F409452
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 328 | 236 | 289 | 290 |
Family's Representative Sequence
| Representative Sequence | 3300053096|Ga0500641_0008830|Ga0500641_0008830_376_1245 |
| Length | 289 |
| Sequence | MNSASNSEVPVVESGTFSLGQLTVRRLGYGAMQITGPGVWGPPADPAAAVRVLRRAVELGVNFVDTADSYGPYVSEELIREALHPYDDVMVATKAGLVRTGPAQWHPVGRPEYLRQECEMSLRRLGVEAIDLFQLHRVDPKVPASEQYGLLKELRDEGKVREVGLSEVTIEQIEAAQKIVPIVSVQNQYNLETRQSEEVLDYCEANGVGFIPWFPINSGALAREGGPVDAISKQTGATAAQVALAWLLARSEVMLPIPGTSSVKHVEENCAAALVKLSDVQIKELNNAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 2 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 3 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 4 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 5 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 6 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 7 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 8 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 9 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 10 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 11 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 12 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 13 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 14 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 15 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 16 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 17 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 18 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 19 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 20 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 21 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 22 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 23 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 24 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 25 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 26 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 27 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 28 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 29 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 30 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 31 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 32 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 33 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 62 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 68 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 86 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 124 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 125 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 126 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 127 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 128 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 129 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 130 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 131 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 132 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 133 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 134 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 135 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 136 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 137 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 138 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 139 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 140 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 141 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 142 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 143 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 144 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 145 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 146 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 147 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 148 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 149 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 150 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 151 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 152 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 153 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 154 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 155 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 156 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 157 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 158 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 186 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 187 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 188 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 189 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 190 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 191 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 192 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 195 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 196 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 197 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 198 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 199 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 200 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 201 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 202 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 203 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 204 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 205 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 206 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 207 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 208 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 221 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 226 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 227 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 228 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 229 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 230 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 231 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 232 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 233 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 234 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 235 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 236 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.11 |
| Metatranscriptomes | 0 |
| Isolates | 11.89 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.61 |
| Bulb | 0 |
| Endosphere | 2.44 |
| Nodule | 3.66 |
| Rhizoplane | 11.89 |
| Rhizosphere | 71.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070676_10012677 | 3300005328 | Bacteria | 4608 |
| 2 | Ga0068868_100016259 | 3300005338 | Bacteria | 5520 |
| 3 | Ga0068868_100507475 | 3300005338 | Bacteria | 1057 |
| 4 | Ga0070660_100097187 | 3300005339 | Bacteria | 2329 |
| 5 | Ga0070691_10041039 | 3300005341 | Bacteria | 2188 |
| 6 | Ga0070687_100014382 | 3300005343 | Bacteria | 3555 |
| 7 | Ga0070692_10111782 | 3300005345 | Bacteria | 1512 |
| 8 | Ga0070669_100169468 | 3300005353 | Bacteria | 1701 |
| 9 | Ga0070675_100052421 | 3300005354 | Bacteria | 3354 |
| 10 | Ga0070674_100078787 | 3300005356 | Bacteria | 2349 |
| 11 | Ga0070667_100044423 | 3300005367 | Bacteria | 3731 |
| 12 | Ga0070667_100082302 | 3300005367 | Bacteria | 2756 |
| 13 | Ga0070708_100013664 | 3300005445 | Bacteria | 6657 |
| 14 | Ga0070663_100321178 | 3300005455 | Bacteria | 1245 |
| 15 | Ga0070678_100206018 | 3300005456 | Bacteria | 1626 |
| 16 | Ga0070685_10032582 | 3300005466 | Bacteria | 2920 |
| 17 | Ga0068853_100142437 | 3300005539 | Bacteria | 2153 |
| 18 | Ga0070686_100060575 | 3300005544 | Bacteria | 2443 |
| 19 | Ga0070696_100102616 | 3300005546 | Bacteria | 2051 |
| 20 | Ga0070665_100091542 | 3300005548 | Bacteria | 3046 |
| 21 | Ga0070665_100100562 | 3300005548 | Bacteria | 2895 |
| 22 | Ga0070704_100201031 | 3300005549 | Bacteria | 1608 |
| 23 | Ga0068857_100050127 | 3300005577 | Bacteria | 3704 |
| 24 | Ga0068859_100000572 | 3300005617 | Bacteria | 36730 |
| 25 | Ga0068859_100005725 | 3300005617 | Bacteria | 12641 |
| 26 | Ga0068866_10027200 | 3300005718 | Bacteria | 2709 |
| 27 | Ga0068851_10086025 | 3300005834 | Bacteria | 1649 |
| 28 | Ga0068870_10220811 | 3300005840 | Bacteria | 1160 |
| 29 | Ga0068863_100001825 | 3300005841 | Bacteria | 21153 |
| 30 | Ga0068863_100126683 | 3300005841 | Bacteria | 2437 |
| 31 | Ga0068858_100174525 | 3300005842 | Bacteria | 2028 |
| 32 | Ga0068860_100060748 | 3300005843 | Bacteria | 3591 |
| 33 | Ga0068862_100000839 | 3300005844 | Bacteria | 30415 |
| 34 | Ga0081538_10000099 | 3300005981 | Bacteria | 83947 |
| 35 | Ga0081538_10000252 | 3300005981 | Bacteria | 60660 |
| 36 | Ga0081538_10010668 | 3300005981 | Bacteria | 7520 |
| 37 | Ga0070717_10002101 | 3300006028 | Bacteria | 13966 |
| 38 | Ga0070717_10045155 | 3300006028 | Bacteria | 3601 |
| 39 | Ga0075364_10000693 | 3300006051 | Bacteria | 17606 |
| 40 | Ga0075364_10219435 | 3300006051 | Bacteria | 1290 |
| 41 | Ga0070716_100093289 | 3300006173 | Bacteria | 1827 |
| 42 | Ga0097621_100067188 | 3300006237 | Bacteria | 2954 |
| 43 | Ga0097620_100000572 | 3300006931 | Bacteria | 36730 |
| 44 | Ga0097620_100005725 | 3300006931 | Bacteria | 12641 |
| 45 | Ga0075435_100113934 | 3300007076 | Bacteria | 2251 |
| 46 | Ga0111539_10129810 | 3300009094 | Bacteria | 2952 |
| 47 | Ga0111539_10223491 | 3300009094 | Bacteria | 2193 |
| 48 | Ga0105245_10076353 | 3300009098 | Bacteria | 3052 |
| 49 | Ga0105245_10084835 | 3300009098 | Bacteria | 2902 |
| 50 | Ga0105245_10244952 | 3300009098 | Bacteria | 1739 |
| 51 | Ga0105247_10000102 | 3300009101 | Bacteria | 90969 |
| 52 | Ga0105247_10065648 | 3300009101 | Bacteria | 2258 |
| 53 | Ga0105243_10009982 | 3300009148 | Bacteria | 7216 |
| 54 | Ga0105243_10386425 | 3300009148 | Bacteria | 1296 |
| 55 | Ga0105242_10155164 | 3300009176 | Bacteria | 1999 |
| 56 | Ga0105248_10000166 | 3300009177 | Bacteria | 77193 |
| 57 | Ga0105248_10000291 | 3300009177 | Bacteria | 59424 |
| 58 | Ga0105248_10003580 | 3300009177 | Bacteria | 17219 |
| 59 | Ga0105237_10087406 | 3300009545 | Bacteria | 3106 |
| 60 | Ga0105249_10002302 | 3300009553 | Bacteria | 16593 |
| 61 | Ga0105249_10021247 | 3300009553 | Bacteria | 5811 |
| 62 | Ga0105246_10009429 | 3300011119 | Bacteria | 6015 |
| 63 | Ga0157370_10033286 | 3300013104 | Bacteria | 5025 |
| 64 | Ga0157369_10097884 | 3300013105 | Bacteria | 3129 |
| 65 | Ga0157369_10206331 | 3300013105 | Bacteria | 2061 |
| 66 | Ga0157378_10132258 | 3300013297 | Bacteria | 2310 |
| 67 | Ga0163162_10045053 | 3300013306 | Bacteria | 4419 |
| 68 | Ga0157372_10102427 | 3300013307 | Bacteria | 3271 |
| 69 | Ga0163163_10015756 | 3300014325 | Bacteria | 7000 |
| 70 | Ga0157380_10315641 | 3300014326 | Bacteria | 1447 |
| 71 | Ga0157379_10009307 | 3300014968 | Bacteria | 8556 |
| 72 | Ga0157379_10115110 | 3300014968 | Bacteria | 2418 |
| 73 | Ga0157379_10275792 | 3300014968 | Bacteria | 1530 |
| 74 | Ga0157379_10328148 | 3300014968 | Bacteria | 1398 |
| 75 | Ga0213874_10008434 | 3300021377 | Bacteria | 2512 |
| 76 | Ga0207656_10129323 | 3300025321 | Bacteria | 1182 |
| 77 | Ga0207655_1003255 | 3300025728 | Bacteria | 12187 |
| 78 | Ga0207682_10002181 | 3300025893 | Bacteria | 8846 |
| 79 | Ga0207710_10000029 | 3300025900 | Bacteria | 289155 |
| 80 | Ga0207710_10070814 | 3300025900 | Bacteria | 1599 |
| 81 | Ga0207688_10028736 | 3300025901 | Bacteria | 3058 |
| 82 | Ga0207684_10277405 | 3300025910 | Bacteria | 1446 |
| 83 | Ga0207671_10119825 | 3300025914 | Bacteria | 2011 |
| 84 | Ga0207693_10013072 | 3300025915 | Bacteria | 6698 |
| 85 | Ga0207663_10039547 | 3300025916 | Bacteria | 2858 |
| 86 | Ga0207662_10018967 | 3300025918 | Bacteria | 3908 |
| 87 | Ga0207662_10344498 | 3300025918 | Bacteria | 999 |
| 88 | Ga0207657_10114802 | 3300025919 | Bacteria | 2220 |
| 89 | Ga0207652_10221105 | 3300025921 | Bacteria | 1706 |
| 90 | Ga0207694_10079596 | 3300025924 | Bacteria | 2570 |
| 91 | Ga0207650_10011387 | 3300025925 | Bacteria | 6122 |
| 92 | Ga0207659_10042497 | 3300025926 | Bacteria | 3187 |
| 93 | Ga0207687_10046382 | 3300025927 | Bacteria | 3008 |
| 94 | Ga0207687_10304645 | 3300025927 | Bacteria | 1284 |
| 95 | Ga0207644_10052090 | 3300025931 | Bacteria | 2941 |
| 96 | Ga0207690_10031737 | 3300025932 | Bacteria | 3383 |
| 97 | Ga0207706_10033577 | 3300025933 | Bacteria | 4566 |
| 98 | Ga0207686_10222560 | 3300025934 | Bacteria | 1363 |
| 99 | Ga0207669_10048262 | 3300025937 | Bacteria | 2528 |
| 100 | Ga0207691_10003333 | 3300025940 | Bacteria | 15631 |
| 101 | Ga0207711_10000141 | 3300025941 | Bacteria | 77173 |
| 102 | Ga0207711_10001478 | 3300025941 | Bacteria | 21895 |
| 103 | Ga0207711_10026991 | 3300025941 | Bacteria | 4821 |
| 104 | Ga0207711_10305447 | 3300025941 | Bacteria | 1468 |
| 105 | Ga0207661_10333088 | 3300025944 | Bacteria | 1367 |
| 106 | Ga0207712_10017003 | 3300025961 | Bacteria | 4718 |
| 107 | Ga0207658_10122780 | 3300025986 | Bacteria | 2074 |
| 108 | Ga0207703_10080397 | 3300026035 | Bacteria | 2714 |
| 109 | Ga0207639_10143950 | 3300026041 | Bacteria | 1989 |
| 110 | Ga0207639_10553860 | 3300026041 | Bacteria | 1056 |
| 111 | Ga0207678_10040015 | 3300026067 | Bacteria | 4066 |
| 112 | Ga0207678_10343995 | 3300026067 | Bacteria | 1285 |
| 113 | Ga0207702_10228628 | 3300026078 | Bacteria | 1737 |
| 114 | Ga0207641_10006937 | 3300026088 | Bacteria | 9479 |
| 115 | Ga0207648_10070233 | 3300026089 | Bacteria | 3053 |
| 116 | Ga0207648_10392733 | 3300026089 | Bacteria | 1256 |
| 117 | Ga0207676_10178667 | 3300026095 | Bacteria | 1856 |
| 118 | Ga0207674_10239585 | 3300026116 | Bacteria | 1761 |
| 119 | Ga0207674_10299851 | 3300026116 | Bacteria | 1556 |
| 120 | Ga0207683_10005043 | 3300026121 | Bacteria | 11337 |
| 121 | Ga0207683_10037081 | 3300026121 | Bacteria | 4245 |
| 122 | Ga0268266_10098757 | 3300028379 | Bacteria | 2570 |
| 123 | Ga0268265_10000253 | 3300028380 | Bacteria | 60788 |
| 124 | Ga0307511_10021536 | 3300030521 | Bacteria | 6067 |
| 125 | Ga0307408_100032388 | 3300031548 | Bacteria | 3644 |
| 126 | Ga0307408_100119731 | 3300031548 | Bacteria | 2037 |
| 127 | Ga0307408_100149958 | 3300031548 | Bacteria | 1839 |
| 128 | Ga0307516_10020752 | 3300031730 | Bacteria | 6782 |
| 129 | Ga0307405_10014548 | 3300031731 | Bacteria | 4234 |
| 130 | Ga0307405_10154135 | 3300031731 | Bacteria | 1619 |
| 131 | Ga0307413_10006069 | 3300031824 | Bacteria | 5475 |
| 132 | Ga0307413_10012368 | 3300031824 | Bacteria | 4246 |
| 133 | Ga0307413_10081611 | 3300031824 | Bacteria | 2074 |
| 134 | Ga0307413_10369453 | 3300031824 | Bacteria | 1113 |
| 135 | Ga0307410_10021018 | 3300031852 | Bacteria | 4006 |
| 136 | Ga0307410_10063619 | 3300031852 | Bacteria | 2532 |
| 137 | Ga0307410_10296841 | 3300031852 | Bacteria | 1273 |
| 138 | Ga0307406_10162059 | 3300031901 | Bacteria | 1609 |
| 139 | Ga0307407_10012314 | 3300031903 | Bacteria | 4107 |
| 140 | Ga0307412_10001653 | 3300031911 | Bacteria | 12315 |
| 141 | Ga0307412_10047019 | 3300031911 | Bacteria | 2831 |
| 142 | Ga0307412_10053408 | 3300031911 | Bacteria | 2678 |
| 143 | Ga0307412_10083724 | 3300031911 | Bacteria | 2212 |
| 144 | Ga0307412_10125835 | 3300031911 | Bacteria | 1853 |
| 145 | Ga0307409_100103983 | 3300031995 | Bacteria | 2364 |
| 146 | Ga0307409_100147923 | 3300031995 | Bacteria | 2034 |
| 147 | Ga0307409_100335570 | 3300031995 | Bacteria | 1420 |
| 148 | Ga0307409_100522601 | 3300031995 | Bacteria | 1160 |
| 149 | Ga0307416_100066297 | 3300032002 | Bacteria | 2972 |
| 150 | Ga0307416_100200086 | 3300032002 | Bacteria | 1894 |
| 151 | Ga0307416_100359040 | 3300032002 | Bacteria | 1478 |
| 152 | Ga0307414_10025803 | 3300032004 | Bacteria | 3771 |
| 153 | Ga0307414_10078705 | 3300032004 | Bacteria | 2404 |
| 154 | Ga0307411_10364279 | 3300032005 | Bacteria | 1183 |
| 155 | Ga0307415_100006832 | 3300032126 | Bacteria | 6192 |
| 156 | Ga0373949_0007308 | 3300035090 | Bacteria | 2418 |
| 157 | Ga0373939_0007115 | 3300035114 | Bacteria | 2712 |
| 158 | Ga0373937_0039336 | 3300036401 | Bacteria | 4310 |
| 159 | Ga0395900_0036657 | 3300037418 | Bacteria | 5056 |
| 160 | Ga0395898_0081180 | 3300037466 | Bacteria | 3127 |
| 161 | Ga0395898_0232664 | 3300037466 | Bacteria | 1757 |
| 162 | Ga0436364_0864789 | 3300037853 | Bacteria | 6547 |
| 163 | Ga0436364_0926921 | 3300037853 | Plasmid | 2513 |
| 164 | Ga0395901_0084010 | 3300038443 | Bacteria | 3328 |
| 165 | Ga0395901_0262195 | 3300038443 | Bacteria | 1798 |
| 166 | Ga0395901_0807755 | 3300038443 | Bacteria | 926 |
| 167 | Ga0436365_0275704 | 3300039437 | Bacteria | 3702 |
| 168 | Ga0436363_1524120 | 3300039450 | Bacteria | 3224 |
| 169 | Ga0436362_1030948 | 3300039453 | Bacteria | 1923 |
| 170 | Ga0451853_2428981 | 3300041512 | Bacteria | 8658 |
| 171 | Ga0439444_0029696 | 3300042437 | Bacteria | 1020 |
| 172 | Ga0439440_0040054 | 3300042993 | Bacteria | 1139 |
| 173 | Ga0466969_0114601 | 3300044656 | Bacteria | 1259 |
| 174 | Ga0453683_0013051 | 3300044673 | Bacteria | 5433 |
| 175 | Ga0466961_0045116 | 3300044693 | Bacteria | 2821 |
| 176 | Ga0466961_0109705 | 3300044693 | Bacteria | 1737 |
| 177 | Ga0466963_0037017 | 3300044694 | Bacteria | 3185 |
| 178 | Ga0453684_0260266 | 3300044712 | Bacteria | 1988 |
| 179 | Ga0466957_0011884 | 3300044842 | Bacteria | 5032 |
| 180 | Ga0466959_0017949 | 3300045049 | Bacteria | 5191 |
| 181 | Ga0466959_0366749 | 3300045049 | Bacteria | 981 |
| 182 | Ga0466958_0007901 | 3300045836 | Bacteria | 5880 |
| 183 | Ga0466958_0181189 | 3300045836 | Bacteria | 1337 |
| 184 | Ga0495629_0231300 | 3300046459 | Bacteria | 1274 |
| 185 | Ga0495641_0082595 | 3300046461 | Bacteria | 1439 |
| 186 | Ga0495582_0017881 | 3300046473 | Bacteria | 3875 |
| 187 | Ga0495582_0116298 | 3300046473 | Bacteria | 1504 |
| 188 | Ga0495639_0005639 | 3300046475 | Bacteria | 5385 |
| 189 | Ga0495662_0028723 | 3300046476 | Bacteria | 2685 |
| 190 | Ga0495585_0015675 | 3300046492 | Bacteria | 4402 |
| 191 | Ga0495594_0017101 | 3300046499 | Bacteria | 3828 |
| 192 | Ga0495620_0000737 | 3300046515 | Bacteria | 20139 |
| 193 | Ga0495630_0512576 | 3300046517 | Bacteria | 920 |
| 194 | Ga0495637_0003907 | 3300046520 | Bacteria | 7818 |
| 195 | Ga0495648_0015427 | 3300046524 | Bacteria | 5549 |
| 196 | Ga0495642_0012081 | 3300046528 | Bacteria | 3327 |
| 197 | Ga0495665_0001901 | 3300046531 | Bacteria | 11270 |
| 198 | Ga0495665_0009631 | 3300046531 | Bacteria | 5234 |
| 199 | Ga0495586_0004272 | 3300046535 | Bacteria | 7640 |
| 200 | Ga0495586_0006650 | 3300046535 | Bacteria | 6172 |
| 201 | Ga0495587_0003423 | 3300046536 | Bacteria | 10583 |
| 202 | Ga0495645_0000854 | 3300046543 | Bacteria | 20754 |
| 203 | Ga0495667_0019127 | 3300046559 | Bacteria | 4622 |
| 204 | Ga0495635_0043040 | 3300046663 | Bacteria | 3117 |
| 205 | Ga0495588_0054406 | 3300046674 | Bacteria | 2064 |
| 206 | Ga0495588_0064364 | 3300046674 | Bacteria | 1902 |
| 207 | Ga0495623_0031140 | 3300046679 | Bacteria | 3431 |
| 208 | Ga0495600_0003214 | 3300046809 | Bacteria | 9561 |
| 209 | Ga0495581_0014752 | 3300047315 | Bacteria | 4532 |
| 210 | Ga0495581_0066240 | 3300047315 | Bacteria | 2088 |
| 211 | Ga0495675_0001270 | 3300047444 | Bacteria | 15282 |
| 212 | Ga0495673_0000227 | 3300047469 | Bacteria | 83114 |
| 213 | Ga0495684_0029456 | 3300047471 | Bacteria | 4214 |
| 214 | Ga0495593_0031487 | 3300047673 | Bacteria | 2897 |
| 215 | Ga0496100_0003552 | 3300048903 | Bacteria | 8144 |
| 216 | Ga0496100_0041368 | 3300048903 | Bacteria | 2938 |
| 217 | Ga0496100_0052177 | 3300048903 | Bacteria | 2657 |
| 218 | Ga0496101_0002043 | 3300048904 | Bacteria | 12285 |
| 219 | Ga0496101_0170537 | 3300048904 | Bacteria | 1672 |
| 220 | Ga0496102_0053419 | 3300048905 | Bacteria | 3683 |
| 221 | Ga0496102_0101200 | 3300048905 | Bacteria | 2677 |
| 222 | Ga0496102_0157738 | 3300048905 | Bacteria | 2134 |
| 223 | Ga0496102_0166925 | 3300048905 | Bacteria | 2071 |
| 224 | Ga0496102_0719335 | 3300048905 | Bacteria | 921 |
| 225 | Ga0496103_0117525 | 3300048906 | Bacteria | 1693 |
| 226 | Ga0496104_0000054 | 3300048907 | Bacteria | 132314 |
| 227 | Ga0496104_0010256 | 3300048907 | Bacteria | 8368 |
| 228 | Ga0496104_0030953 | 3300048907 | Bacteria | 4974 |
| 229 | Ga0496104_0128838 | 3300048907 | Bacteria | 2430 |
| 230 | Ga0496105_0029355 | 3300048908 | Bacteria | 4501 |
| 231 | Ga0496105_0239351 | 3300048908 | Bacteria | 1473 |
| 232 | Ga0496106_0018961 | 3300048909 | Bacteria | 5097 |
| 233 | Ga0496106_0025711 | 3300048909 | Bacteria | 4382 |
| 234 | Ga0496107_0008836 | 3300048910 | Bacteria | 6980 |
| 235 | Ga0496107_0140690 | 3300048910 | Bacteria | 1783 |
| 236 | Ga0496108_0023168 | 3300048911 | Bacteria | 5107 |
| 237 | Ga0496108_0410465 | 3300048911 | Bacteria | 1183 |
| 238 | Ga0496109_0035844 | 3300048912 | Bacteria | 4478 |
| 239 | Ga0496109_0221041 | 3300048912 | Bacteria | 1781 |
| 240 | Ga0496110_0032346 | 3300048913 | Bacteria | 4516 |
| 241 | Ga0496110_0052527 | 3300048913 | Bacteria | 3581 |
| 242 | Ga0496111_0081474 | 3300048914 | Bacteria | 2362 |
| 243 | Ga0496111_0183733 | 3300048914 | Bacteria | 1554 |
| 244 | Ga0496112_0046666 | 3300048915 | Bacteria | 4250 |
| 245 | Ga0496112_0131240 | 3300048915 | Bacteria | 2476 |
| 246 | Ga0496113_0186346 | 3300048916 | Bacteria | 1646 |
| 247 | Ga0496114_0009368 | 3300048917 | Bacteria | 7773 |
| 248 | Ga0496114_0048718 | 3300048917 | Bacteria | 3524 |
| 249 | Ga0496114_0724803 | 3300048917 | Bacteria | 871 |
| 250 | Ga0496115_0004419 | 3300048918 | Bacteria | 10187 |
| 251 | Ga0496115_0037615 | 3300048918 | Bacteria | 3836 |
| 252 | Ga0496115_0075713 | 3300048918 | Bacteria | 2734 |
| 253 | Ga0496116_0000190 | 3300048919 | Bacteria | 122544 |
| 254 | Ga0496117_0010955 | 3300048920 | Bacteria | 8172 |
| 255 | Ga0496117_0011659 | 3300048920 | Bacteria | 7849 |
| 256 | Ga0496118_0002278 | 3300048921 | Bacteria | 26188 |
| 257 | Ga0496118_0008521 | 3300048921 | Bacteria | 10584 |
| 258 | Ga0496119_0000784 | 3300048922 | Bacteria | 42478 |
| 259 | Ga0496119_0010794 | 3300048922 | Bacteria | 7646 |
| 260 | Ga0496120_0000765 | 3300048923 | Bacteria | 46402 |
| 261 | Ga0496121_0041628 | 3300048924 | Bacteria | 4012 |
| 262 | Ga0496121_0206091 | 3300048924 | Bacteria | 1397 |
| 263 | Ga0496124_0057859 | 3300048927 | Bacteria | 3264 |
| 264 | Ga0496126_0237922 | 3300048929 | Bacteria | 1523 |
| 265 | Ga0501037_0005151 | 3300049573 | Bacteria | 9511 |
| 266 | Ga0501037_0031413 | 3300049573 | Bacteria | 3921 |
| 267 | Ga0501038_0064066 | 3300049574 | Bacteria | 3135 |
| 268 | Ga0501039_0021915 | 3300049575 | Bacteria | 4902 |
| 269 | Ga0501039_0026472 | 3300049575 | Bacteria | 4456 |
| 270 | Ga0501043_0300099 | 3300049579 | Bacteria | 1227 |
| 271 | Ga0501048_0019188 | 3300049582 | Bacteria | 5020 |
| 272 | Ga0501071_0158162 | 3300049587 | Bacteria | 1692 |
| 273 | Ga0501072_0047923 | 3300049588 | Bacteria | 3365 |
| 274 | Ga0501075_0139308 | 3300049591 | Bacteria | 1848 |
| 275 | Ga0501076_0005425 | 3300049592 | Bacteria | 9168 |
| 276 | Ga0501081_0005938 | 3300049743 | Bacteria | 7904 |
| 277 | Ga0501044_0389407 | 3300049823 | Bacteria | 1308 |
| 278 | Ga0501045_0024343 | 3300049824 | Bacteria | 4347 |
| 279 | nmdc:mga00v17_204966_c1 | 3300050491 | Bacteria | 1275 |
| 280 | nmdc:mga00v17_9982_c1 | 3300050491 | Bacteria | 5164 |
| 281 | nmdc:mga08y16_369997_c1 | 3300050511 | Bacteria | 1470 |
| 282 | nmdc:mga0rr50_104041_c1 | 3300050513 | Bacteria | 2236 |
| 283 | Ga0495601_0000481 | 3300053077 | Bacteria | 20953 |
| 284 | Ga0495619_0410506 | 3300053085 | Bacteria | 935 |
| 285 | Ga0500641_0008830 | 3300053096 | Unclassified | 3608 |
| 286 | Ga0500572_043664 | 3300053111 | Bacteria | 1311 |
| 287 | Ga0500595_018946 | 3300053119 | Bacteria | 2506 |
| 288 | Ga0500600_0066212 | 3300053149 | Bacteria | 1996 |
| 289 | Ga0501084_0058342 | 3300054114 | Bacteria | 3230 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005981 | Ga0081538_10000252 | Ga0081538_1000025239 | 259 |
| 2 | 3300006173 | Ga0070716_100093289 | Ga0070716_1000932892 | 259 |
| 3 | 3300009177 | Ga0105248_10000166 | Ga0105248_1000016658 | 259 |
| 4 | 3300025941 | Ga0207711_10000141 | Ga0207711_1000014159 | 259 |
| 5 | 3300026089 | Ga0207648_10392733 | Ga0207648_103927332 | 259 |
| 6 | 3300039453 | Ga0436362_1030948 | Ga0436362_1030948_1121_1906 | 259 |
| 7 | 3300044656 | Ga0466969_0114601 | Ga0466969_0114601_440_1219 | 259 |
| 8 | 3300044712 | Ga0453684_0260266 | Ga0453684_0260266_587_1456 | 259 |
| 9 | 3300047471 | Ga0495684_0029456 | Ga0495684_0029456_1011_1790 | 259 |
| 10 | 3300048905 | Ga0496102_0719335 | Ga0496102_0719335_44_847 | 259 |
| 11 | 3300048917 | Ga0496114_0724803 | Ga0496114_0724803_12_791 | 259 |
| 12 | iso_pu_bacteria | 2515154155 | 2515855544 | 265 |
| 13 | 3300042993 | Ga0439440_0040054 | Ga0439440_0040054_15_824 | 267 |
| 14 | 3300031730 | Ga0307516_10020752 | Ga0307516_100207525 | 273 |
| 15 | 3300044694 | Ga0466963_0037017 | Ga0466963_0037017_2219_3043 | 273 |
| 16 | 3300053149 | Ga0500600_0066212 | Ga0500600_0066212_806_1627 | 273 |
| 17 | 3300049823 | Ga0501044_0389407 | Ga0501044_0389407_258_1085 | 275 |
| 18 | iso_pu_bacteria | 2599185354 | 2600203684 | 276 |
| 19 | iso_pu_bacteria | 8053945823 | 8053951268 | 276 |
| 20 | 3300005981 | Ga0081538_10000099 | Ga0081538_1000009980 | 278 |
| 21 | 3300005981 | Ga0081538_10010668 | Ga0081538_100106682 | 278 |
| 22 | 3300031824 | Ga0307413_10012368 | Ga0307413_100123683 | 278 |
| 23 | 3300031852 | Ga0307410_10063619 | Ga0307410_100636194 | 278 |
| 24 | 3300031911 | Ga0307412_10001653 | Ga0307412_100016538 | 278 |
| 25 | 3300031995 | Ga0307409_100103983 | Ga0307409_1001039832 | 278 |
| 26 | 3300041512 | Ga0451853_2428981 | Ga0451853_2428981_669_1505 | 278 |
| 27 | 3300042437 | Ga0439444_0029696 | Ga0439444_0029696_79_921 | 278 |
| 28 | 3300046515 | Ga0495620_0000737 | Ga0495620_0000737_5236_6078 | 280 |
| 29 | 3300046520 | Ga0495637_0003907 | Ga0495637_0003907_4461_5303 | 280 |
| 30 | 3300047469 | Ga0495673_0000227 | Ga0495673_0000227_38998_39840 | 280 |
| 31 | 3300048907 | Ga0496104_0000054 | Ga0496104_0000054_48894_49742 | 281 |
| 32 | 3300048905 | Ga0496102_0157738 | Ga0496102_0157738_404_1270 | 282 |
| 33 | 3300049582 | Ga0501048_0019188 | Ga0501048_0019188_3049_3912 | 282 |
| 34 | 3300049587 | Ga0501071_0158162 | Ga0501071_0158162_324_1187 | 282 |
| 35 | 3300049588 | Ga0501072_0047923 | Ga0501072_0047923_2357_3220 | 282 |
| 36 | 3300049591 | Ga0501075_0139308 | Ga0501075_0139308_899_1762 | 282 |
| 37 | 3300049592 | Ga0501076_0005425 | Ga0501076_0005425_740_1603 | 282 |
| 38 | 3300049743 | Ga0501081_0005938 | Ga0501081_0005938_6329_7192 | 282 |
| 39 | 3300049824 | Ga0501045_0024343 | Ga0501045_0024343_2044_2907 | 282 |
| 40 | 3300053111 | Ga0500572_043664 | Ga0500572_043664_104_955 | 282 |
| 41 | 3300053119 | Ga0500595_018946 | Ga0500595_018946_798_1649 | 282 |
| 42 | 3300054114 | Ga0501084_0058342 | Ga0501084_0058342_1087_1950 | 282 |
| 43 | iso_pu_bacteria | 2984576629 | 2984577201 | 283 |
| 44 | iso_pu_bacteria | 2990256926 | 2990260876 | 283 |
| 45 | iso_pu_bacteria | 8004021418 | 8004022349 | 283 |
| 46 | iso_pu_bacteria | 8004025490 | 8004026648 | 283 |
| 47 | 3300025918 | Ga0207662_10344498 | Ga0207662_103444982 | 284 |
| 48 | iso_pu_bacteria | 2939598168 | 2939602172 | 284 |
| 49 | 3300006028 | Ga0070717_10002101 | Ga0070717_100021017 | 285 |
| 50 | 3300038443 | Ga0395901_0807755 | Ga0395901_0807755_45_905 | 285 |
| 51 | 3300048924 | Ga0496121_0206091 | Ga0496121_0206091_65_922 | 285 |
| 52 | iso_pu_bacteria | 2690315906 | 2691515773 | 285 |
| 53 | iso_pu_bacteria | 2775506735 | 2775657345 | 285 |
| 54 | iso_pu_bacteria | 2808606357 | 2808828911 | 285 |
| 55 | iso_pu_bacteria | 2808606360 | 2808850142 | 285 |
| 56 | iso_pu_bacteria | 2808606366 | 2808877308 | 285 |
| 57 | iso_pu_bacteria | 2808606370 | 2808893149 | 285 |
| 58 | iso_pu_bacteria | 2808606371 | 2808898783 | 285 |
| 59 | iso_pu_bacteria | 2811994871 | 2812319388 | 285 |
| 60 | iso_pu_bacteria | 2945916053 | 2945917141 | 285 |
| 61 | iso_pu_bacteria | 2945920336 | 2945922608 | 285 |
| 62 | iso_pu_bacteria | 2946037020 | 2946037102 | 285 |
| 63 | iso_pu_bacteria | 2946059875 | 2946060941 | 285 |
| 64 | iso_pu_bacteria | 2953998280 | 2953998354 | 285 |
| 65 | iso_pu_bacteria | 2990044586 | 2990050285 | 285 |
| 66 | 3300005445 | Ga0070708_100013664 | Ga0070708_1000136647 | 286 |
| 67 | 3300005577 | Ga0068857_100050127 | Ga0068857_1000501275 | 286 |
| 68 | 3300021377 | Ga0213874_10008434 | Ga0213874_100084343 | 286 |
| 69 | 3300025910 | Ga0207684_10277405 | Ga0207684_102774052 | 286 |
| 70 | 3300025921 | Ga0207652_10221105 | Ga0207652_102211051 | 286 |
| 71 | 3300026116 | Ga0207674_10239585 | Ga0207674_102395853 | 286 |
| 72 | 3300031824 | Ga0307413_10006069 | Ga0307413_100060696 | 286 |
| 73 | 3300032004 | Ga0307414_10078705 | Ga0307414_100787052 | 286 |
| 74 | 3300039437 | Ga0436365_0275704 | Ga0436365_0275704_2045_2911 | 286 |
| 75 | 3300039450 | Ga0436363_1524120 | Ga0436363_1524120_1613_2479 | 286 |
| 76 | 3300044673 | Ga0453683_0013051 | Ga0453683_0013051_3213_4073 | 286 |
| 77 | 3300044693 | Ga0466961_0045116 | Ga0466961_0045116_1761_2621 | 286 |
| 78 | 3300046524 | Ga0495648_0015427 | Ga0495648_0015427_4605_5501 | 286 |
| 79 | 3300048915 | Ga0496112_0046666 | Ga0496112_0046666_1587_2474 | 286 |
| 80 | 3300053077 | Ga0495601_0000481 | Ga0495601_0000481_10838_11698 | 286 |
| 81 | iso_pu_bacteria | 2974302888 | 2974305083 | 286 |
| 82 | 3300005455 | Ga0070663_100321178 | Ga0070663_1003211782 | 287 |
| 83 | 3300005617 | Ga0068859_100000572 | Ga0068859_10000057229 | 287 |
| 84 | 3300005617 | Ga0068859_100005725 | Ga0068859_10000572510 | 287 |
| 85 | 3300005841 | Ga0068863_100001825 | Ga0068863_1000018256 | 287 |
| 86 | 3300005842 | Ga0068858_100174525 | Ga0068858_1001745252 | 287 |
| 87 | 3300005844 | Ga0068862_100000839 | Ga0068862_1000008395 | 287 |
| 88 | 3300006051 | Ga0075364_10000693 | Ga0075364_100006938 | 287 |
| 89 | 3300006051 | Ga0075364_10219435 | Ga0075364_102194351 | 287 |
| 90 | 3300006931 | Ga0097620_100000572 | Ga0097620_10000057229 | 287 |
| 91 | 3300006931 | Ga0097620_100005725 | Ga0097620_10000572510 | 287 |
| 92 | 3300009101 | Ga0105247_10065648 | Ga0105247_100656482 | 287 |
| 93 | 3300009176 | Ga0105242_10155164 | Ga0105242_101551644 | 287 |
| 94 | 3300009177 | Ga0105248_10000291 | Ga0105248_1000029147 | 287 |
| 95 | 3300009553 | Ga0105249_10021247 | Ga0105249_100212475 | 287 |
| 96 | 3300014325 | Ga0163163_10015756 | Ga0163163_100157563 | 287 |
| 97 | 3300014968 | Ga0157379_10328148 | Ga0157379_103281481 | 287 |
| 98 | 3300025931 | Ga0207644_10052090 | Ga0207644_100520904 | 287 |
| 99 | 3300025941 | Ga0207711_10001478 | Ga0207711_100014783 | 287 |
| 100 | 3300025961 | Ga0207712_10017003 | Ga0207712_100170033 | 287 |
| 101 | 3300026035 | Ga0207703_10080397 | Ga0207703_100803972 | 287 |
| 102 | 3300026088 | Ga0207641_10006937 | Ga0207641_100069373 | 287 |
| 103 | 3300028380 | Ga0268265_10000253 | Ga0268265_1000025332 | 287 |
| 104 | 3300031824 | Ga0307413_10081611 | Ga0307413_100816112 | 287 |
| 105 | 3300031995 | Ga0307409_100147923 | Ga0307409_1001479233 | 287 |
| 106 | 3300032004 | Ga0307414_10025803 | Ga0307414_100258034 | 287 |
| 107 | 3300036401 | Ga0373937_0039336 | Ga0373937_0039336_2269_3150 | 287 |
| 108 | 3300037853 | Ga0436364_0864789 | Ga0436364_0864789_4447_5322 | 287 |
| 109 | 3300046517 | Ga0495630_0512576 | Ga0495630_0512576_26_889 | 287 |
| 110 | 3300048903 | Ga0496100_0003552 | Ga0496100_0003552_5335_6207 | 287 |
| 111 | 3300048904 | Ga0496101_0002043 | Ga0496101_0002043_6588_7460 | 287 |
| 112 | 3300048905 | Ga0496102_0053419 | Ga0496102_0053419_1792_2673 | 287 |
| 113 | 3300048905 | Ga0496102_0101200 | Ga0496102_0101200_358_1239 | 287 |
| 114 | 3300048907 | Ga0496104_0010256 | Ga0496104_0010256_6132_7004 | 287 |
| 115 | 3300048908 | Ga0496105_0239351 | Ga0496105_0239351_35_907 | 287 |
| 116 | 3300048909 | Ga0496106_0018961 | Ga0496106_0018961_3356_4228 | 287 |
| 117 | 3300048910 | Ga0496107_0008836 | Ga0496107_0008836_311_1183 | 287 |
| 118 | 3300048917 | Ga0496114_0009368 | Ga0496114_0009368_1483_2355 | 287 |
| 119 | 3300048918 | Ga0496115_0004419 | Ga0496115_0004419_4005_4877 | 287 |
| 120 | 3300048919 | Ga0496116_0000190 | Ga0496116_0000190_104860_105741 | 287 |
| 121 | 3300048920 | Ga0496117_0010955 | Ga0496117_0010955_5583_6464 | 287 |
| 122 | 3300048920 | Ga0496117_0011659 | Ga0496117_0011659_4724_5605 | 287 |
| 123 | 3300048921 | Ga0496118_0002278 | Ga0496118_0002278_383_1264 | 287 |
| 124 | 3300048921 | Ga0496118_0008521 | Ga0496118_0008521_1171_2052 | 287 |
| 125 | 3300048922 | Ga0496119_0010794 | Ga0496119_0010794_4685_5566 | 287 |
| 126 | 3300048924 | Ga0496121_0041628 | Ga0496121_0041628_1235_2116 | 287 |
| 127 | 3300048929 | Ga0496126_0237922 | Ga0496126_0237922_413_1294 | 287 |
| 128 | 3300050491 | nmdc:mga00v17_204966_c1 | nmdc:mga00v17_204966_c1_52_921 | 287 |
| 129 | 3300050491 | nmdc:mga00v17_9982_c1 | nmdc:mga00v17_9982_c1_1925_2794 | 287 |
| 130 | 3300053096 | Ga0500641_0008830 | Ga0500641_0008830_376_1245 | 287 |
| 131 | iso_pu_bacteria | 2508501039 | 2508676288 | 287 |
| 132 | iso_pu_bacteria | 2517572101 | 2517763361 | 287 |
| 133 | iso_pu_bacteria | 2675902999 | 2676198586 | 287 |
| 134 | iso_pu_bacteria | 2687453737 | 2689961451 | 287 |
| 135 | iso_pu_bacteria | 2773857921 | 2774843164 | 287 |
| 136 | iso_pu_bacteria | 8002784119 | 8002792132 | 287 |
| 137 | 3300005338 | Ga0068868_100016259 | Ga0068868_1000162594 | 288 |
| 138 | 3300005338 | Ga0068868_100507475 | Ga0068868_1005074751 | 288 |
| 139 | 3300005339 | Ga0070660_100097187 | Ga0070660_1000971871 | 288 |
| 140 | 3300005341 | Ga0070691_10041039 | Ga0070691_100410392 | 288 |
| 141 | 3300005343 | Ga0070687_100014382 | Ga0070687_1000143822 | 288 |
| 142 | 3300005345 | Ga0070692_10111782 | Ga0070692_101117822 | 288 |
| 143 | 3300005367 | Ga0070667_100082302 | Ga0070667_1000823022 | 288 |
| 144 | 3300005466 | Ga0070685_10032582 | Ga0070685_100325821 | 288 |
| 145 | 3300005539 | Ga0068853_100142437 | Ga0068853_1001424372 | 288 |
| 146 | 3300005544 | Ga0070686_100060575 | Ga0070686_1000605752 | 288 |
| 147 | 3300005546 | Ga0070696_100102616 | Ga0070696_1001026162 | 288 |
| 148 | 3300005548 | Ga0070665_100100562 | Ga0070665_1001005622 | 288 |
| 149 | 3300005549 | Ga0070704_100201031 | Ga0070704_1002010312 | 288 |
| 150 | 3300005718 | Ga0068866_10027200 | Ga0068866_100272002 | 288 |
| 151 | 3300005834 | Ga0068851_10086025 | Ga0068851_100860252 | 288 |
| 152 | 3300005840 | Ga0068870_10220811 | Ga0068870_102208112 | 288 |
| 153 | 3300005841 | Ga0068863_100126683 | Ga0068863_1001266833 | 288 |
| 154 | 3300005843 | Ga0068860_100060748 | Ga0068860_1000607482 | 288 |
| 155 | 3300006028 | Ga0070717_10045155 | Ga0070717_100451552 | 288 |
| 156 | 3300006237 | Ga0097621_100067188 | Ga0097621_1000671882 | 288 |
| 157 | 3300007076 | Ga0075435_100113934 | Ga0075435_1001139342 | 288 |
| 158 | 3300009094 | Ga0111539_10129810 | Ga0111539_101298102 | 288 |
| 159 | 3300009094 | Ga0111539_10223491 | Ga0111539_102234912 | 288 |
| 160 | 3300009098 | Ga0105245_10076353 | Ga0105245_100763531 | 288 |
| 161 | 3300009098 | Ga0105245_10084835 | Ga0105245_100848352 | 288 |
| 162 | 3300009101 | Ga0105247_10000102 | Ga0105247_1000010215 | 288 |
| 163 | 3300009148 | Ga0105243_10386425 | Ga0105243_103864252 | 288 |
| 164 | 3300009177 | Ga0105248_10003580 | Ga0105248_1000358013 | 288 |
| 165 | 3300009545 | Ga0105237_10087406 | Ga0105237_100874062 | 288 |
| 166 | 3300009553 | Ga0105249_10002302 | Ga0105249_1000230211 | 288 |
| 167 | 3300011119 | Ga0105246_10009429 | Ga0105246_100094296 | 288 |
| 168 | 3300013104 | Ga0157370_10033286 | Ga0157370_100332863 | 288 |
| 169 | 3300013105 | Ga0157369_10206331 | Ga0157369_102063312 | 288 |
| 170 | 3300013297 | Ga0157378_10132258 | Ga0157378_101322582 | 288 |
| 171 | 3300013307 | Ga0157372_10102427 | Ga0157372_101024272 | 288 |
| 172 | 3300014326 | Ga0157380_10315641 | Ga0157380_103156412 | 288 |
| 173 | 3300014968 | Ga0157379_10009307 | Ga0157379_100093072 | 288 |
| 174 | 3300014968 | Ga0157379_10115110 | Ga0157379_101151102 | 288 |
| 175 | 3300014968 | Ga0157379_10275792 | Ga0157379_102757921 | 288 |
| 176 | 3300025321 | Ga0207656_10129323 | Ga0207656_101293231 | 288 |
| 177 | 3300025900 | Ga0207710_10000029 | Ga0207710_1000002957 | 288 |
| 178 | 3300025900 | Ga0207710_10070814 | Ga0207710_100708142 | 288 |
| 179 | 3300025901 | Ga0207688_10028736 | Ga0207688_100287365 | 288 |
| 180 | 3300025914 | Ga0207671_10119825 | Ga0207671_101198252 | 288 |
| 181 | 3300025915 | Ga0207693_10013072 | Ga0207693_100130722 | 288 |
| 182 | 3300025916 | Ga0207663_10039547 | Ga0207663_100395472 | 288 |
| 183 | 3300025918 | Ga0207662_10018967 | Ga0207662_100189674 | 288 |
| 184 | 3300025919 | Ga0207657_10114802 | Ga0207657_101148022 | 288 |
| 185 | 3300025924 | Ga0207694_10079596 | Ga0207694_100795962 | 288 |
| 186 | 3300025927 | Ga0207687_10046382 | Ga0207687_100463824 | 288 |
| 187 | 3300025932 | Ga0207690_10031737 | Ga0207690_100317372 | 288 |
| 188 | 3300025933 | Ga0207706_10033577 | Ga0207706_100335772 | 288 |
| 189 | 3300025941 | Ga0207711_10026991 | Ga0207711_100269913 | 288 |
| 190 | 3300025941 | Ga0207711_10305447 | Ga0207711_103054472 | 288 |
| 191 | 3300025944 | Ga0207661_10333088 | Ga0207661_103330881 | 288 |
| 192 | 3300025986 | Ga0207658_10122780 | Ga0207658_101227802 | 288 |
| 193 | 3300026041 | Ga0207639_10143950 | Ga0207639_101439501 | 288 |
| 194 | 3300026041 | Ga0207639_10553860 | Ga0207639_105538601 | 288 |
| 195 | 3300026067 | Ga0207678_10040015 | Ga0207678_100400153 | 288 |
| 196 | 3300026067 | Ga0207678_10343995 | Ga0207678_103439951 | 288 |
| 197 | 3300026078 | Ga0207702_10228628 | Ga0207702_102286281 | 288 |
| 198 | 3300026089 | Ga0207648_10070233 | Ga0207648_100702332 | 288 |
| 199 | 3300026095 | Ga0207676_10178667 | Ga0207676_101786672 | 288 |
| 200 | 3300026116 | Ga0207674_10299851 | Ga0207674_102998512 | 288 |
| 201 | 3300026121 | Ga0207683_10037081 | Ga0207683_100370813 | 288 |
| 202 | 3300031995 | Ga0307409_100522601 | Ga0307409_1005226011 | 288 |
| 203 | 3300032002 | Ga0307416_100359040 | Ga0307416_1003590402 | 288 |
| 204 | 3300035090 | Ga0373949_0007308 | Ga0373949_0007308_721_1620 | 288 |
| 205 | 3300035114 | Ga0373939_0007115 | Ga0373939_0007115_1122_2021 | 288 |
| 206 | 3300037853 | Ga0436364_0926921 | Ga0436364_0926921_379_1260 | 288 |
| 207 | 3300038443 | Ga0395901_0084010 | Ga0395901_0084010_1632_2516 | 288 |
| 208 | 3300044693 | Ga0466961_0109705 | Ga0466961_0109705_292_1161 | 288 |
| 209 | 3300048906 | Ga0496103_0117525 | Ga0496103_0117525_447_1346 | 288 |
| 210 | 3300048907 | Ga0496104_0030953 | Ga0496104_0030953_3237_4136 | 288 |
| 211 | 3300048911 | Ga0496108_0023168 | Ga0496108_0023168_371_1237 | 288 |
| 212 | 3300048912 | Ga0496109_0035844 | Ga0496109_0035844_25_924 | 288 |
| 213 | 3300048912 | Ga0496109_0221041 | Ga0496109_0221041_190_1065 | 288 |
| 214 | 3300048913 | Ga0496110_0032346 | Ga0496110_0032346_68_967 | 288 |
| 215 | 3300048913 | Ga0496110_0052527 | Ga0496110_0052527_1057_1923 | 288 |
| 216 | 3300048914 | Ga0496111_0183733 | Ga0496111_0183733_38_937 | 288 |
| 217 | 3300048916 | Ga0496113_0186346 | Ga0496113_0186346_380_1246 | 288 |
| 218 | 3300048918 | Ga0496115_0075713 | Ga0496115_0075713_1387_2286 | 288 |
| 219 | 3300048922 | Ga0496119_0000784 | Ga0496119_0000784_33368_34267 | 288 |
| 220 | 3300048923 | Ga0496120_0000765 | Ga0496120_0000765_31377_32276 | 288 |
| 221 | 3300050511 | nmdc:mga08y16_369997_c1 | nmdc:mga08y16_369997_c1_37_906 | 288 |
| 222 | 3300050513 | nmdc:mga0rr50_104041_c1 | nmdc:mga0rr50_104041_c1_659_1558 | 288 |
| 223 | iso_pu_bacteria | 2579778521 | 2579852106 | 288 |
| 224 | iso_pu_bacteria | 2619618881 | 2619854756 | 288 |
| 225 | iso_pu_bacteria | 2619619003 | 2620351139 | 288 |
| 226 | iso_pu_bacteria | 2626541554 | 2626637795 | 288 |
| 227 | iso_pu_bacteria | 2684623035 | 2686534164 | 288 |
| 228 | iso_pu_bacteria | 2687453743 | 2689992897 | 288 |
| 229 | iso_pu_bacteria | 2895880812 | 2895888574 | 288 |
| 230 | iso_pu_bacteria | 8002775197 | 8002776689 | 288 |
| 231 | iso_pu_bacteria | 8054913762 | 8054914049 | 288 |
| 232 | iso_pu_bacteria | 8054920844 | 8054920932 | 288 |
| 233 | 3300005328 | Ga0070676_10012677 | Ga0070676_100126774 | 289 |
| 234 | 3300005353 | Ga0070669_100169468 | Ga0070669_1001694682 | 289 |
| 235 | 3300005354 | Ga0070675_100052421 | Ga0070675_1000524212 | 289 |
| 236 | 3300005356 | Ga0070674_100078787 | Ga0070674_1000787872 | 289 |
| 237 | 3300005367 | Ga0070667_100044423 | Ga0070667_1000444233 | 289 |
| 238 | 3300005456 | Ga0070678_100206018 | Ga0070678_1002060182 | 289 |
| 239 | 3300005548 | Ga0070665_100091542 | Ga0070665_1000915422 | 289 |
| 240 | 3300009098 | Ga0105245_10244952 | Ga0105245_102449522 | 289 |
| 241 | 3300009148 | Ga0105243_10009982 | Ga0105243_100099822 | 289 |
| 242 | 3300013105 | Ga0157369_10097884 | Ga0157369_100978843 | 289 |
| 243 | 3300013306 | Ga0163162_10045053 | Ga0163162_100450534 | 289 |
| 244 | 3300025728 | Ga0207655_1003255 | Ga0207655_10032557 | 289 |
| 245 | 3300025893 | Ga0207682_10002181 | Ga0207682_100021815 | 289 |
| 246 | 3300025925 | Ga0207650_10011387 | Ga0207650_100113872 | 289 |
| 247 | 3300025926 | Ga0207659_10042497 | Ga0207659_100424972 | 289 |
| 248 | 3300025927 | Ga0207687_10304645 | Ga0207687_103046451 | 289 |
| 249 | 3300025934 | Ga0207686_10222560 | Ga0207686_102225602 | 289 |
| 250 | 3300025937 | Ga0207669_10048262 | Ga0207669_100482622 | 289 |
| 251 | 3300025940 | Ga0207691_10003333 | Ga0207691_100033337 | 289 |
| 252 | 3300026121 | Ga0207683_10005043 | Ga0207683_100050437 | 289 |
| 253 | 3300028379 | Ga0268266_10098757 | Ga0268266_100987572 | 289 |
| 254 | 3300030521 | Ga0307511_10021536 | Ga0307511_100215364 | 289 |
| 255 | 3300031548 | Ga0307408_100032388 | Ga0307408_1000323883 | 289 |
| 256 | 3300031548 | Ga0307408_100119731 | Ga0307408_1001197312 | 289 |
| 257 | 3300031548 | Ga0307408_100149958 | Ga0307408_1001499582 | 289 |
| 258 | 3300031731 | Ga0307405_10014548 | Ga0307405_100145482 | 289 |
| 259 | 3300031731 | Ga0307405_10154135 | Ga0307405_101541352 | 289 |
| 260 | 3300031824 | Ga0307413_10369453 | Ga0307413_103694531 | 289 |
| 261 | 3300031852 | Ga0307410_10021018 | Ga0307410_100210183 | 289 |
| 262 | 3300031852 | Ga0307410_10296841 | Ga0307410_102968412 | 289 |
| 263 | 3300031901 | Ga0307406_10162059 | Ga0307406_101620592 | 289 |
| 264 | 3300031903 | Ga0307407_10012314 | Ga0307407_100123143 | 289 |
| 265 | 3300031911 | Ga0307412_10047019 | Ga0307412_100470192 | 289 |
| 266 | 3300031911 | Ga0307412_10053408 | Ga0307412_100534082 | 289 |
| 267 | 3300031911 | Ga0307412_10083724 | Ga0307412_100837242 | 289 |
| 268 | 3300031911 | Ga0307412_10125835 | Ga0307412_101258352 | 289 |
| 269 | 3300031995 | Ga0307409_100335570 | Ga0307409_1003355701 | 289 |
| 270 | 3300032002 | Ga0307416_100066297 | Ga0307416_1000662972 | 289 |
| 271 | 3300032002 | Ga0307416_100200086 | Ga0307416_1002000862 | 289 |
| 272 | 3300032005 | Ga0307411_10364279 | Ga0307411_103642792 | 289 |
| 273 | 3300032126 | Ga0307415_100006832 | Ga0307415_1000068324 | 289 |
| 274 | 3300037418 | Ga0395900_0036657 | Ga0395900_0036657_493_1365 | 289 |
| 275 | 3300037466 | Ga0395898_0081180 | Ga0395898_0081180_1316_2194 | 289 |
| 276 | 3300037466 | Ga0395898_0232664 | Ga0395898_0232664_652_1524 | 289 |
| 277 | 3300038443 | Ga0395901_0262195 | Ga0395901_0262195_424_1296 | 289 |
| 278 | 3300044842 | Ga0466957_0011884 | Ga0466957_0011884_1194_2069 | 289 |
| 279 | 3300045049 | Ga0466959_0017949 | Ga0466959_0017949_357_1232 | 289 |
| 280 | 3300045049 | Ga0466959_0366749 | Ga0466959_0366749_77_952 | 289 |
| 281 | 3300045836 | Ga0466958_0007901 | Ga0466958_0007901_2582_3457 | 289 |
| 282 | 3300045836 | Ga0466958_0181189 | Ga0466958_0181189_134_1009 | 289 |
| 283 | 3300046459 | Ga0495629_0231300 | Ga0495629_0231300_40_909 | 289 |
| 284 | 3300046461 | Ga0495641_0082595 | Ga0495641_0082595_71_946 | 289 |
| 285 | 3300046473 | Ga0495582_0017881 | Ga0495582_0017881_2737_3606 | 289 |
| 286 | 3300046473 | Ga0495582_0116298 | Ga0495582_0116298_441_1310 | 289 |
| 287 | 3300046475 | Ga0495639_0005639 | Ga0495639_0005639_4294_5163 | 289 |
| 288 | 3300046476 | Ga0495662_0028723 | Ga0495662_0028723_1175_2044 | 289 |
| 289 | 3300046492 | Ga0495585_0015675 | Ga0495585_0015675_1394_2278 | 289 |
| 290 | 3300046499 | Ga0495594_0017101 | Ga0495594_0017101_2138_3007 | 289 |
| 291 | 3300046528 | Ga0495642_0012081 | Ga0495642_0012081_1704_2573 | 289 |
| 292 | 3300046531 | Ga0495665_0001901 | Ga0495665_0001901_2560_3429 | 289 |
| 293 | 3300046531 | Ga0495665_0009631 | Ga0495665_0009631_1984_2853 | 289 |
| 294 | 3300046535 | Ga0495586_0004272 | Ga0495586_0004272_4159_5028 | 289 |
| 295 | 3300046535 | Ga0495586_0006650 | Ga0495586_0006650_4171_5040 | 289 |
| 296 | 3300046536 | Ga0495587_0003423 | Ga0495587_0003423_2228_3097 | 289 |
| 297 | 3300046543 | Ga0495645_0000854 | Ga0495645_0000854_7297_8166 | 289 |
| 298 | 3300046559 | Ga0495667_0019127 | Ga0495667_0019127_2161_3030 | 289 |
| 299 | 3300046663 | Ga0495635_0043040 | Ga0495635_0043040_55_924 | 289 |
| 300 | 3300046674 | Ga0495588_0054406 | Ga0495588_0054406_798_1667 | 289 |
| 301 | 3300046674 | Ga0495588_0064364 | Ga0495588_0064364_1009_1878 | 289 |
| 302 | 3300046679 | Ga0495623_0031140 | Ga0495623_0031140_1663_2532 | 289 |
| 303 | 3300046809 | Ga0495600_0003214 | Ga0495600_0003214_6698_7567 | 289 |
| 304 | 3300047315 | Ga0495581_0014752 | Ga0495581_0014752_589_1458 | 289 |
| 305 | 3300047315 | Ga0495581_0066240 | Ga0495581_0066240_1132_2001 | 289 |
| 306 | 3300047444 | Ga0495675_0001270 | Ga0495675_0001270_5799_6668 | 289 |
| 307 | 3300047673 | Ga0495593_0031487 | Ga0495593_0031487_25_894 | 289 |
| 308 | 3300048903 | Ga0496100_0041368 | Ga0496100_0041368_1526_2404 | 289 |
| 309 | 3300048903 | Ga0496100_0052177 | Ga0496100_0052177_863_1732 | 289 |
| 310 | 3300048904 | Ga0496101_0170537 | Ga0496101_0170537_704_1573 | 289 |
| 311 | 3300048905 | Ga0496102_0166925 | Ga0496102_0166925_926_1795 | 289 |
| 312 | 3300048907 | Ga0496104_0128838 | Ga0496104_0128838_636_1505 | 289 |
| 313 | 3300048908 | Ga0496105_0029355 | Ga0496105_0029355_2707_3576 | 289 |
| 314 | 3300048909 | Ga0496106_0025711 | Ga0496106_0025711_1291_2160 | 289 |
| 315 | 3300048910 | Ga0496107_0140690 | Ga0496107_0140690_46_915 | 289 |
| 316 | 3300048911 | Ga0496108_0410465 | Ga0496108_0410465_164_1033 | 289 |
| 317 | 3300048914 | Ga0496111_0081474 | Ga0496111_0081474_926_1795 | 289 |
| 318 | 3300048915 | Ga0496112_0131240 | Ga0496112_0131240_1518_2387 | 289 |
| 319 | 3300048917 | Ga0496114_0048718 | Ga0496114_0048718_2379_3248 | 289 |
| 320 | 3300048918 | Ga0496115_0037615 | Ga0496115_0037615_1247_2116 | 289 |
| 321 | 3300048927 | Ga0496124_0057859 | Ga0496124_0057859_777_1646 | 289 |
| 322 | 3300049573 | Ga0501037_0005151 | Ga0501037_0005151_7885_8757 | 289 |
| 323 | 3300049573 | Ga0501037_0031413 | Ga0501037_0031413_2238_3125 | 289 |
| 324 | 3300049574 | Ga0501038_0064066 | Ga0501038_0064066_1849_2736 | 289 |
| 325 | 3300049575 | Ga0501039_0021915 | Ga0501039_0021915_70_957 | 289 |
| 326 | 3300049575 | Ga0501039_0026472 | Ga0501039_0026472_675_1562 | 289 |
| 327 | 3300049579 | Ga0501043_0300099 | Ga0501043_0300099_111_998 | 289 |
| 328 | 3300053085 | Ga0495619_0410506 | Ga0495619_0410506_14_883 | 289 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8hnq-assembly1.cif.gz_A | the structure of a alcohol dehydrogenase akr13b2 with nadp | 0.9671 | 2 | 286 |
| 8hnq-assembly1.cif.gz_A | the structure of a alcohol dehydrogenase akr13b2 with nadp | 0.9539 | 2 | 286 |
| 3v0u-assembly1.cif.gz_A | crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding | 0.9033 | 12 | 289 |
| 3v0t-assembly1.cif.gz_A | crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding | 0.899 | 13 | 288 |
| 3uyi-assembly1.cif.gz_A-2 | crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding | 0.8932 | 12 | 289 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O94315_19_306_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9911 | 23 | 288 | 3.20.20.100 |
| af_P25906_7_286_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9216 | 23 | 287 | 3.20.20.100 |
| af_A0A0R0ETH2_7_234_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9171 | 13 | 216 | 3.20.20.100 |
| af_O94315_19_306_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9093 | 23 | 288 | 3.20.20.100 |
| af_F4HPY8_8_325_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9047 | 13 | 287 | 3.20.20.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5C4MDS9-F1-model_v4 | Aldo/keto reductase | 0.9944 | 12 | 289 |
GO:0004033
GO:0005737 |
| AF-A0A1A2DX74-F1-model_v4 | Oxidoreductase | 0.9908 | 9 | 287 |
GO:0004033
GO:0005737 |
| AF-A0A840IIJ8-F1-model_v4 | Aryl-alcohol dehydrogenase-like predicted oxidoreductase | 0.9907 | 8 | 287 |
GO:0004033
GO:0005737 |
| AF-A0A375Z3A9-F1-model_v4 | Oxidoreductase [Mycobacterium leprae TN] | 0.9904 | 8 | 287 |
GO:0004033
GO:0005737 |
| AF-A0A7W6VF61-F1-model_v4 | Aryl-alcohol dehydrogenase-like predicted oxidoreductase | 0.99 | 8 | 288 |
GO:0004033
GO:0005737 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar