F409452

General Info

Members Datasets Scaffolds Average Seq Length
328 236 289 290

Family's Representative Sequence

Representative Sequence 3300053096|Ga0500641_0008830|Ga0500641_0008830_376_1245
Length 289
Sequence MNSASNSEVPVVESGTFSLGQLTVRRLGYGAMQITGPGVWGPPADPAAAVRVLRRAVELGVNFVDTADSYGPYVSEELIREALHPYDDVMVATKAGLVRTGPAQWHPVGRPEYLRQECEMSLRRLGVEAIDLFQLHRVDPKVPASEQYGLLKELRDEGKVREVGLSEVTIEQIEAAQKIVPIVSVQNQYNLETRQSEEVLDYCEANGVGFIPWFPINSGALAREGGPVDAISKQTGATAAQVALAWLLARSEVMLPIPGTSSVKHVEENCAAALVKLSDVQIKELNNAV

Samples

Sample ID Description Type Environment
1 2508501039 Frankia saprophytica CN3 Isolate Nodule
2 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
3 2517572101 Frankia sp. DC12 Isolate Nodule
4 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
5 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
6 2619618881 Frankia sp. ACN1ag Isolate Unclassified
7 2619619003 Frankia sp. CpI1-P Isolate Nodule
8 2626541554 Frankia sp. AvcI.1 Isolate Nodule
9 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
10 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
11 2687453737 Frankia sp. BMG5.36 Isolate Nodule
12 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
13 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
14 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
15 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
16 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
17 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
18 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
19 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
20 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
21 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
22 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
23 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
24 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
25 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
26 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
27 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
28 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
29 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
30 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
31 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
32 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
138 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
146 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
147 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
148 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
149 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
150 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
151 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
152 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
162 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
163 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
168 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
169 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
170 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
171 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
172 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
177 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
180 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
181 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
182 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
183 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
201 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
202 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
203 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
204 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
205 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
206 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
207 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
208 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
214 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
215 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
216 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
217 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
224 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
225 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
226 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
227 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
228 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
229 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
230 8002775197 Frankia nepalensis CN7 Isolate Nodule
231 8002784119 Frankia sp. AgB1.9 Isolate Nodule
232 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
233 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
234 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
235 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
236 8054920844 Frankia tisae Agncl-8 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.11
Metatranscriptomes 0
Isolates 11.89

Biome Distribution

Category Percentage (%)
Aerial Root 0.61
Bulb 0
Endosphere 2.44
Nodule 3.66
Rhizoplane 11.89
Rhizosphere 71.34
Stem 0
Stem Tuber 0
Unclassified 10.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10012677 3300005328 Bacteria 4608
2 Ga0068868_100016259 3300005338 Bacteria 5520
3 Ga0068868_100507475 3300005338 Bacteria 1057
4 Ga0070660_100097187 3300005339 Bacteria 2329
5 Ga0070691_10041039 3300005341 Bacteria 2188
6 Ga0070687_100014382 3300005343 Bacteria 3555
7 Ga0070692_10111782 3300005345 Bacteria 1512
8 Ga0070669_100169468 3300005353 Bacteria 1701
9 Ga0070675_100052421 3300005354 Bacteria 3354
10 Ga0070674_100078787 3300005356 Bacteria 2349
11 Ga0070667_100044423 3300005367 Bacteria 3731
12 Ga0070667_100082302 3300005367 Bacteria 2756
13 Ga0070708_100013664 3300005445 Bacteria 6657
14 Ga0070663_100321178 3300005455 Bacteria 1245
15 Ga0070678_100206018 3300005456 Bacteria 1626
16 Ga0070685_10032582 3300005466 Bacteria 2920
17 Ga0068853_100142437 3300005539 Bacteria 2153
18 Ga0070686_100060575 3300005544 Bacteria 2443
19 Ga0070696_100102616 3300005546 Bacteria 2051
20 Ga0070665_100091542 3300005548 Bacteria 3046
21 Ga0070665_100100562 3300005548 Bacteria 2895
22 Ga0070704_100201031 3300005549 Bacteria 1608
23 Ga0068857_100050127 3300005577 Bacteria 3704
24 Ga0068859_100000572 3300005617 Bacteria 36730
25 Ga0068859_100005725 3300005617 Bacteria 12641
26 Ga0068866_10027200 3300005718 Bacteria 2709
27 Ga0068851_10086025 3300005834 Bacteria 1649
28 Ga0068870_10220811 3300005840 Bacteria 1160
29 Ga0068863_100001825 3300005841 Bacteria 21153
30 Ga0068863_100126683 3300005841 Bacteria 2437
31 Ga0068858_100174525 3300005842 Bacteria 2028
32 Ga0068860_100060748 3300005843 Bacteria 3591
33 Ga0068862_100000839 3300005844 Bacteria 30415
34 Ga0081538_10000099 3300005981 Bacteria 83947
35 Ga0081538_10000252 3300005981 Bacteria 60660
36 Ga0081538_10010668 3300005981 Bacteria 7520
37 Ga0070717_10002101 3300006028 Bacteria 13966
38 Ga0070717_10045155 3300006028 Bacteria 3601
39 Ga0075364_10000693 3300006051 Bacteria 17606
40 Ga0075364_10219435 3300006051 Bacteria 1290
41 Ga0070716_100093289 3300006173 Bacteria 1827
42 Ga0097621_100067188 3300006237 Bacteria 2954
43 Ga0097620_100000572 3300006931 Bacteria 36730
44 Ga0097620_100005725 3300006931 Bacteria 12641
45 Ga0075435_100113934 3300007076 Bacteria 2251
46 Ga0111539_10129810 3300009094 Bacteria 2952
47 Ga0111539_10223491 3300009094 Bacteria 2193
48 Ga0105245_10076353 3300009098 Bacteria 3052
49 Ga0105245_10084835 3300009098 Bacteria 2902
50 Ga0105245_10244952 3300009098 Bacteria 1739
51 Ga0105247_10000102 3300009101 Bacteria 90969
52 Ga0105247_10065648 3300009101 Bacteria 2258
53 Ga0105243_10009982 3300009148 Bacteria 7216
54 Ga0105243_10386425 3300009148 Bacteria 1296
55 Ga0105242_10155164 3300009176 Bacteria 1999
56 Ga0105248_10000166 3300009177 Bacteria 77193
57 Ga0105248_10000291 3300009177 Bacteria 59424
58 Ga0105248_10003580 3300009177 Bacteria 17219
59 Ga0105237_10087406 3300009545 Bacteria 3106
60 Ga0105249_10002302 3300009553 Bacteria 16593
61 Ga0105249_10021247 3300009553 Bacteria 5811
62 Ga0105246_10009429 3300011119 Bacteria 6015
63 Ga0157370_10033286 3300013104 Bacteria 5025
64 Ga0157369_10097884 3300013105 Bacteria 3129
65 Ga0157369_10206331 3300013105 Bacteria 2061
66 Ga0157378_10132258 3300013297 Bacteria 2310
67 Ga0163162_10045053 3300013306 Bacteria 4419
68 Ga0157372_10102427 3300013307 Bacteria 3271
69 Ga0163163_10015756 3300014325 Bacteria 7000
70 Ga0157380_10315641 3300014326 Bacteria 1447
71 Ga0157379_10009307 3300014968 Bacteria 8556
72 Ga0157379_10115110 3300014968 Bacteria 2418
73 Ga0157379_10275792 3300014968 Bacteria 1530
74 Ga0157379_10328148 3300014968 Bacteria 1398
75 Ga0213874_10008434 3300021377 Bacteria 2512
76 Ga0207656_10129323 3300025321 Bacteria 1182
77 Ga0207655_1003255 3300025728 Bacteria 12187
78 Ga0207682_10002181 3300025893 Bacteria 8846
79 Ga0207710_10000029 3300025900 Bacteria 289155
80 Ga0207710_10070814 3300025900 Bacteria 1599
81 Ga0207688_10028736 3300025901 Bacteria 3058
82 Ga0207684_10277405 3300025910 Bacteria 1446
83 Ga0207671_10119825 3300025914 Bacteria 2011
84 Ga0207693_10013072 3300025915 Bacteria 6698
85 Ga0207663_10039547 3300025916 Bacteria 2858
86 Ga0207662_10018967 3300025918 Bacteria 3908
87 Ga0207662_10344498 3300025918 Bacteria 999
88 Ga0207657_10114802 3300025919 Bacteria 2220
89 Ga0207652_10221105 3300025921 Bacteria 1706
90 Ga0207694_10079596 3300025924 Bacteria 2570
91 Ga0207650_10011387 3300025925 Bacteria 6122
92 Ga0207659_10042497 3300025926 Bacteria 3187
93 Ga0207687_10046382 3300025927 Bacteria 3008
94 Ga0207687_10304645 3300025927 Bacteria 1284
95 Ga0207644_10052090 3300025931 Bacteria 2941
96 Ga0207690_10031737 3300025932 Bacteria 3383
97 Ga0207706_10033577 3300025933 Bacteria 4566
98 Ga0207686_10222560 3300025934 Bacteria 1363
99 Ga0207669_10048262 3300025937 Bacteria 2528
100 Ga0207691_10003333 3300025940 Bacteria 15631
101 Ga0207711_10000141 3300025941 Bacteria 77173
102 Ga0207711_10001478 3300025941 Bacteria 21895
103 Ga0207711_10026991 3300025941 Bacteria 4821
104 Ga0207711_10305447 3300025941 Bacteria 1468
105 Ga0207661_10333088 3300025944 Bacteria 1367
106 Ga0207712_10017003 3300025961 Bacteria 4718
107 Ga0207658_10122780 3300025986 Bacteria 2074
108 Ga0207703_10080397 3300026035 Bacteria 2714
109 Ga0207639_10143950 3300026041 Bacteria 1989
110 Ga0207639_10553860 3300026041 Bacteria 1056
111 Ga0207678_10040015 3300026067 Bacteria 4066
112 Ga0207678_10343995 3300026067 Bacteria 1285
113 Ga0207702_10228628 3300026078 Bacteria 1737
114 Ga0207641_10006937 3300026088 Bacteria 9479
115 Ga0207648_10070233 3300026089 Bacteria 3053
116 Ga0207648_10392733 3300026089 Bacteria 1256
117 Ga0207676_10178667 3300026095 Bacteria 1856
118 Ga0207674_10239585 3300026116 Bacteria 1761
119 Ga0207674_10299851 3300026116 Bacteria 1556
120 Ga0207683_10005043 3300026121 Bacteria 11337
121 Ga0207683_10037081 3300026121 Bacteria 4245
122 Ga0268266_10098757 3300028379 Bacteria 2570
123 Ga0268265_10000253 3300028380 Bacteria 60788
124 Ga0307511_10021536 3300030521 Bacteria 6067
125 Ga0307408_100032388 3300031548 Bacteria 3644
126 Ga0307408_100119731 3300031548 Bacteria 2037
127 Ga0307408_100149958 3300031548 Bacteria 1839
128 Ga0307516_10020752 3300031730 Bacteria 6782
129 Ga0307405_10014548 3300031731 Bacteria 4234
130 Ga0307405_10154135 3300031731 Bacteria 1619
131 Ga0307413_10006069 3300031824 Bacteria 5475
132 Ga0307413_10012368 3300031824 Bacteria 4246
133 Ga0307413_10081611 3300031824 Bacteria 2074
134 Ga0307413_10369453 3300031824 Bacteria 1113
135 Ga0307410_10021018 3300031852 Bacteria 4006
136 Ga0307410_10063619 3300031852 Bacteria 2532
137 Ga0307410_10296841 3300031852 Bacteria 1273
138 Ga0307406_10162059 3300031901 Bacteria 1609
139 Ga0307407_10012314 3300031903 Bacteria 4107
140 Ga0307412_10001653 3300031911 Bacteria 12315
141 Ga0307412_10047019 3300031911 Bacteria 2831
142 Ga0307412_10053408 3300031911 Bacteria 2678
143 Ga0307412_10083724 3300031911 Bacteria 2212
144 Ga0307412_10125835 3300031911 Bacteria 1853
145 Ga0307409_100103983 3300031995 Bacteria 2364
146 Ga0307409_100147923 3300031995 Bacteria 2034
147 Ga0307409_100335570 3300031995 Bacteria 1420
148 Ga0307409_100522601 3300031995 Bacteria 1160
149 Ga0307416_100066297 3300032002 Bacteria 2972
150 Ga0307416_100200086 3300032002 Bacteria 1894
151 Ga0307416_100359040 3300032002 Bacteria 1478
152 Ga0307414_10025803 3300032004 Bacteria 3771
153 Ga0307414_10078705 3300032004 Bacteria 2404
154 Ga0307411_10364279 3300032005 Bacteria 1183
155 Ga0307415_100006832 3300032126 Bacteria 6192
156 Ga0373949_0007308 3300035090 Bacteria 2418
157 Ga0373939_0007115 3300035114 Bacteria 2712
158 Ga0373937_0039336 3300036401 Bacteria 4310
159 Ga0395900_0036657 3300037418 Bacteria 5056
160 Ga0395898_0081180 3300037466 Bacteria 3127
161 Ga0395898_0232664 3300037466 Bacteria 1757
162 Ga0436364_0864789 3300037853 Bacteria 6547
163 Ga0436364_0926921 3300037853 Plasmid 2513
164 Ga0395901_0084010 3300038443 Bacteria 3328
165 Ga0395901_0262195 3300038443 Bacteria 1798
166 Ga0395901_0807755 3300038443 Bacteria 926
167 Ga0436365_0275704 3300039437 Bacteria 3702
168 Ga0436363_1524120 3300039450 Bacteria 3224
169 Ga0436362_1030948 3300039453 Bacteria 1923
170 Ga0451853_2428981 3300041512 Bacteria 8658
171 Ga0439444_0029696 3300042437 Bacteria 1020
172 Ga0439440_0040054 3300042993 Bacteria 1139
173 Ga0466969_0114601 3300044656 Bacteria 1259
174 Ga0453683_0013051 3300044673 Bacteria 5433
175 Ga0466961_0045116 3300044693 Bacteria 2821
176 Ga0466961_0109705 3300044693 Bacteria 1737
177 Ga0466963_0037017 3300044694 Bacteria 3185
178 Ga0453684_0260266 3300044712 Bacteria 1988
179 Ga0466957_0011884 3300044842 Bacteria 5032
180 Ga0466959_0017949 3300045049 Bacteria 5191
181 Ga0466959_0366749 3300045049 Bacteria 981
182 Ga0466958_0007901 3300045836 Bacteria 5880
183 Ga0466958_0181189 3300045836 Bacteria 1337
184 Ga0495629_0231300 3300046459 Bacteria 1274
185 Ga0495641_0082595 3300046461 Bacteria 1439
186 Ga0495582_0017881 3300046473 Bacteria 3875
187 Ga0495582_0116298 3300046473 Bacteria 1504
188 Ga0495639_0005639 3300046475 Bacteria 5385
189 Ga0495662_0028723 3300046476 Bacteria 2685
190 Ga0495585_0015675 3300046492 Bacteria 4402
191 Ga0495594_0017101 3300046499 Bacteria 3828
192 Ga0495620_0000737 3300046515 Bacteria 20139
193 Ga0495630_0512576 3300046517 Bacteria 920
194 Ga0495637_0003907 3300046520 Bacteria 7818
195 Ga0495648_0015427 3300046524 Bacteria 5549
196 Ga0495642_0012081 3300046528 Bacteria 3327
197 Ga0495665_0001901 3300046531 Bacteria 11270
198 Ga0495665_0009631 3300046531 Bacteria 5234
199 Ga0495586_0004272 3300046535 Bacteria 7640
200 Ga0495586_0006650 3300046535 Bacteria 6172
201 Ga0495587_0003423 3300046536 Bacteria 10583
202 Ga0495645_0000854 3300046543 Bacteria 20754
203 Ga0495667_0019127 3300046559 Bacteria 4622
204 Ga0495635_0043040 3300046663 Bacteria 3117
205 Ga0495588_0054406 3300046674 Bacteria 2064
206 Ga0495588_0064364 3300046674 Bacteria 1902
207 Ga0495623_0031140 3300046679 Bacteria 3431
208 Ga0495600_0003214 3300046809 Bacteria 9561
209 Ga0495581_0014752 3300047315 Bacteria 4532
210 Ga0495581_0066240 3300047315 Bacteria 2088
211 Ga0495675_0001270 3300047444 Bacteria 15282
212 Ga0495673_0000227 3300047469 Bacteria 83114
213 Ga0495684_0029456 3300047471 Bacteria 4214
214 Ga0495593_0031487 3300047673 Bacteria 2897
215 Ga0496100_0003552 3300048903 Bacteria 8144
216 Ga0496100_0041368 3300048903 Bacteria 2938
217 Ga0496100_0052177 3300048903 Bacteria 2657
218 Ga0496101_0002043 3300048904 Bacteria 12285
219 Ga0496101_0170537 3300048904 Bacteria 1672
220 Ga0496102_0053419 3300048905 Bacteria 3683
221 Ga0496102_0101200 3300048905 Bacteria 2677
222 Ga0496102_0157738 3300048905 Bacteria 2134
223 Ga0496102_0166925 3300048905 Bacteria 2071
224 Ga0496102_0719335 3300048905 Bacteria 921
225 Ga0496103_0117525 3300048906 Bacteria 1693
226 Ga0496104_0000054 3300048907 Bacteria 132314
227 Ga0496104_0010256 3300048907 Bacteria 8368
228 Ga0496104_0030953 3300048907 Bacteria 4974
229 Ga0496104_0128838 3300048907 Bacteria 2430
230 Ga0496105_0029355 3300048908 Bacteria 4501
231 Ga0496105_0239351 3300048908 Bacteria 1473
232 Ga0496106_0018961 3300048909 Bacteria 5097
233 Ga0496106_0025711 3300048909 Bacteria 4382
234 Ga0496107_0008836 3300048910 Bacteria 6980
235 Ga0496107_0140690 3300048910 Bacteria 1783
236 Ga0496108_0023168 3300048911 Bacteria 5107
237 Ga0496108_0410465 3300048911 Bacteria 1183
238 Ga0496109_0035844 3300048912 Bacteria 4478
239 Ga0496109_0221041 3300048912 Bacteria 1781
240 Ga0496110_0032346 3300048913 Bacteria 4516
241 Ga0496110_0052527 3300048913 Bacteria 3581
242 Ga0496111_0081474 3300048914 Bacteria 2362
243 Ga0496111_0183733 3300048914 Bacteria 1554
244 Ga0496112_0046666 3300048915 Bacteria 4250
245 Ga0496112_0131240 3300048915 Bacteria 2476
246 Ga0496113_0186346 3300048916 Bacteria 1646
247 Ga0496114_0009368 3300048917 Bacteria 7773
248 Ga0496114_0048718 3300048917 Bacteria 3524
249 Ga0496114_0724803 3300048917 Bacteria 871
250 Ga0496115_0004419 3300048918 Bacteria 10187
251 Ga0496115_0037615 3300048918 Bacteria 3836
252 Ga0496115_0075713 3300048918 Bacteria 2734
253 Ga0496116_0000190 3300048919 Bacteria 122544
254 Ga0496117_0010955 3300048920 Bacteria 8172
255 Ga0496117_0011659 3300048920 Bacteria 7849
256 Ga0496118_0002278 3300048921 Bacteria 26188
257 Ga0496118_0008521 3300048921 Bacteria 10584
258 Ga0496119_0000784 3300048922 Bacteria 42478
259 Ga0496119_0010794 3300048922 Bacteria 7646
260 Ga0496120_0000765 3300048923 Bacteria 46402
261 Ga0496121_0041628 3300048924 Bacteria 4012
262 Ga0496121_0206091 3300048924 Bacteria 1397
263 Ga0496124_0057859 3300048927 Bacteria 3264
264 Ga0496126_0237922 3300048929 Bacteria 1523
265 Ga0501037_0005151 3300049573 Bacteria 9511
266 Ga0501037_0031413 3300049573 Bacteria 3921
267 Ga0501038_0064066 3300049574 Bacteria 3135
268 Ga0501039_0021915 3300049575 Bacteria 4902
269 Ga0501039_0026472 3300049575 Bacteria 4456
270 Ga0501043_0300099 3300049579 Bacteria 1227
271 Ga0501048_0019188 3300049582 Bacteria 5020
272 Ga0501071_0158162 3300049587 Bacteria 1692
273 Ga0501072_0047923 3300049588 Bacteria 3365
274 Ga0501075_0139308 3300049591 Bacteria 1848
275 Ga0501076_0005425 3300049592 Bacteria 9168
276 Ga0501081_0005938 3300049743 Bacteria 7904
277 Ga0501044_0389407 3300049823 Bacteria 1308
278 Ga0501045_0024343 3300049824 Bacteria 4347
279 nmdc:mga00v17_204966_c1 3300050491 Bacteria 1275
280 nmdc:mga00v17_9982_c1 3300050491 Bacteria 5164
281 nmdc:mga08y16_369997_c1 3300050511 Bacteria 1470
282 nmdc:mga0rr50_104041_c1 3300050513 Bacteria 2236
283 Ga0495601_0000481 3300053077 Bacteria 20953
284 Ga0495619_0410506 3300053085 Bacteria 935
285 Ga0500641_0008830 3300053096 Unclassified 3608
286 Ga0500572_043664 3300053111 Bacteria 1311
287 Ga0500595_018946 3300053119 Bacteria 2506
288 Ga0500600_0066212 3300053149 Bacteria 1996
289 Ga0501084_0058342 3300054114 Bacteria 3230

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005981 Ga0081538_10000252 Ga0081538_1000025239 259
2 3300006173 Ga0070716_100093289 Ga0070716_1000932892 259
3 3300009177 Ga0105248_10000166 Ga0105248_1000016658 259
4 3300025941 Ga0207711_10000141 Ga0207711_1000014159 259
5 3300026089 Ga0207648_10392733 Ga0207648_103927332 259
6 3300039453 Ga0436362_1030948 Ga0436362_1030948_1121_1906 259
7 3300044656 Ga0466969_0114601 Ga0466969_0114601_440_1219 259
8 3300044712 Ga0453684_0260266 Ga0453684_0260266_587_1456 259
9 3300047471 Ga0495684_0029456 Ga0495684_0029456_1011_1790 259
10 3300048905 Ga0496102_0719335 Ga0496102_0719335_44_847 259
11 3300048917 Ga0496114_0724803 Ga0496114_0724803_12_791 259
12 iso_pu_bacteria 2515154155 2515855544 265
13 3300042993 Ga0439440_0040054 Ga0439440_0040054_15_824 267
14 3300031730 Ga0307516_10020752 Ga0307516_100207525 273
15 3300044694 Ga0466963_0037017 Ga0466963_0037017_2219_3043 273
16 3300053149 Ga0500600_0066212 Ga0500600_0066212_806_1627 273
17 3300049823 Ga0501044_0389407 Ga0501044_0389407_258_1085 275
18 iso_pu_bacteria 2599185354 2600203684 276
19 iso_pu_bacteria 8053945823 8053951268 276
20 3300005981 Ga0081538_10000099 Ga0081538_1000009980 278
21 3300005981 Ga0081538_10010668 Ga0081538_100106682 278
22 3300031824 Ga0307413_10012368 Ga0307413_100123683 278
23 3300031852 Ga0307410_10063619 Ga0307410_100636194 278
24 3300031911 Ga0307412_10001653 Ga0307412_100016538 278
25 3300031995 Ga0307409_100103983 Ga0307409_1001039832 278
26 3300041512 Ga0451853_2428981 Ga0451853_2428981_669_1505 278
27 3300042437 Ga0439444_0029696 Ga0439444_0029696_79_921 278
28 3300046515 Ga0495620_0000737 Ga0495620_0000737_5236_6078 280
29 3300046520 Ga0495637_0003907 Ga0495637_0003907_4461_5303 280
30 3300047469 Ga0495673_0000227 Ga0495673_0000227_38998_39840 280
31 3300048907 Ga0496104_0000054 Ga0496104_0000054_48894_49742 281
32 3300048905 Ga0496102_0157738 Ga0496102_0157738_404_1270 282
33 3300049582 Ga0501048_0019188 Ga0501048_0019188_3049_3912 282
34 3300049587 Ga0501071_0158162 Ga0501071_0158162_324_1187 282
35 3300049588 Ga0501072_0047923 Ga0501072_0047923_2357_3220 282
36 3300049591 Ga0501075_0139308 Ga0501075_0139308_899_1762 282
37 3300049592 Ga0501076_0005425 Ga0501076_0005425_740_1603 282
38 3300049743 Ga0501081_0005938 Ga0501081_0005938_6329_7192 282
39 3300049824 Ga0501045_0024343 Ga0501045_0024343_2044_2907 282
40 3300053111 Ga0500572_043664 Ga0500572_043664_104_955 282
41 3300053119 Ga0500595_018946 Ga0500595_018946_798_1649 282
42 3300054114 Ga0501084_0058342 Ga0501084_0058342_1087_1950 282
43 iso_pu_bacteria 2984576629 2984577201 283
44 iso_pu_bacteria 2990256926 2990260876 283
45 iso_pu_bacteria 8004021418 8004022349 283
46 iso_pu_bacteria 8004025490 8004026648 283
47 3300025918 Ga0207662_10344498 Ga0207662_103444982 284
48 iso_pu_bacteria 2939598168 2939602172 284
49 3300006028 Ga0070717_10002101 Ga0070717_100021017 285
50 3300038443 Ga0395901_0807755 Ga0395901_0807755_45_905 285
51 3300048924 Ga0496121_0206091 Ga0496121_0206091_65_922 285
52 iso_pu_bacteria 2690315906 2691515773 285
53 iso_pu_bacteria 2775506735 2775657345 285
54 iso_pu_bacteria 2808606357 2808828911 285
55 iso_pu_bacteria 2808606360 2808850142 285
56 iso_pu_bacteria 2808606366 2808877308 285
57 iso_pu_bacteria 2808606370 2808893149 285
58 iso_pu_bacteria 2808606371 2808898783 285
59 iso_pu_bacteria 2811994871 2812319388 285
60 iso_pu_bacteria 2945916053 2945917141 285
61 iso_pu_bacteria 2945920336 2945922608 285
62 iso_pu_bacteria 2946037020 2946037102 285
63 iso_pu_bacteria 2946059875 2946060941 285
64 iso_pu_bacteria 2953998280 2953998354 285
65 iso_pu_bacteria 2990044586 2990050285 285
66 3300005445 Ga0070708_100013664 Ga0070708_1000136647 286
67 3300005577 Ga0068857_100050127 Ga0068857_1000501275 286
68 3300021377 Ga0213874_10008434 Ga0213874_100084343 286
69 3300025910 Ga0207684_10277405 Ga0207684_102774052 286
70 3300025921 Ga0207652_10221105 Ga0207652_102211051 286
71 3300026116 Ga0207674_10239585 Ga0207674_102395853 286
72 3300031824 Ga0307413_10006069 Ga0307413_100060696 286
73 3300032004 Ga0307414_10078705 Ga0307414_100787052 286
74 3300039437 Ga0436365_0275704 Ga0436365_0275704_2045_2911 286
75 3300039450 Ga0436363_1524120 Ga0436363_1524120_1613_2479 286
76 3300044673 Ga0453683_0013051 Ga0453683_0013051_3213_4073 286
77 3300044693 Ga0466961_0045116 Ga0466961_0045116_1761_2621 286
78 3300046524 Ga0495648_0015427 Ga0495648_0015427_4605_5501 286
79 3300048915 Ga0496112_0046666 Ga0496112_0046666_1587_2474 286
80 3300053077 Ga0495601_0000481 Ga0495601_0000481_10838_11698 286
81 iso_pu_bacteria 2974302888 2974305083 286
82 3300005455 Ga0070663_100321178 Ga0070663_1003211782 287
83 3300005617 Ga0068859_100000572 Ga0068859_10000057229 287
84 3300005617 Ga0068859_100005725 Ga0068859_10000572510 287
85 3300005841 Ga0068863_100001825 Ga0068863_1000018256 287
86 3300005842 Ga0068858_100174525 Ga0068858_1001745252 287
87 3300005844 Ga0068862_100000839 Ga0068862_1000008395 287
88 3300006051 Ga0075364_10000693 Ga0075364_100006938 287
89 3300006051 Ga0075364_10219435 Ga0075364_102194351 287
90 3300006931 Ga0097620_100000572 Ga0097620_10000057229 287
91 3300006931 Ga0097620_100005725 Ga0097620_10000572510 287
92 3300009101 Ga0105247_10065648 Ga0105247_100656482 287
93 3300009176 Ga0105242_10155164 Ga0105242_101551644 287
94 3300009177 Ga0105248_10000291 Ga0105248_1000029147 287
95 3300009553 Ga0105249_10021247 Ga0105249_100212475 287
96 3300014325 Ga0163163_10015756 Ga0163163_100157563 287
97 3300014968 Ga0157379_10328148 Ga0157379_103281481 287
98 3300025931 Ga0207644_10052090 Ga0207644_100520904 287
99 3300025941 Ga0207711_10001478 Ga0207711_100014783 287
100 3300025961 Ga0207712_10017003 Ga0207712_100170033 287
101 3300026035 Ga0207703_10080397 Ga0207703_100803972 287
102 3300026088 Ga0207641_10006937 Ga0207641_100069373 287
103 3300028380 Ga0268265_10000253 Ga0268265_1000025332 287
104 3300031824 Ga0307413_10081611 Ga0307413_100816112 287
105 3300031995 Ga0307409_100147923 Ga0307409_1001479233 287
106 3300032004 Ga0307414_10025803 Ga0307414_100258034 287
107 3300036401 Ga0373937_0039336 Ga0373937_0039336_2269_3150 287
108 3300037853 Ga0436364_0864789 Ga0436364_0864789_4447_5322 287
109 3300046517 Ga0495630_0512576 Ga0495630_0512576_26_889 287
110 3300048903 Ga0496100_0003552 Ga0496100_0003552_5335_6207 287
111 3300048904 Ga0496101_0002043 Ga0496101_0002043_6588_7460 287
112 3300048905 Ga0496102_0053419 Ga0496102_0053419_1792_2673 287
113 3300048905 Ga0496102_0101200 Ga0496102_0101200_358_1239 287
114 3300048907 Ga0496104_0010256 Ga0496104_0010256_6132_7004 287
115 3300048908 Ga0496105_0239351 Ga0496105_0239351_35_907 287
116 3300048909 Ga0496106_0018961 Ga0496106_0018961_3356_4228 287
117 3300048910 Ga0496107_0008836 Ga0496107_0008836_311_1183 287
118 3300048917 Ga0496114_0009368 Ga0496114_0009368_1483_2355 287
119 3300048918 Ga0496115_0004419 Ga0496115_0004419_4005_4877 287
120 3300048919 Ga0496116_0000190 Ga0496116_0000190_104860_105741 287
121 3300048920 Ga0496117_0010955 Ga0496117_0010955_5583_6464 287
122 3300048920 Ga0496117_0011659 Ga0496117_0011659_4724_5605 287
123 3300048921 Ga0496118_0002278 Ga0496118_0002278_383_1264 287
124 3300048921 Ga0496118_0008521 Ga0496118_0008521_1171_2052 287
125 3300048922 Ga0496119_0010794 Ga0496119_0010794_4685_5566 287
126 3300048924 Ga0496121_0041628 Ga0496121_0041628_1235_2116 287
127 3300048929 Ga0496126_0237922 Ga0496126_0237922_413_1294 287
128 3300050491 nmdc:mga00v17_204966_c1 nmdc:mga00v17_204966_c1_52_921 287
129 3300050491 nmdc:mga00v17_9982_c1 nmdc:mga00v17_9982_c1_1925_2794 287
130 3300053096 Ga0500641_0008830 Ga0500641_0008830_376_1245 287
131 iso_pu_bacteria 2508501039 2508676288 287
132 iso_pu_bacteria 2517572101 2517763361 287
133 iso_pu_bacteria 2675902999 2676198586 287
134 iso_pu_bacteria 2687453737 2689961451 287
135 iso_pu_bacteria 2773857921 2774843164 287
136 iso_pu_bacteria 8002784119 8002792132 287
137 3300005338 Ga0068868_100016259 Ga0068868_1000162594 288
138 3300005338 Ga0068868_100507475 Ga0068868_1005074751 288
139 3300005339 Ga0070660_100097187 Ga0070660_1000971871 288
140 3300005341 Ga0070691_10041039 Ga0070691_100410392 288
141 3300005343 Ga0070687_100014382 Ga0070687_1000143822 288
142 3300005345 Ga0070692_10111782 Ga0070692_101117822 288
143 3300005367 Ga0070667_100082302 Ga0070667_1000823022 288
144 3300005466 Ga0070685_10032582 Ga0070685_100325821 288
145 3300005539 Ga0068853_100142437 Ga0068853_1001424372 288
146 3300005544 Ga0070686_100060575 Ga0070686_1000605752 288
147 3300005546 Ga0070696_100102616 Ga0070696_1001026162 288
148 3300005548 Ga0070665_100100562 Ga0070665_1001005622 288
149 3300005549 Ga0070704_100201031 Ga0070704_1002010312 288
150 3300005718 Ga0068866_10027200 Ga0068866_100272002 288
151 3300005834 Ga0068851_10086025 Ga0068851_100860252 288
152 3300005840 Ga0068870_10220811 Ga0068870_102208112 288
153 3300005841 Ga0068863_100126683 Ga0068863_1001266833 288
154 3300005843 Ga0068860_100060748 Ga0068860_1000607482 288
155 3300006028 Ga0070717_10045155 Ga0070717_100451552 288
156 3300006237 Ga0097621_100067188 Ga0097621_1000671882 288
157 3300007076 Ga0075435_100113934 Ga0075435_1001139342 288
158 3300009094 Ga0111539_10129810 Ga0111539_101298102 288
159 3300009094 Ga0111539_10223491 Ga0111539_102234912 288
160 3300009098 Ga0105245_10076353 Ga0105245_100763531 288
161 3300009098 Ga0105245_10084835 Ga0105245_100848352 288
162 3300009101 Ga0105247_10000102 Ga0105247_1000010215 288
163 3300009148 Ga0105243_10386425 Ga0105243_103864252 288
164 3300009177 Ga0105248_10003580 Ga0105248_1000358013 288
165 3300009545 Ga0105237_10087406 Ga0105237_100874062 288
166 3300009553 Ga0105249_10002302 Ga0105249_1000230211 288
167 3300011119 Ga0105246_10009429 Ga0105246_100094296 288
168 3300013104 Ga0157370_10033286 Ga0157370_100332863 288
169 3300013105 Ga0157369_10206331 Ga0157369_102063312 288
170 3300013297 Ga0157378_10132258 Ga0157378_101322582 288
171 3300013307 Ga0157372_10102427 Ga0157372_101024272 288
172 3300014326 Ga0157380_10315641 Ga0157380_103156412 288
173 3300014968 Ga0157379_10009307 Ga0157379_100093072 288
174 3300014968 Ga0157379_10115110 Ga0157379_101151102 288
175 3300014968 Ga0157379_10275792 Ga0157379_102757921 288
176 3300025321 Ga0207656_10129323 Ga0207656_101293231 288
177 3300025900 Ga0207710_10000029 Ga0207710_1000002957 288
178 3300025900 Ga0207710_10070814 Ga0207710_100708142 288
179 3300025901 Ga0207688_10028736 Ga0207688_100287365 288
180 3300025914 Ga0207671_10119825 Ga0207671_101198252 288
181 3300025915 Ga0207693_10013072 Ga0207693_100130722 288
182 3300025916 Ga0207663_10039547 Ga0207663_100395472 288
183 3300025918 Ga0207662_10018967 Ga0207662_100189674 288
184 3300025919 Ga0207657_10114802 Ga0207657_101148022 288
185 3300025924 Ga0207694_10079596 Ga0207694_100795962 288
186 3300025927 Ga0207687_10046382 Ga0207687_100463824 288
187 3300025932 Ga0207690_10031737 Ga0207690_100317372 288
188 3300025933 Ga0207706_10033577 Ga0207706_100335772 288
189 3300025941 Ga0207711_10026991 Ga0207711_100269913 288
190 3300025941 Ga0207711_10305447 Ga0207711_103054472 288
191 3300025944 Ga0207661_10333088 Ga0207661_103330881 288
192 3300025986 Ga0207658_10122780 Ga0207658_101227802 288
193 3300026041 Ga0207639_10143950 Ga0207639_101439501 288
194 3300026041 Ga0207639_10553860 Ga0207639_105538601 288
195 3300026067 Ga0207678_10040015 Ga0207678_100400153 288
196 3300026067 Ga0207678_10343995 Ga0207678_103439951 288
197 3300026078 Ga0207702_10228628 Ga0207702_102286281 288
198 3300026089 Ga0207648_10070233 Ga0207648_100702332 288
199 3300026095 Ga0207676_10178667 Ga0207676_101786672 288
200 3300026116 Ga0207674_10299851 Ga0207674_102998512 288
201 3300026121 Ga0207683_10037081 Ga0207683_100370813 288
202 3300031995 Ga0307409_100522601 Ga0307409_1005226011 288
203 3300032002 Ga0307416_100359040 Ga0307416_1003590402 288
204 3300035090 Ga0373949_0007308 Ga0373949_0007308_721_1620 288
205 3300035114 Ga0373939_0007115 Ga0373939_0007115_1122_2021 288
206 3300037853 Ga0436364_0926921 Ga0436364_0926921_379_1260 288
207 3300038443 Ga0395901_0084010 Ga0395901_0084010_1632_2516 288
208 3300044693 Ga0466961_0109705 Ga0466961_0109705_292_1161 288
209 3300048906 Ga0496103_0117525 Ga0496103_0117525_447_1346 288
210 3300048907 Ga0496104_0030953 Ga0496104_0030953_3237_4136 288
211 3300048911 Ga0496108_0023168 Ga0496108_0023168_371_1237 288
212 3300048912 Ga0496109_0035844 Ga0496109_0035844_25_924 288
213 3300048912 Ga0496109_0221041 Ga0496109_0221041_190_1065 288
214 3300048913 Ga0496110_0032346 Ga0496110_0032346_68_967 288
215 3300048913 Ga0496110_0052527 Ga0496110_0052527_1057_1923 288
216 3300048914 Ga0496111_0183733 Ga0496111_0183733_38_937 288
217 3300048916 Ga0496113_0186346 Ga0496113_0186346_380_1246 288
218 3300048918 Ga0496115_0075713 Ga0496115_0075713_1387_2286 288
219 3300048922 Ga0496119_0000784 Ga0496119_0000784_33368_34267 288
220 3300048923 Ga0496120_0000765 Ga0496120_0000765_31377_32276 288
221 3300050511 nmdc:mga08y16_369997_c1 nmdc:mga08y16_369997_c1_37_906 288
222 3300050513 nmdc:mga0rr50_104041_c1 nmdc:mga0rr50_104041_c1_659_1558 288
223 iso_pu_bacteria 2579778521 2579852106 288
224 iso_pu_bacteria 2619618881 2619854756 288
225 iso_pu_bacteria 2619619003 2620351139 288
226 iso_pu_bacteria 2626541554 2626637795 288
227 iso_pu_bacteria 2684623035 2686534164 288
228 iso_pu_bacteria 2687453743 2689992897 288
229 iso_pu_bacteria 2895880812 2895888574 288
230 iso_pu_bacteria 8002775197 8002776689 288
231 iso_pu_bacteria 8054913762 8054914049 288
232 iso_pu_bacteria 8054920844 8054920932 288
233 3300005328 Ga0070676_10012677 Ga0070676_100126774 289
234 3300005353 Ga0070669_100169468 Ga0070669_1001694682 289
235 3300005354 Ga0070675_100052421 Ga0070675_1000524212 289
236 3300005356 Ga0070674_100078787 Ga0070674_1000787872 289
237 3300005367 Ga0070667_100044423 Ga0070667_1000444233 289
238 3300005456 Ga0070678_100206018 Ga0070678_1002060182 289
239 3300005548 Ga0070665_100091542 Ga0070665_1000915422 289
240 3300009098 Ga0105245_10244952 Ga0105245_102449522 289
241 3300009148 Ga0105243_10009982 Ga0105243_100099822 289
242 3300013105 Ga0157369_10097884 Ga0157369_100978843 289
243 3300013306 Ga0163162_10045053 Ga0163162_100450534 289
244 3300025728 Ga0207655_1003255 Ga0207655_10032557 289
245 3300025893 Ga0207682_10002181 Ga0207682_100021815 289
246 3300025925 Ga0207650_10011387 Ga0207650_100113872 289
247 3300025926 Ga0207659_10042497 Ga0207659_100424972 289
248 3300025927 Ga0207687_10304645 Ga0207687_103046451 289
249 3300025934 Ga0207686_10222560 Ga0207686_102225602 289
250 3300025937 Ga0207669_10048262 Ga0207669_100482622 289
251 3300025940 Ga0207691_10003333 Ga0207691_100033337 289
252 3300026121 Ga0207683_10005043 Ga0207683_100050437 289
253 3300028379 Ga0268266_10098757 Ga0268266_100987572 289
254 3300030521 Ga0307511_10021536 Ga0307511_100215364 289
255 3300031548 Ga0307408_100032388 Ga0307408_1000323883 289
256 3300031548 Ga0307408_100119731 Ga0307408_1001197312 289
257 3300031548 Ga0307408_100149958 Ga0307408_1001499582 289
258 3300031731 Ga0307405_10014548 Ga0307405_100145482 289
259 3300031731 Ga0307405_10154135 Ga0307405_101541352 289
260 3300031824 Ga0307413_10369453 Ga0307413_103694531 289
261 3300031852 Ga0307410_10021018 Ga0307410_100210183 289
262 3300031852 Ga0307410_10296841 Ga0307410_102968412 289
263 3300031901 Ga0307406_10162059 Ga0307406_101620592 289
264 3300031903 Ga0307407_10012314 Ga0307407_100123143 289
265 3300031911 Ga0307412_10047019 Ga0307412_100470192 289
266 3300031911 Ga0307412_10053408 Ga0307412_100534082 289
267 3300031911 Ga0307412_10083724 Ga0307412_100837242 289
268 3300031911 Ga0307412_10125835 Ga0307412_101258352 289
269 3300031995 Ga0307409_100335570 Ga0307409_1003355701 289
270 3300032002 Ga0307416_100066297 Ga0307416_1000662972 289
271 3300032002 Ga0307416_100200086 Ga0307416_1002000862 289
272 3300032005 Ga0307411_10364279 Ga0307411_103642792 289
273 3300032126 Ga0307415_100006832 Ga0307415_1000068324 289
274 3300037418 Ga0395900_0036657 Ga0395900_0036657_493_1365 289
275 3300037466 Ga0395898_0081180 Ga0395898_0081180_1316_2194 289
276 3300037466 Ga0395898_0232664 Ga0395898_0232664_652_1524 289
277 3300038443 Ga0395901_0262195 Ga0395901_0262195_424_1296 289
278 3300044842 Ga0466957_0011884 Ga0466957_0011884_1194_2069 289
279 3300045049 Ga0466959_0017949 Ga0466959_0017949_357_1232 289
280 3300045049 Ga0466959_0366749 Ga0466959_0366749_77_952 289
281 3300045836 Ga0466958_0007901 Ga0466958_0007901_2582_3457 289
282 3300045836 Ga0466958_0181189 Ga0466958_0181189_134_1009 289
283 3300046459 Ga0495629_0231300 Ga0495629_0231300_40_909 289
284 3300046461 Ga0495641_0082595 Ga0495641_0082595_71_946 289
285 3300046473 Ga0495582_0017881 Ga0495582_0017881_2737_3606 289
286 3300046473 Ga0495582_0116298 Ga0495582_0116298_441_1310 289
287 3300046475 Ga0495639_0005639 Ga0495639_0005639_4294_5163 289
288 3300046476 Ga0495662_0028723 Ga0495662_0028723_1175_2044 289
289 3300046492 Ga0495585_0015675 Ga0495585_0015675_1394_2278 289
290 3300046499 Ga0495594_0017101 Ga0495594_0017101_2138_3007 289
291 3300046528 Ga0495642_0012081 Ga0495642_0012081_1704_2573 289
292 3300046531 Ga0495665_0001901 Ga0495665_0001901_2560_3429 289
293 3300046531 Ga0495665_0009631 Ga0495665_0009631_1984_2853 289
294 3300046535 Ga0495586_0004272 Ga0495586_0004272_4159_5028 289
295 3300046535 Ga0495586_0006650 Ga0495586_0006650_4171_5040 289
296 3300046536 Ga0495587_0003423 Ga0495587_0003423_2228_3097 289
297 3300046543 Ga0495645_0000854 Ga0495645_0000854_7297_8166 289
298 3300046559 Ga0495667_0019127 Ga0495667_0019127_2161_3030 289
299 3300046663 Ga0495635_0043040 Ga0495635_0043040_55_924 289
300 3300046674 Ga0495588_0054406 Ga0495588_0054406_798_1667 289
301 3300046674 Ga0495588_0064364 Ga0495588_0064364_1009_1878 289
302 3300046679 Ga0495623_0031140 Ga0495623_0031140_1663_2532 289
303 3300046809 Ga0495600_0003214 Ga0495600_0003214_6698_7567 289
304 3300047315 Ga0495581_0014752 Ga0495581_0014752_589_1458 289
305 3300047315 Ga0495581_0066240 Ga0495581_0066240_1132_2001 289
306 3300047444 Ga0495675_0001270 Ga0495675_0001270_5799_6668 289
307 3300047673 Ga0495593_0031487 Ga0495593_0031487_25_894 289
308 3300048903 Ga0496100_0041368 Ga0496100_0041368_1526_2404 289
309 3300048903 Ga0496100_0052177 Ga0496100_0052177_863_1732 289
310 3300048904 Ga0496101_0170537 Ga0496101_0170537_704_1573 289
311 3300048905 Ga0496102_0166925 Ga0496102_0166925_926_1795 289
312 3300048907 Ga0496104_0128838 Ga0496104_0128838_636_1505 289
313 3300048908 Ga0496105_0029355 Ga0496105_0029355_2707_3576 289
314 3300048909 Ga0496106_0025711 Ga0496106_0025711_1291_2160 289
315 3300048910 Ga0496107_0140690 Ga0496107_0140690_46_915 289
316 3300048911 Ga0496108_0410465 Ga0496108_0410465_164_1033 289
317 3300048914 Ga0496111_0081474 Ga0496111_0081474_926_1795 289
318 3300048915 Ga0496112_0131240 Ga0496112_0131240_1518_2387 289
319 3300048917 Ga0496114_0048718 Ga0496114_0048718_2379_3248 289
320 3300048918 Ga0496115_0037615 Ga0496115_0037615_1247_2116 289
321 3300048927 Ga0496124_0057859 Ga0496124_0057859_777_1646 289
322 3300049573 Ga0501037_0005151 Ga0501037_0005151_7885_8757 289
323 3300049573 Ga0501037_0031413 Ga0501037_0031413_2238_3125 289
324 3300049574 Ga0501038_0064066 Ga0501038_0064066_1849_2736 289
325 3300049575 Ga0501039_0021915 Ga0501039_0021915_70_957 289
326 3300049575 Ga0501039_0026472 Ga0501039_0026472_675_1562 289
327 3300049579 Ga0501043_0300099 Ga0501043_0300099_111_998 289
328 3300053085 Ga0495619_0410506 Ga0495619_0410506_14_883 289

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

26

289

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.9671 2 286
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.9539 2 286
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9033 12 289
3v0t-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.899 13 288
3uyi-assembly1.cif.gz_A-2 crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.8932 12 289
ID Description Score Start End Superfamily
af_O94315_19_306_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9911 23 288 3.20.20.100
af_P25906_7_286_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9216 23 287 3.20.20.100
af_A0A0R0ETH2_7_234_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9171 13 216 3.20.20.100
af_O94315_19_306_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9093 23 288 3.20.20.100
af_F4HPY8_8_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9047 13 287 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A5C4MDS9-F1-model_v4 Aldo/keto reductase 0.9944 12 289 GO:0004033
GO:0005737
AF-A0A1A2DX74-F1-model_v4 Oxidoreductase 0.9908 9 287 GO:0004033
GO:0005737
AF-A0A840IIJ8-F1-model_v4 Aryl-alcohol dehydrogenase-like predicted oxidoreductase 0.9907 8 287 GO:0004033
GO:0005737
AF-A0A375Z3A9-F1-model_v4 Oxidoreductase [Mycobacterium leprae TN] 0.9904 8 287 GO:0004033
GO:0005737
AF-A0A7W6VF61-F1-model_v4 Aryl-alcohol dehydrogenase-like predicted oxidoreductase 0.99 8 288 GO:0004033
GO:0005737

Feature Viewer

pLDDT pTM Quality
93.5 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map