 3863 |
| 101 | Ga0207650_10000062 | 3300025925 | Bacteria | 149776 |
| 102 | Ga0207644_10001653 | 3300025931 | Bacteria | 14370 |
| 103 | Ga0207644_10002801 | 3300025931 | Bacteria | 11240 |
| 104 | Ga0207704_10001140 | 3300025938 | Bacteria | 11821 |
| 105 | Ga0207711_10003138 | 3300025941 | Bacteria | 14409 |
| 106 | Ga0207711_10039688 | 3300025941 | Bacteria | 4005 |
| 107 | Ga0207711_10057373 | 3300025941 | Bacteria | 3347 |
| 108 | Ga0207711_10069466 | 3300025941 | Bacteria | 3053 |
| 109 | Ga0207711_10273606 | 3300025941 | Bacteria | 1554 |
| 110 | Ga0207667_10034613 | 3300025949 | Bacteria | 5423 |
| 111 | Ga0207667_10038385 | 3300025949 | Bacteria | 5116 |
| 112 | Ga0207712_10001626 | 3300025961 | Bacteria | 15143 |
| 113 | Ga0207712_10347735 | 3300025961 | Bacteria | 1231 |
| 114 | Ga0207668_10000028 | 3300025972 | Bacteria | 125361 |
| 115 | Ga0207668_10000507 | 3300025972 | Bacteria | 24393 |
| 116 | Ga0207668_10009769 | 3300025972 | Bacteria | 5763 |
| 117 | Ga0207640_10076426 | 3300025981 | Bacteria | 2273 |
| 118 | Ga0207658_10000209 | 3300025986 | Bacteria | 61041 |
| 119 | Ga0207658_10002861 | 3300025986 | Bacteria | 12358 |
| 120 | Ga0207658_10019258 | 3300025986 | Bacteria | 4719 |
| 121 | Ga0207703_10000038 | 3300026035 | Bacteria | 175917 |
| 122 | Ga0207639_10203924 | 3300026041 | Bacteria | 1698 |
| 123 | Ga0207702_10095853 | 3300026078 | Bacteria | 2608 |
| 124 | Ga0207702_10377831 | 3300026078 | Bacteria | 1362 |
| 125 | Ga0207641_10000012 | 3300026088 | Bacteria | 375486 |
| 126 | Ga0207641_10000341 | 3300026088 | Bacteria | 56155 |
| 127 | Ga0207641_10012230 | 3300026088 | Bacteria | 7043 |
| 128 | Ga0207641_10167164 | 3300026088 | Bacteria | 2004 |
| 129 | Ga0207676_10000255 | 3300026095 | Bacteria | 46136 |
| 130 | Ga0207676_10026896 | 3300026095 | Bacteria | 4279 |
| 131 | Ga0207675_100318047 | 3300026118 | Bacteria | 1519 |
| 132 | Ga0207683_10141412 | 3300026121 | Bacteria | 2169 |
| 133 | Ga0209813_10005717 | 3300027866 | Bacteria | 3034 |
| 134 | Ga0268266_10000064 | 3300028379 | Bacteria | 249533 |
| 135 | Ga0268266_10000792 | 3300028379 | Bacteria | 42146 |
| 136 | Ga0268266_10001340 | 3300028379 | Bacteria | 29786 |
| 137 | Ga0268265_10002811 | 3300028380 | Bacteria | 12812 |
| 138 | Ga0268265_10135745 | 3300028380 | Bacteria | 2052 |
| 139 | Ga0268265_10457862 | 3300028380 | Bacteria | 1193 |
| 140 | Ga0268264_10000059 | 3300028381 | Bacteria | 306927 |
| 141 | Ga0268264_10052179 | 3300028381 | Bacteria | 3409 |
| 142 | Ga0307517_10131488 | 3300028786 | Bacteria | 1800 |
| 143 | Ga0307517_10227404 | 3300028786 | Bacteria | 1125 |
| 144 | Ga0307515_10018705 | 3300028794 | Bacteria | 12509 |
| 145 | Ga0265327_10000682 | 3300031251 | Bacteria | 54560 |
| 146 | Ga0265327_10001180 | 3300031251 | Bacteria | 35383 |
| 147 | Ga0307513_10000448 | 3300031456 | Bacteria | 59427 |
| 148 | Ga0265314_10014262 | 3300031711 | Bacteria | 6372 |
| 149 | Ga0307413_10066388 | 3300031824 | Bacteria | 2251 |
| 150 | Ga0307406_10001178 | 3300031901 | Bacteria | 14628 |
| 151 | Ga0307412_10056547 | 3300031911 | Bacteria | 2615 |
| 152 | Ga0307414_10031941 | 3300032004 | Bacteria | 3460 |
| 153 | Ga0307414_10056963 | 3300032004 | Bacteria | 2744 |
| 154 | Ga0373936_0009932 | 3300035113 | Bacteria | 3591 |
| 155 | Ga0373946_0026369 | 3300035171 | Bacteria | 2292 |
| 156 | Ga0373927_0001895 | 3300035695 | Bacteria | 15450 |
| 157 | Ga0373937_0344598 | 3300036401 | Bacteria | 1411 |
| 158 | Ga0373925_0000061 | 3300037068 | Bacteria | 117783 |
| 159 | Ga0395899_0048104 | 3300037312 | Bacteria | 3175 |
| 160 | Ga0395900_0159982 | 3300037418 | Bacteria | 2297 |
| 161 | Ga0395905_0008081 | 3300037471 | Bacteria | 10392 |
| 162 | Ga0395905_0017165 | 3300037471 | Bacteria | 6876 |
| 163 | Ga0395905_0069763 | 3300037471 | Bacteria | 3292 |
| 164 | Ga0436364_0602296 | 3300037853 | Bacteria | 2050 |
| 165 | Ga0395901_0057840 | 3300038443 | Bacteria | 4033 |
| 166 | Ga0436365_0736661 | 3300039437 | Bacteria | 8176 |
| 167 | Ga0436361_0144463 | 3300039447 | Bacteria | 26892 |
| 168 | Ga0436361_0825753 | 3300039447 | Bacteria | 5102 |
| 169 | Ga0466969_0019776 | 3300044656 | Bacteria | 3493 |
| 170 | Ga0466966_0000942 | 3300044684 | Bacteria | 18596 |
| 171 | Ga0466961_0009320 | 3300044693 | Bacteria | 6253 |
| 172 | Ga0466959_0007921 | 3300045049 | Bacteria | 7484 |
| 173 | Ga0495629_0029291 | 3300046459 | Bacteria | 3905 |
| 174 | Ga0495638_0000701 | 3300046460 | Bacteria | 36250 |
| 175 | Ga0495638_0001003 | 3300046460 | Bacteria | 28322 |
| 176 | Ga0495638_0030128 | 3300046460 | Bacteria | 3495 |
| 177 | Ga0495638_0060017 | 3300046460 | Bacteria | 2353 |
| 178 | Ga0495650_0000017 | 3300046471 | Bacteria | 542552 |
| 179 | Ga0495583_0000020 | 3300046506 | Bacteria | 296185 |
| 180 | Ga0495606_0009121 | 3300046507 | Bacteria | 8448 |
| 181 | Ga0495606_0057975 | 3300046507 | Bacteria | 2492 |
| 182 | Ga0495610_0000535 | 3300046512 | Bacteria | 38235 |
| 183 | Ga0495610_0004890 | 3300046512 | Bacteria | 9740 |
| 184 | Ga0495610_0014329 | 3300046512 | Bacteria | 4662 |
| 185 | Ga0495616_0000375 | 3300046513 | Bacteria | 34773 |
| 186 | Ga0495620_0019711 | 3300046515 | Bacteria | 3311 |
| 187 | Ga0495631_0003608 | 3300046518 | Bacteria | 8446 |
| 188 | Ga0495632_0024633 | 3300046519 | Bacteria | 3193 |
| 189 | Ga0495632_0058697 | 3300046519 | Bacteria | 1874 |
| 190 | Ga0495637_0006004 | 3300046520 | Bacteria | 6137 |
| 191 | Ga0495648_0000154 | 3300046524 | Bacteria | 81679 |
| 192 | Ga0495642_0003162 | 3300046528 | Bacteria | 6531 |
| 193 | Ga0495654_0001339 | 3300046530 | Bacteria | 17152 |
| 194 | Ga0495609_0105251 | 3300046538 | Bacteria | 1220 |
| 195 | Ga0495597_0002864 | 3300046542 | Bacteria | 10537 |
| 196 | Ga0495622_0005742 | 3300046557 | Bacteria | 5753 |
| 197 | Ga0495668_0000092 | 3300046616 | Bacteria | 142835 |
| 198 | Ga0495668_0006042 | 3300046616 | Bacteria | 8023 |
| 199 | Ga0495668_0014974 | 3300046616 | Bacteria | 4537 |
| 200 | Ga0495668_0026617 | 3300046616 | Bacteria | 3281 |
| 201 | Ga0495668_0049541 | 3300046616 | Bacteria | 2329 |
| 202 | Ga0495625_0000865 | 3300046660 | Bacteria | 41188 |
| 203 | Ga0495625_0003577 | 3300046660 | Bacteria | 15316 |
| 204 | Ga0495625_0011340 | 3300046660 | Bacteria | 7277 |
| 205 | Ga0495625_0012928 | 3300046660 | Bacteria | 6739 |
| 206 | Ga0495625_0018510 | 3300046660 | Bacteria | 5435 |
| 207 | Ga0495669_0000199 | 3300046684 | Bacteria | 36829 |
| 208 | Ga0495649_0000807 | 3300046694 | Bacteria | 25271 |
| 209 | Ga0495589_0069321 | 3300046794 | Bacteria | 1725 |
| 210 | Ga0495672_0002681 | 3300047320 | Bacteria | 16015 |
| 211 | Ga0495672_0006463 | 3300047320 | Bacteria | 9068 |
| 212 | Ga0495679_002984 | 3300047446 | Bacteria | 8342 |
| 213 | Ga0495673_0000078 | 3300047469 | Bacteria | 203066 |
| 214 | Ga0495673_0002407 | 3300047469 | Bacteria | 13187 |
| 215 | Ga0495673_0006904 | 3300047469 | Bacteria | 6613 |
| 216 | Ga0495681_0076857 | 3300047470 | Bacteria | 1500 |
| 217 | Ga0495686_0000525 | 3300047472 | Bacteria | 55165 |
| 218 | Ga0495686_0011689 | 3300047472 | Bacteria | 6181 |
| 219 | Ga0496100_0145097 | 3300048903 | Bacteria | 1687 |
| 220 | Ga0496102_0050200 | 3300048905 | Bacteria | 3798 |
| 221 | Ga0496102_0074054 | 3300048905 | Bacteria | 3130 |
| 222 | Ga0496104_0096028 | 3300048907 | Bacteria | 2836 |
| 223 | Ga0496107_0000125 | 3300048910 | Bacteria | 37117 |
| 224 | Ga0496107_0098936 | 3300048910 | Bacteria | 2137 |
| 225 | Ga0496109_0002851 | 3300048912 | Bacteria | 14465 |
| 226 | Ga0496110_0199197 | 3300048913 | Bacteria | 1819 |
| 227 | Ga0496115_0002134 | 3300048918 | Bacteria | 14137 |
| 228 | Ga0496115_0003418 | 3300048918 | Bacteria | 11405 |
| 229 | Ga0496115_0077907 | 3300048918 | Bacteria | 2696 |
| 230 | Ga0496115_0114636 | 3300048918 | Bacteria | 2215 |
| 231 | Ga0496117_0018325 | 3300048920 | Bacteria | 5804 |
| 232 | Ga0496118_0008616 | 3300048921 | Bacteria | 10495 |
| 233 | Ga0496121_0000009 | 3300048924 | Bacteria | 836971 |
| 234 | Ga0496121_0002520 | 3300048924 | Bacteria | 27781 |
| 235 | Ga0496122_0039212 | 3300048925 | Bacteria | 3780 |
| 236 | Ga0496123_0001713 | 3300048926 | Bacteria | 29280 |
| 237 | Ga0496125_0055276 | 3300048928 | Bacteria | 3236 |
| 238 | Ga0496126_0003112 | 3300048929 | Bacteria | 21403 |
| 239 | Ga0495678_000659 | 3300049459 | Bacteria | 31659 |
| 240 | Ga0501033_0137924 | 3300049570 | Bacteria | 1765 |
| 241 | Ga0501034_0075191 | 3300049571 | Bacteria | 3386 |
| 242 | Ga0501034_0111616 | 3300049571 | Bacteria | 2725 |
| 243 | Ga0501047_0100166 | 3300049581 | Bacteria | 2777 |
| 244 | Ga0501047_0285988 | 3300049581 | Bacteria | 1493 |
| 245 | Ga0501238_001180 | 3300049671 | Bacteria | 2978 |
| 246 | Ga0501044_0162484 | 3300049823 | Bacteria | 2209 |
| 247 | Ga0501044_0450430 | 3300049823 | Bacteria | 1194 |
| 248 | nmdc:mga03n38_58695_c1 | 3300050490 | Bacteria | 1744 |
| 249 | nmdc:mga00v17_423_c1 | 3300050491 | Bacteria | 23976 |
| 250 | nmdc:mga0k408_108593_c1 | 3300050493 | Bacteria | 1639 |
| 251 | nmdc:mga04h51_5801_c1 | 3300050495 | Bacteria | 3164 |
| 252 | nmdc:mga07m45_1047_c1 | 3300050496 | Bacteria | 12323 |
| 253 | nmdc:mga07m45_224677_c1 | 3300050496 | Bacteria | 1092 |
| 254 | Ga0500635_0000228 | 3300053080 | Bacteria | 24908 |
| 255 | Ga0500635_0012612 | 3300053080 | Bacteria | 2432 |
| 256 | Ga0500578_0000092 | 3300053086 | Bacteria | 102206 |
| 257 | Ga0500643_000432 | 3300053087 | Bacteria | 31579 |
| 258 | Ga0500643_000609 | 3300053087 | Bacteria | 24354 |
| 259 | Ga0500644_0001143 | 3300053088 | Bacteria | 7726 |
| 260 | Ga0500644_0003597 | 3300053088 | Bacteria | 3846 |
| 261 | Ga0500647_0048623 | 3300053091 | Bacteria | 2039 |
| 262 | Ga0500651_0122869 | 3300053093 | Bacteria | 1574 |
| 263 | Ga0500555_023928 | 3300053103 | Bacteria | 1752 |
| 264 | Ga0500555_026914 | 3300053103 | Bacteria | 1642 |
| 265 | Ga0500556_0000944 | 3300053104 | Bacteria | 15720 |
| 266 | Ga0500556_0002063 | 3300053104 | Bacteria | 6943 |
| 267 | Ga0500556_0007721 | 3300053104 | Bacteria | 3081 |
| 268 | Ga0500557_007269 | 3300053105 | Bacteria | 2575 |
| 269 | Ga0500562_003772 | 3300053108 | Bacteria | 3811 |
| 270 | Ga0500562_020328 | 3300053108 | Bacteria | 1723 |
| 271 | Ga0500569_003259 | 3300053109 | Bacteria | 3296 |
| 272 | Ga0500594_0000140 | 3300053118 | Bacteria | 20041 |
| 273 | Ga0500595_053054 | 3300053119 | Bacteria | 1250 |
| 274 | Ga0500608_000059 | 3300053122 | Bacteria | 48253 |
| 275 | Ga0500608_000267 | 3300053122 | Bacteria | 20141 |
| 276 | Ga0500608_001944 | 3300053122 | Bacteria | 7387 |
| 277 | Ga0500618_000060 | 3300053125 | Bacteria | 97135 |
| 278 | Ga0500658_0027003 | 3300053134 | Bacteria | 2216 |
| 279 | Ga0500559_0000005 | 3300053136 | Bacteria | 230231 |
| 280 | Ga0500559_0001872 | 3300053136 | Bacteria | 11450 |
| 281 | Ga0500559_0076389 | 3300053136 | Bacteria | 1516 |
| 282 | Ga0500564_001592 | 3300053138 | Bacteria | 7944 |
| 283 | Ga0500590_078039 | 3300053148 | Bacteria | 1633 |
| 284 | Ga0500616_0011241 | 3300053153 | Bacteria | 5303 |
| 285 | Ga0500616_0015084 | 3300053153 | Bacteria | 4427 |
| 286 | Ga0500619_044649 | 3300053154 | Bacteria | 1414 |
| 287 | Ga0500622_0000105 | 3300053156 | Bacteria | 85855 |
| 288 | Ga0500622_0009132 | 3300053156 | Bacteria | 5503 |
| 289 | Ga0500622_0044249 | 3300053156 | Bacteria | 2307 |
| 290 | Ga0500637_0007603 | 3300053178 | Bacteria | 5430 |
| 291 | Ga0500611_000576 | 3300053727 | Bacteria | 3733 |
| 292 | Ga0500625_021987 | 3300053729 | Bacteria | 3011 |
| 293 | Ga0500645_000649 | 3300053730 | Bacteria | 21995 |
| 294 | Ga0500645_001221 | 3300053730 | Bacteria | 13557 |
| 295 | Ga0500645_008592 | 3300053730 | Bacteria | 3475 |
| 296 | Ga0500609_000829 | 3300053731 | Bacteria | 4650 |
| 297 | Ga0466962_0000385 | 3300061719 | Bacteria | 19029 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037312 | Ga0395899_0048104 | Ga0395899_0048104_38_913 | 291 |
| 2 | 3300013105 | Ga0157369_10079745 | Ga0157369_100797452 | 310 |
| 3 | 3300048925 | Ga0496122_0039212 | Ga0496122_0039212_416_1453 | 310 |
| 4 | 3300048926 | Ga0496123_0001713 | Ga0496123_0001713_3481_4518 | 310 |
| 5 | 3300031824 | Ga0307413_10066388 | Ga0307413_100663882 | 312 |
| 6 | 3300048918 | Ga0496115_0077907 | Ga0496115_0077907_334_1347 | 321 |
| 7 | 3300003578 | Ga0006562J51391_1161223 | Ga0006562J51391_11612235 | 322 |
| 8 | 3300039447 | Ga0436361_0825753 | Ga0436361_0825753_29_1042 | 325 |
| 9 | 3300047470 | Ga0495681_0076857 | Ga0495681_0076857_254_1282 | 327 |
| 10 | 3300046684 | Ga0495669_0000199 | Ga0495669_0000199_27920_28948 | 330 |
| 11 | iso_pu_bacteria | 2739367756 | 2739791325 | 333 |
| 12 | 3300037471 | Ga0395905_0008081 | Ga0395905_0008081_2082_3095 | 336 |
| 13 | 3300003323 | rootH1_10010156 | rootH1_100101562 | 337 |
| 14 | 3300003323 | rootH1_10294932 | rootH1_102949322 | 337 |
| 15 | 3300005341 | Ga0070691_10039781 | Ga0070691_100397814 | 337 |
| 16 | 3300005364 | Ga0070673_100087553 | Ga0070673_1000875531 | 337 |
| 17 | 3300005456 | Ga0070678_100124118 | Ga0070678_1001241183 | 337 |
| 18 | 3300005458 | Ga0070681_10042690 | Ga0070681_100426904 | 337 |
| 19 | 3300005530 | Ga0070679_100008769 | Ga0070679_1000087699 | 337 |
| 20 | 3300005539 | Ga0068853_100042350 | Ga0068853_1000423502 | 337 |
| 21 | 3300005539 | Ga0068853_100262808 | Ga0068853_1002628082 | 337 |
| 22 | 3300005614 | Ga0068856_100085847 | Ga0068856_1000858474 | 337 |
| 23 | 3300006358 | Ga0068871_100102350 | Ga0068871_1001023503 | 337 |
| 24 | 3300006881 | Ga0068865_100000711 | Ga0068865_1000007115 | 337 |
| 25 | 3300009093 | Ga0105240_10110071 | Ga0105240_101100713 | 337 |
| 26 | 3300009177 | Ga0105248_10065422 | Ga0105248_100654225 | 337 |
| 27 | 3300009177 | Ga0105248_10289191 | Ga0105248_102891912 | 337 |
| 28 | 3300009551 | Ga0105238_10017833 | Ga0105238_100178338 | 337 |
| 29 | 3300010375 | Ga0105239_10172338 | Ga0105239_101723382 | 337 |
| 30 | 3300013100 | Ga0157373_10001429 | Ga0157373_100014296 | 337 |
| 31 | 3300013100 | Ga0157373_10008774 | Ga0157373_100087743 | 337 |
| 32 | 3300013306 | Ga0163162_10121750 | Ga0163162_101217502 | 337 |
| 33 | 3300013308 | Ga0157375_10054144 | Ga0157375_100541442 | 337 |
| 34 | 3300014325 | Ga0163163_10015019 | Ga0163163_100150195 | 337 |
| 35 | 3300014325 | Ga0163163_10112597 | Ga0163163_101125972 | 337 |
| 36 | 3300015684 | Ga0183365_10002 | Ga0183365_10002245 | 337 |
| 37 | 3300025909 | Ga0207705_10190540 | Ga0207705_101905402 | 337 |
| 38 | 3300025912 | Ga0207707_10065129 | Ga0207707_100651292 | 337 |
| 39 | 3300025913 | Ga0207695_10001229 | Ga0207695_1000122933 | 337 |
| 40 | 3300025913 | Ga0207695_10014530 | Ga0207695_100145308 | 337 |
| 41 | 3300025919 | Ga0207657_10127482 | Ga0207657_101274823 | 337 |
| 42 | 3300025931 | Ga0207644_10002801 | Ga0207644_1000280112 | 337 |
| 43 | 3300025938 | Ga0207704_10001140 | Ga0207704_100011406 | 337 |
| 44 | 3300025941 | Ga0207711_10039688 | Ga0207711_100396881 | 337 |
| 45 | 3300025941 | Ga0207711_10273606 | Ga0207711_102736062 | 337 |
| 46 | 3300025949 | Ga0207667_10038385 | Ga0207667_100383853 | 337 |
| 47 | 3300026041 | Ga0207639_10203924 | Ga0207639_102039242 | 337 |
| 48 | 3300026078 | Ga0207702_10095853 | Ga0207702_100958533 | 337 |
| 49 | 3300026078 | Ga0207702_10377831 | Ga0207702_103778312 | 337 |
| 50 | 3300026088 | Ga0207641_10167164 | Ga0207641_101671642 | 337 |
| 51 | 3300026095 | Ga0207676_10026896 | Ga0207676_100268965 | 337 |
| 52 | 3300026118 | Ga0207675_100318047 | Ga0207675_1003180472 | 337 |
| 53 | 3300026121 | Ga0207683_10141412 | Ga0207683_101414122 | 337 |
| 54 | 3300028379 | Ga0268266_10000064 | Ga0268266_10000064188 | 337 |
| 55 | 3300035113 | Ga0373936_0009932 | Ga0373936_0009932_2153_3166 | 337 |
| 56 | 3300035171 | Ga0373946_0026369 | Ga0373946_0026369_703_1716 | 337 |
| 57 | 3300035695 | Ga0373927_0001895 | Ga0373927_0001895_4848_5861 | 337 |
| 58 | 3300037068 | Ga0373925_0000061 | Ga0373925_0000061_17522_18535 | 337 |
| 59 | 3300037471 | Ga0395905_0017165 | Ga0395905_0017165_2610_3623 | 337 |
| 60 | 3300044656 | Ga0466969_0019776 | Ga0466969_0019776_232_1245 | 337 |
| 61 | 3300044684 | Ga0466966_0000942 | Ga0466966_0000942_540_1553 | 337 |
| 62 | 3300044693 | Ga0466961_0009320 | Ga0466961_0009320_5140_6153 | 337 |
| 63 | 3300045049 | Ga0466959_0007921 | Ga0466959_0007921_3932_4945 | 337 |
| 64 | 3300046528 | Ga0495642_0003162 | Ga0495642_0003162_5377_6390 | 337 |
| 65 | 3300047320 | Ga0495672_0006463 | Ga0495672_0006463_4965_5978 | 337 |
| 66 | 3300048903 | Ga0496100_0145097 | Ga0496100_0145097_428_1441 | 337 |
| 67 | 3300048905 | Ga0496102_0074054 | Ga0496102_0074054_1722_2735 | 337 |
| 68 | 3300048907 | Ga0496104_0096028 | Ga0496104_0096028_566_1579 | 337 |
| 69 | 3300048912 | Ga0496109_0002851 | Ga0496109_0002851_12751_13764 | 337 |
| 70 | 3300048913 | Ga0496110_0199197 | Ga0496110_0199197_720_1733 | 337 |
| 71 | 3300048918 | Ga0496115_0002134 | Ga0496115_0002134_6768_7781 | 337 |
| 72 | 3300048918 | Ga0496115_0003418 | Ga0496115_0003418_9370_10383 | 337 |
| 73 | 3300049570 | Ga0501033_0137924 | Ga0501033_0137924_526_1539 | 337 |
| 74 | 3300049571 | Ga0501034_0075191 | Ga0501034_0075191_2031_3047 | 337 |
| 75 | 3300049571 | Ga0501034_0111616 | Ga0501034_0111616_20_1036 | 337 |
| 76 | 3300049581 | Ga0501047_0285988 | Ga0501047_0285988_437_1450 | 337 |
| 77 | 3300049823 | Ga0501044_0162484 | Ga0501044_0162484_685_1698 | 337 |
| 78 | 3300053080 | Ga0500635_0012612 | Ga0500635_0012612_146_1162 | 337 |
| 79 | 3300053087 | Ga0500643_000432 | Ga0500643_000432_10578_11591 | 337 |
| 80 | 3300053091 | Ga0500647_0048623 | Ga0500647_0048623_723_1736 | 337 |
| 81 | 3300053122 | Ga0500608_000267 | Ga0500608_000267_16772_17788 | 337 |
| 82 | 3300053136 | Ga0500559_0076389 | Ga0500559_0076389_484_1500 | 337 |
| 83 | 3300053148 | Ga0500590_078039 | Ga0500590_078039_463_1476 | 337 |
| 84 | 3300061719 | Ga0466962_0000385 | Ga0466962_0000385_1977_2990 | 337 |
| 85 | iso_pu_bacteria | 2585428106 | 2587916681 | 337 |
| 86 | iso_pu_bacteria | 2643221552 | 2643778253 | 337 |
| 87 | iso_pu_bacteria | 2643221584 | 2643927487 | 337 |
| 88 | iso_pu_bacteria | 2643221640 | 2644225788 | 337 |
| 89 | iso_pu_bacteria | 2643221642 | 2644235277 | 337 |
| 90 | iso_pu_bacteria | 2857504554 | 2857506322 | 337 |
| 91 | iso_pu_bacteria | 2884960567 | 2884965070 | 337 |
| 92 | iso_pu_bacteria | 2928531327 | 2928535346 | 337 |
| 93 | 3300005842 | Ga0068858_100178655 | Ga0068858_1001786552 | 338 |
| 94 | 3300021361 | Ga0213872_10024810 | Ga0213872_100248103 | 338 |
| 95 | 3300025250 | Ga0209026_1009226 | Ga0209026_10092262 | 338 |
| 96 | 3300031456 | Ga0307513_10000448 | Ga0307513_1000044833 | 338 |
| 97 | 3300039447 | Ga0436361_0144463 | Ga0436361_0144463_14714_15736 | 338 |
| 98 | 3300053087 | Ga0500643_000609 | Ga0500643_000609_14250_15266 | 338 |
| 99 | 3300053103 | Ga0500555_023928 | Ga0500555_023928_244_1260 | 338 |
| 100 | 3300053104 | Ga0500556_0007721 | Ga0500556_0007721_207_1223 | 338 |
| 101 | 3300053105 | Ga0500557_007269 | Ga0500557_007269_1337_2353 | 338 |
| 102 | 3300053153 | Ga0500616_0011241 | Ga0500616_0011241_1626_2642 | 338 |
| 103 | 3300053156 | Ga0500622_0009132 | Ga0500622_0009132_2349_3365 | 338 |
| 104 | 3300053730 | Ga0500645_000649 | Ga0500645_000649_18531_19547 | 338 |
| 105 | iso_pu_bacteria | 2510917020 | 2511124334 | 338 |
| 106 | iso_pu_bacteria | 2582581279 | 2585148670 | 338 |
| 107 | iso_pu_bacteria | 2582581280 | 2585153145 | 338 |
| 108 | iso_pu_bacteria | 2582581293 | 2585196706 | 338 |
| 109 | iso_pu_bacteria | 2643221545 | 2643751463 | 338 |
| 110 | iso_pu_bacteria | 2643221574 | 2643883283 | 338 |
| 111 | iso_pu_bacteria | 2643221583 | 2643923535 | 338 |
| 112 | iso_pu_bacteria | 2643221598 | 2644000245 | 338 |
| 113 | iso_pu_bacteria | 2643221663 | 2644351927 | 338 |
| 114 | iso_pu_bacteria | 2643221691 | 2644510485 | 338 |
| 115 | iso_pu_bacteria | 2643221699 | 2644547546 | 338 |
| 116 | iso_pu_bacteria | 2643221699 | 2644547899 | 338 |
| 117 | iso_pu_bacteria | 2791355048 | 2792463304 | 338 |
| 118 | iso_pu_bacteria | 2818991435 | 2819536555 | 338 |
| 119 | iso_pu_bacteria | 2818991454 | 2819645716 | 338 |
| 120 | iso_pu_bacteria | 2843744320 | 2843748107 | 338 |
| 121 | iso_pu_bacteria | 2849560528 | 2849564855 | 338 |
| 122 | iso_pu_bacteria | 2849573788 | 2849578149 | 338 |
| 123 | iso_pu_bacteria | 2851153111 | 2851154573 | 338 |
| 124 | iso_pu_bacteria | 2898329390 | 2898329795 | 338 |
| 125 | iso_pu_bacteria | 2928972540 | 2928975086 | 338 |
| 126 | iso_pu_bacteria | 2977240413 | 2977241921 | 338 |
| 127 | 3300053104 | Ga0500556_0000944 | Ga0500556_0000944_1916_2935 | 339 |
| 128 | 3300053108 | Ga0500562_020328 | Ga0500562_020328_352_1371 | 339 |
| 129 | 3300053730 | Ga0500645_001221 | Ga0500645_001221_4226_5245 | 339 |
| 130 | 3300006042 | Ga0075368_10000575 | Ga0075368_100005755 | 340 |
| 131 | 3300006048 | Ga0075363_100129284 | Ga0075363_1001292842 | 340 |
| 132 | 3300006051 | Ga0075364_10000306 | Ga0075364_1000030611 | 340 |
| 133 | 3300006178 | Ga0075367_10015263 | Ga0075367_100152634 | 340 |
| 134 | 3300006195 | Ga0075366_10035857 | Ga0075366_100358574 | 340 |
| 135 | 3300006353 | Ga0075370_10048091 | Ga0075370_100480912 | 340 |
| 136 | 3300006353 | Ga0075370_10103895 | Ga0075370_101038951 | 340 |
| 137 | 3300027866 | Ga0209813_10005717 | Ga0209813_100057173 | 340 |
| 138 | 3300050490 | nmdc:mga03n38_58695_c1 | nmdc:mga03n38_58695_c1_289_1311 | 340 |
| 139 | 3300050491 | nmdc:mga00v17_423_c1 | nmdc:mga00v17_423_c1_10273_11295 | 340 |
| 140 | 3300050493 | nmdc:mga0k408_108593_c1 | nmdc:mga0k408_108593_c1_236_1258 | 340 |
| 141 | 3300050495 | nmdc:mga04h51_5801_c1 | nmdc:mga04h51_5801_c1_1585_2607 | 340 |
| 142 | 3300050496 | nmdc:mga07m45_1047_c1 | nmdc:mga07m45_1047_c1_6745_7767 | 340 |
| 143 | 3300053119 | Ga0500595_053054 | Ga0500595_053054_207_1229 | 340 |
| 144 | 3300003781 | Ga0055536_1001278 | Ga0055536_10012787 | 341 |
| 145 | 3300003791 | Ga0055530_10004385 | Ga0055530_100043857 | 341 |
| 146 | 3300003791 | Ga0055530_10004852 | Ga0055530_100048525 | 341 |
| 147 | 3300003794 | Ga0055531_10001195 | Ga0055531_100011957 | 341 |
| 148 | 3300005262 | Ga0065165_1005110 | Ga0065165_10051105 | 341 |
| 149 | 3300005347 | Ga0070668_100000097 | Ga0070668_10000009754 | 341 |
| 150 | 3300005347 | Ga0070668_100015206 | Ga0070668_1000152063 | 341 |
| 151 | 3300005353 | Ga0070669_100039406 | Ga0070669_1000394064 | 341 |
| 152 | 3300005355 | Ga0070671_100000342 | Ga0070671_10000034226 | 341 |
| 153 | 3300005367 | Ga0070667_100000083 | Ga0070667_10000008365 | 341 |
| 154 | 3300005367 | Ga0070667_100175304 | Ga0070667_1001753042 | 341 |
| 155 | 3300005548 | Ga0070665_100000483 | Ga0070665_10000048329 | 341 |
| 156 | 3300005617 | Ga0068859_100000435 | Ga0068859_10000043525 | 341 |
| 157 | 3300005841 | Ga0068863_100000007 | Ga0068863_100000007169 | 341 |
| 158 | 3300005841 | Ga0068863_100001697 | Ga0068863_10000169715 | 341 |
| 159 | 3300005841 | Ga0068863_100006190 | Ga0068863_1000061906 | 341 |
| 160 | 3300005842 | Ga0068858_100000031 | Ga0068858_100000031109 | 341 |
| 161 | 3300005843 | Ga0068860_100000128 | Ga0068860_1000001287 | 341 |
| 162 | 3300005844 | Ga0068862_100001627 | Ga0068862_10000162721 | 341 |
| 163 | 3300005844 | Ga0068862_100154567 | Ga0068862_1001545672 | 341 |
| 164 | 3300005844 | Ga0068862_100199887 | Ga0068862_1001998872 | 341 |
| 165 | 3300006186 | Ga0075369_10040957 | Ga0075369_100409572 | 341 |
| 166 | 3300006195 | Ga0075366_10005124 | Ga0075366_100051244 | 341 |
| 167 | 3300006353 | Ga0075370_10101080 | Ga0075370_101010802 | 341 |
| 168 | 3300006931 | Ga0097620_100000435 | Ga0097620_10000043525 | 341 |
| 169 | 3300009093 | Ga0105240_10044492 | Ga0105240_100444922 | 341 |
| 170 | 3300009177 | Ga0105248_10023180 | Ga0105248_100231807 | 341 |
| 171 | 3300009553 | Ga0105249_10008103 | Ga0105249_100081038 | 341 |
| 172 | 3300013306 | Ga0163162_10019316 | Ga0163162_100193165 | 341 |
| 173 | 3300014968 | Ga0157379_10006808 | Ga0157379_100068084 | 341 |
| 174 | 3300014968 | Ga0157379_10007773 | Ga0157379_100077737 | 341 |
| 175 | 3300014968 | Ga0157379_10181345 | Ga0157379_101813452 | 341 |
| 176 | 3300025292 | Ga0209676_1000327 | Ga0209676_100032768 | 341 |
| 177 | 3300025292 | Ga0209676_1000409 | Ga0209676_100040952 | 341 |
| 178 | 3300025295 | Ga0209564_1003963 | Ga0209564_10039634 | 341 |
| 179 | 3300025298 | Ga0209050_1001093 | Ga0209050_100109326 | 341 |
| 180 | 3300025298 | Ga0209050_1001133 | Ga0209050_10011339 | 341 |
| 181 | 3300025303 | Ga0209051_1000338 | Ga0209051_100033823 | 341 |
| 182 | 3300025304 | Ga0209257_1000609 | Ga0209257_10006097 | 341 |
| 183 | 3300025304 | Ga0209257_1003210 | Ga0209257_10032108 | 341 |
| 184 | 3300025903 | Ga0207680_10191715 | Ga0207680_101917152 | 341 |
| 185 | 3300025913 | Ga0207695_10234955 | Ga0207695_102349552 | 341 |
| 186 | 3300025923 | Ga0207681_10024635 | Ga0207681_100246354 | 341 |
| 187 | 3300025925 | Ga0207650_10000062 | Ga0207650_1000006225 | 341 |
| 188 | 3300025931 | Ga0207644_10001653 | Ga0207644_100016532 | 341 |
| 189 | 3300025941 | Ga0207711_10003138 | Ga0207711_100031385 | 341 |
| 190 | 3300025941 | Ga0207711_10057373 | Ga0207711_100573734 | 341 |
| 191 | 3300025941 | Ga0207711_10069466 | Ga0207711_100694664 | 341 |
| 192 | 3300025949 | Ga0207667_10034613 | Ga0207667_100346135 | 341 |
| 193 | 3300025961 | Ga0207712_10001626 | Ga0207712_100016266 | 341 |
| 194 | 3300025961 | Ga0207712_10347735 | Ga0207712_103477351 | 341 |
| 195 | 3300025972 | Ga0207668_10000028 | Ga0207668_1000002877 | 341 |
| 196 | 3300025972 | Ga0207668_10000507 | Ga0207668_1000050723 | 341 |
| 197 | 3300025972 | Ga0207668_10009769 | Ga0207668_100097693 | 341 |
| 198 | 3300025986 | Ga0207658_10000209 | Ga0207658_1000020956 | 341 |
| 199 | 3300025986 | Ga0207658_10002861 | Ga0207658_100028617 | 341 |
| 200 | 3300025986 | Ga0207658_10019258 | Ga0207658_100192582 | 341 |
| 201 | 3300026035 | Ga0207703_10000038 | Ga0207703_1000003879 | 341 |
| 202 | 3300026088 | Ga0207641_10000012 | Ga0207641_10000012140 | 341 |
| 203 | 3300026088 | Ga0207641_10000341 | Ga0207641_100003419 | 341 |
| 204 | 3300026088 | Ga0207641_10012230 | Ga0207641_100122307 | 341 |
| 205 | 3300026095 | Ga0207676_10000255 | Ga0207676_1000025539 | 341 |
| 206 | 3300028379 | Ga0268266_10000792 | Ga0268266_1000079223 | 341 |
| 207 | 3300028379 | Ga0268266_10001340 | Ga0268266_1000134029 | 341 |
| 208 | 3300028380 | Ga0268265_10002811 | Ga0268265_100028113 | 341 |
| 209 | 3300028380 | Ga0268265_10135745 | Ga0268265_101357452 | 341 |
| 210 | 3300028380 | Ga0268265_10457862 | Ga0268265_104578622 | 341 |
| 211 | 3300028381 | Ga0268264_10000059 | Ga0268264_10000059245 | 341 |
| 212 | 3300028381 | Ga0268264_10052179 | Ga0268264_100521791 | 341 |
| 213 | 3300028786 | Ga0307517_10131488 | Ga0307517_101314882 | 341 |
| 214 | 3300028786 | Ga0307517_10227404 | Ga0307517_102274041 | 341 |
| 215 | 3300031911 | Ga0307412_10056547 | Ga0307412_100565472 | 341 |
| 216 | 3300036401 | Ga0373937_0344598 | Ga0373937_0344598_101_1126 | 341 |
| 217 | 3300037418 | Ga0395900_0159982 | Ga0395900_0159982_591_1616 | 341 |
| 218 | 3300037471 | Ga0395905_0069763 | Ga0395905_0069763_984_2009 | 341 |
| 219 | 3300037853 | Ga0436364_0602296 | Ga0436364_0602296_574_1599 | 341 |
| 220 | 3300038443 | Ga0395901_0057840 | Ga0395901_0057840_2102_3127 | 341 |
| 221 | 3300039437 | Ga0436365_0736661 | Ga0436365_0736661_2788_3813 | 341 |
| 222 | 3300046459 | Ga0495629_0029291 | Ga0495629_0029291_1197_2222 | 341 |
| 223 | 3300046460 | Ga0495638_0030128 | Ga0495638_0030128_2191_3216 | 341 |
| 224 | 3300046507 | Ga0495606_0009121 | Ga0495606_0009121_6186_7211 | 341 |
| 225 | 3300046507 | Ga0495606_0057975 | Ga0495606_0057975_49_1074 | 341 |
| 226 | 3300046513 | Ga0495616_0000375 | Ga0495616_0000375_26450_27475 | 341 |
| 227 | 3300046519 | Ga0495632_0024633 | Ga0495632_0024633_18_1043 | 341 |
| 228 | 3300046519 | Ga0495632_0058697 | Ga0495632_0058697_832_1857 | 341 |
| 229 | 3300046538 | Ga0495609_0105251 | Ga0495609_0105251_10_1035 | 341 |
| 230 | 3300046542 | Ga0495597_0002864 | Ga0495597_0002864_7576_8601 | 341 |
| 231 | 3300046557 | Ga0495622_0005742 | Ga0495622_0005742_750_1775 | 341 |
| 232 | 3300046616 | Ga0495668_0000092 | Ga0495668_0000092_70377_71402 | 341 |
| 233 | 3300046616 | Ga0495668_0014974 | Ga0495668_0014974_3393_4418 | 341 |
| 234 | 3300046616 | Ga0495668_0026617 | Ga0495668_0026617_1952_2977 | 341 |
| 235 | 3300046616 | Ga0495668_0049541 | Ga0495668_0049541_672_1697 | 341 |
| 236 | 3300048905 | Ga0496102_0050200 | Ga0496102_0050200_344_1369 | 341 |
| 237 | 3300048920 | Ga0496117_0018325 | Ga0496117_0018325_2766_3791 | 341 |
| 238 | 3300048921 | Ga0496118_0008616 | Ga0496118_0008616_3603_4628 | 341 |
| 239 | 3300048924 | Ga0496121_0000009 | Ga0496121_0000009_639836_640861 | 341 |
| 240 | 3300048928 | Ga0496125_0055276 | Ga0496125_0055276_1269_2294 | 341 |
| 241 | 3300048929 | Ga0496126_0003112 | Ga0496126_0003112_8858_9883 | 341 |
| 242 | 3300049581 | Ga0501047_0100166 | Ga0501047_0100166_1432_2457 | 341 |
| 243 | 3300050496 | nmdc:mga07m45_224677_c1 | nmdc:mga07m45_224677_c1_33_1058 | 341 |
| 244 | 3300053080 | Ga0500635_0000228 | Ga0500635_0000228_15213_16238 | 341 |
| 245 | 3300053109 | Ga0500569_003259 | Ga0500569_003259_2170_3195 | 341 |
| 246 | 3300053122 | Ga0500608_000059 | Ga0500608_000059_26245_27270 | 341 |
| 247 | 3300053122 | Ga0500608_001944 | Ga0500608_001944_2347_3372 | 341 |
| 248 | 3300053154 | Ga0500619_044649 | Ga0500619_044649_148_1173 | 341 |
| 249 | 3300053156 | Ga0500622_0044249 | Ga0500622_0044249_642_1667 | 341 |
| 250 | 3300053178 | Ga0500637_0007603 | Ga0500637_0007603_1197_2222 | 341 |
| 251 | 3300053729 | Ga0500625_021987 | Ga0500625_021987_135_1160 | 341 |
| 252 | 3300053731 | Ga0500609_000829 | Ga0500609_000829_3586_4611 | 341 |
| 253 | 3300003215 | JGI25153J46596_10019310 | JGI25153J46596_100193103 | 342 |
| 254 | 3300003773 | Ga0055537_1002170 | Ga0055537_10021703 | 342 |
| 255 | 3300003781 | Ga0055536_1003888 | Ga0055536_10038885 | 342 |
| 256 | 3300003790 | Ga0055528_1019189 | Ga0055528_10191891 | 342 |
| 257 | 3300003794 | Ga0055531_10001530 | Ga0055531_100015309 | 342 |
| 258 | 3300003794 | Ga0055531_10021297 | Ga0055531_100212971 | 342 |
| 259 | 3300013105 | Ga0157369_10197726 | Ga0157369_101977262 | 342 |
| 260 | 3300025263 | Ga0209565_1000781 | Ga0209565_100078113 | 342 |
| 261 | 3300025273 | Ga0209673_1000523 | Ga0209673_100052350 | 342 |
| 262 | 3300025292 | Ga0209676_1000061 | Ga0209676_100006129 | 342 |
| 263 | 3300025297 | Ga0209758_1003805 | Ga0209758_10038054 | 342 |
| 264 | 3300025298 | Ga0209050_1004203 | Ga0209050_100420310 | 342 |
| 265 | 3300025299 | Ga0209256_1004896 | Ga0209256_10048967 | 342 |
| 266 | 3300025299 | Ga0209256_1006065 | Ga0209256_10060652 | 342 |
| 267 | 3300025304 | Ga0209257_1000178 | Ga0209257_100017836 | 342 |
| 268 | 3300025304 | Ga0209257_1000944 | Ga0209257_100094427 | 342 |
| 269 | 3300025981 | Ga0207640_10076426 | Ga0207640_100764264 | 342 |
| 270 | 3300028794 | Ga0307515_10018705 | Ga0307515_1001870511 | 342 |
| 271 | 3300031251 | Ga0265327_10000682 | Ga0265327_1000068249 | 342 |
| 272 | 3300031251 | Ga0265327_10001180 | Ga0265327_1000118018 | 342 |
| 273 | 3300031711 | Ga0265314_10014262 | Ga0265314_100142625 | 342 |
| 274 | 3300031901 | Ga0307406_10001178 | Ga0307406_100011786 | 342 |
| 275 | 3300032004 | Ga0307414_10031941 | Ga0307414_100319414 | 342 |
| 276 | 3300032004 | Ga0307414_10056963 | Ga0307414_100569634 | 342 |
| 277 | 3300046460 | Ga0495638_0000701 | Ga0495638_0000701_24969_25997 | 342 |
| 278 | 3300046460 | Ga0495638_0001003 | Ga0495638_0001003_7542_8570 | 342 |
| 279 | 3300046460 | Ga0495638_0060017 | Ga0495638_0060017_285_1325 | 342 |
| 280 | 3300046471 | Ga0495650_0000017 | Ga0495650_0000017_94856_95884 | 342 |
| 281 | 3300046506 | Ga0495583_0000020 | Ga0495583_0000020_174916_175944 | 342 |
| 282 | 3300046512 | Ga0495610_0000535 | Ga0495610_0000535_25589_26632 | 342 |
| 283 | 3300046512 | Ga0495610_0004890 | Ga0495610_0004890_1416_2444 | 342 |
| 284 | 3300046512 | Ga0495610_0014329 | Ga0495610_0014329_2704_3732 | 342 |
| 285 | 3300046515 | Ga0495620_0019711 | Ga0495620_0019711_1189_2217 | 342 |
| 286 | 3300046518 | Ga0495631_0003608 | Ga0495631_0003608_6159_7187 | 342 |
| 287 | 3300046520 | Ga0495637_0006004 | Ga0495637_0006004_2107_3135 | 342 |
| 288 | 3300046524 | Ga0495648_0000154 | Ga0495648_0000154_5625_6653 | 342 |
| 289 | 3300046530 | Ga0495654_0001339 | Ga0495654_0001339_8189_9217 | 342 |
| 290 | 3300046616 | Ga0495668_0006042 | Ga0495668_0006042_3239_4267 | 342 |
| 291 | 3300046660 | Ga0495625_0000865 | Ga0495625_0000865_30730_31773 | 342 |
| 292 | 3300046660 | Ga0495625_0003577 | Ga0495625_0003577_3958_4986 | 342 |
| 293 | 3300046660 | Ga0495625_0011340 | Ga0495625_0011340_4715_5758 | 342 |
| 294 | 3300046660 | Ga0495625_0012928 | Ga0495625_0012928_271_1299 | 342 |
| 295 | 3300046660 | Ga0495625_0018510 | Ga0495625_0018510_3072_4100 | 342 |
| 296 | 3300046694 | Ga0495649_0000807 | Ga0495649_0000807_237_1277 | 342 |
| 297 | 3300046794 | Ga0495589_0069321 | Ga0495589_0069321_245_1288 | 342 |
| 298 | 3300047320 | Ga0495672_0002681 | Ga0495672_0002681_3115_4158 | 342 |
| 299 | 3300047446 | Ga0495679_002984 | Ga0495679_002984_3939_4967 | 342 |
| 300 | 3300047469 | Ga0495673_0000078 | Ga0495673_0000078_148227_149255 | 342 |
| 301 | 3300047469 | Ga0495673_0002407 | Ga0495673_0002407_6295_7323 | 342 |
| 302 | 3300047469 | Ga0495673_0006904 | Ga0495673_0006904_4227_5255 | 342 |
| 303 | 3300047472 | Ga0495686_0000525 | Ga0495686_0000525_51508_52536 | 342 |
| 304 | 3300047472 | Ga0495686_0011689 | Ga0495686_0011689_1322_2350 | 342 |
| 305 | 3300048910 | Ga0496107_0000125 | Ga0496107_0000125_15389_16417 | 342 |
| 306 | 3300048910 | Ga0496107_0098936 | Ga0496107_0098936_984_2012 | 342 |
| 307 | 3300048918 | Ga0496115_0114636 | Ga0496115_0114636_46_1089 | 342 |
| 308 | 3300048924 | Ga0496121_0002520 | Ga0496121_0002520_8396_9424 | 342 |
| 309 | 3300049459 | Ga0495678_000659 | Ga0495678_000659_7549_8577 | 342 |
| 310 | 3300049671 | Ga0501238_001180 | Ga0501238_001180_1762_2790 | 342 |
| 311 | 3300049823 | Ga0501044_0450430 | Ga0501044_0450430_107_1135 | 342 |
| 312 | 3300053086 | Ga0500578_0000092 | Ga0500578_0000092_5845_6873 | 342 |
| 313 | 3300053088 | Ga0500644_0001143 | Ga0500644_0001143_5757_6785 | 342 |
| 314 | 3300053088 | Ga0500644_0003597 | Ga0500644_0003597_2442_3476 | 342 |
| 315 | 3300053093 | Ga0500651_0122869 | Ga0500651_0122869_205_1239 | 342 |
| 316 | 3300053103 | Ga0500555_026914 | Ga0500555_026914_312_1340 | 342 |
| 317 | 3300053104 | Ga0500556_0002063 | Ga0500556_0002063_3718_4746 | 342 |
| 318 | 3300053108 | Ga0500562_003772 | Ga0500562_003772_2706_3734 | 342 |
| 319 | 3300053118 | Ga0500594_0000140 | Ga0500594_0000140_11508_12536 | 342 |
| 320 | 3300053125 | Ga0500618_000060 | Ga0500618_000060_11725_12753 | 342 |
| 321 | 3300053134 | Ga0500658_0027003 | Ga0500658_0027003_341_1384 | 342 |
| 322 | 3300053136 | Ga0500559_0000005 | Ga0500559_0000005_217514_218542 | 342 |
| 323 | 3300053136 | Ga0500559_0001872 | Ga0500559_0001872_3664_4692 | 342 |
| 324 | 3300053138 | Ga0500564_001592 | Ga0500564_001592_3543_4571 | 342 |
| 325 | 3300053153 | Ga0500616_0015084 | Ga0500616_0015084_1133_2161 | 342 |
| 326 | 3300053156 | Ga0500622_0000105 | Ga0500622_0000105_10110_11138 | 342 |
| 327 | 3300053727 | Ga0500611_000576 | Ga0500611_000576_1852_2880 | 342 |
| 328 | 3300053730 | Ga0500645_008592 | Ga0500645_008592_226_1269 | 342 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1khd-assembly1.cif.gz_A | crystal structure analysis of the anthranilate phosphoribosyltransferase from erwinia carotovora at 1.9 resolution (current name, pectobacterium carotovorum) | 0.9635 | 5 | 333 |
| 1kgz-assembly1.cif.gz_B | crystal structure analysis of the anthranilate phosphoribosyltransferase from erwinia carotovora (current name, pectobacterium carotovorum) | 0.9624 | 5 | 333 |
| 5c1r-assembly1.cif.gz_A | stereoisomer of prpp bound in the active site of mycobacterium tuberculosis anthranilate phosphoribosyl (anprt; trpd) | 0.9623 | 5 | 337 |
| 1khd-assembly2.cif.gz_B | crystal structure analysis of the anthranilate phosphoribosyltransferase from erwinia carotovora at 1.9 resolution (current name, pectobacterium carotovorum) | 0.9607 | 5 | 333 |
| 4zof-assembly1.cif.gz_B | lobenzarit-like inhibitor bound in the active site of mycobacterium tuberculosis anthranilate phosphoribosyltransferase (anprt; trpd) | 0.9607 | 5 | 337 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57686_71_335_3.40.1030.10 | Alpha Beta;3-Layer(aba) Sandwich;Pyrimidine Nucleoside Phosphorylase; Chain A, domain 2;Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain | 0.9715 | 73 | 337 | 3.40.1030.10 |
| af_Q57686_71_335_3.40.1030.10 | Alpha Beta;3-Layer(aba) Sandwich;Pyrimidine Nucleoside Phosphorylase; Chain A, domain 2;Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain | 0.9679 | 73 | 337 | 3.40.1030.10 |
| af_O60122_85_351_3.40.1030.10 | Alpha Beta;3-Layer(aba) Sandwich;Pyrimidine Nucleoside Phosphorylase; Chain A, domain 2;Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain | 0.966 | 74 | 332 | 3.40.1030.10 |
| af_K7WHC8_126_393_3.40.1030.10 | Alpha Beta;3-Layer(aba) Sandwich;Pyrimidine Nucleoside Phosphorylase; Chain A, domain 2;Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain | 0.9656 | 74 | 339 | 3.40.1030.10 |
| af_Q2FYR7_70_332_3.40.1030.10 | Alpha Beta;3-Layer(aba) Sandwich;Pyrimidine Nucleoside Phosphorylase; Chain A, domain 2;Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain | 0.9588 | 77 | 331 | 3.40.1030.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E8YPZ8-F1-model_v4 | Anthranilate phosphoribosyltransferase | 0.9932 | 193 | 337 |
GO:0000162
GO:0004048 GO:0005829 |
| AF-A0A530R206-F1-model_v4 | Anthranilate phosphoribosyltransferase (EC 2.4.2.18) | 0.9888 | 92 | 337 |
GO:0000162
GO:0004048 GO:0005829 |
| AF-A0A382YA79-F1-model_v4 | Glycosyl transferase family 3 domain-containing protein | 0.9878 | 92 | 340 |
GO:0000162
GO:0004048 GO:0005829 |
| AF-A0A7C1JAR4-F1-model_v4 | Anthranilate phosphoribosyltransferase (EC 2.4.2.18) | 0.9871 | 185 | 322 |
GO:0000162
GO:0004048 GO:0005829 |
| AF-A0A3S1ETP6-F1-model_v4 | Anthranilate phosphoribosyltransferase (EC 2.4.2.18) | 0.9863 | 83 | 337 |
GO:0000162
GO:0004048 GO:0005829 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar