F409574

General Info

Members Datasets Scaffolds Average Seq Length
329 190 658 303

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100364978|Ga0070706_1003649782
Length 333
Sequence MGPAIGFASPQLANEASHPEKPPSQPCGTRSKVPCMTPAVEIVNVARRFGTVQALAGVDLAVEAGEFFGLLGPNGAGKTTLISILAGLTRADAGAARVLGHDVVEDYRNARRLLGVVPQELVFDPFFSVRETLEIQSGYFGIRDNDDWIDEILHHLDLTARANANMRALSGGMKRRVLIGQALVHKPPVIVLDEPTAGVDVELRQSLWAFIRKLNRDGHTIILTTHYLEEAEALCGRIAMLKAGKVVALDTKRNLLSSFAGLTVRLTADMLPEAWQSRVVREEDGTYLLSLASYAELERLLAALRESGATIAELSLQEADLEQVFLRIMARHH

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
140 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
162 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
166 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
167 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
171 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
184 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
186 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
187 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
188 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
189 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
190 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.22
Nodule 0
Rhizoplane 0
Rhizosphere 97.87
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100364978 3300005467 Bacteria 1345
2 rootL2_10004552 3300003322 Bacteria 16584
3 Ga0070658_10006355 3300005327 Bacteria 9576
4 Ga0070676_10237480 3300005328 Bacteria 1211
5 Ga0070690_100000412 3300005330 Bacteria 21682
6 Ga0070690_100029916 3300005330 Bacteria 3382
7 Ga0070670_100014420 3300005331 Bacteria 6782
8 Ga0068869_100000446 3300005334 Bacteria 22625
9 Ga0068869_100111174 3300005334 Bacteria 2085
10 Ga0068869_100237166 3300005334 Bacteria 1452
11 Ga0070666_10116735 3300005335 Bacteria 1848
12 Ga0070666_10251292 3300005335 Bacteria 1252
13 Ga0070680_100112889 3300005336 Bacteria 2263
14 Ga0068868_100176824 3300005338 Bacteria 1769
15 Ga0068868_100242947 3300005338 Bacteria 1513
16 Ga0070689_100163486 3300005340 Bacteria 1801
17 Ga0070692_10003660 3300005345 Bacteria 6286
18 Ga0070668_100012372 3300005347 Bacteria 6354
19 Ga0070668_100103042 3300005347 Bacteria 2264
20 Ga0070669_100045332 3300005353 Bacteria 3204
21 Ga0070669_100090623 3300005353 Bacteria 2292
22 Ga0070675_100095331 3300005354 Bacteria 2498
23 Ga0070671_100360507 3300005355 Bacteria 1241
24 Ga0070674_100007493 3300005356 Bacteria 6439
25 Ga0070674_100026763 3300005356 Bacteria 3771
26 Ga0070674_100123837 3300005356 Bacteria 1917
27 Ga0070674_100239925 3300005356 Bacteria 1419
28 Ga0070674_100429378 3300005356 Bacteria 1086
29 Ga0070673_100071889 3300005364 Bacteria 2781
30 Ga0070667_100104742 3300005367 Bacteria 2447
31 Ga0070667_100220434 3300005367 Bacteria 1688
32 Ga0070667_100242900 3300005367 Bacteria 1608
33 Ga0070709_10155857 3300005434 Bacteria 1583
34 Ga0070713_100000699 3300005436 Bacteria 21563
35 Ga0070701_10000095 3300005438 Bacteria 24800
36 Ga0070711_100102980 3300005439 Bacteria 2080
37 Ga0070700_100000343 3300005441 Bacteria 23981
38 Ga0070694_100108782 3300005444 Bacteria 1972
39 Ga0070694_100359824 3300005444 Bacteria 1130
40 Ga0070708_100000226 3300005445 Bacteria 42003
41 Ga0070708_100437210 3300005445 Bacteria 1234
42 Ga0070678_100003913 3300005456 Bacteria 8374
43 Ga0070678_100077581 3300005456 Bacteria 2507
44 Ga0070678_100236264 3300005456 Bacteria 1526
45 Ga0070662_100208583 3300005457 Bacteria 1554
46 Ga0070681_10005855 3300005458 Bacteria 11898
47 Ga0068867_100000224 3300005459 Bacteria 37294
48 Ga0068867_100073637 3300005459 Bacteria 2558
49 Ga0068867_100195526 3300005459 Bacteria 1616
50 Ga0070685_10042714 3300005466 Bacteria 2588
51 Ga0070706_100179014 3300005467 Bacteria 1979
52 Ga0070706_100370062 3300005467 Bacteria 1335
53 Ga0070707_100150610 3300005468 Bacteria 2265
54 Ga0070698_100009607 3300005471 Bacteria 10348
55 Ga0070699_100186379 3300005518 Bacteria 1842
56 Ga0070679_100011828 3300005530 Bacteria 8324
57 Ga0070697_100018224 3300005536 Bacteria 5534
58 Ga0070697_100186145 3300005536 Bacteria 1761
59 Ga0070697_100194697 3300005536 Bacteria 1721
60 Ga0070672_100014382 3300005543 Bacteria 5608
61 Ga0070672_100487478 3300005543 Bacteria 1065
62 Ga0070686_100000448 3300005544 Bacteria 25484
63 Ga0070695_100003128 3300005545 Bacteria 9642
64 Ga0070695_100081255 3300005545 Bacteria 2144
65 Ga0070693_100000709 3300005547 Bacteria 14685
66 Ga0070693_100003468 3300005547 Bacteria 7362
67 Ga0070665_100014676 3300005548 Bacteria 7861
68 Ga0070665_100086235 3300005548 Bacteria 3145
69 Ga0070665_100128039 3300005548 Bacteria 2541
70 Ga0070665_100172232 3300005548 Bacteria 2166
71 Ga0068855_100028360 3300005563 Bacteria 6697
72 Ga0068855_100040786 3300005563 Bacteria 5506
73 Ga0068855_100074783 3300005563 Bacteria 3934
74 Ga0068855_100637236 3300005563 Bacteria 1146
75 Ga0070664_100012474 3300005564 Bacteria 6909
76 Ga0070664_100021711 3300005564 Bacteria 5295
77 Ga0068857_100202666 3300005577 Bacteria 1809
78 Ga0068854_100072424 3300005578 Bacteria 2523
79 Ga0068854_100335921 3300005578 Bacteria 1232
80 Ga0070702_100000034 3300005615 Bacteria 36812
81 Ga0068852_100058649 3300005616 Bacteria 3336
82 Ga0068852_100089263 3300005616 Bacteria 2754
83 Ga0068852_100245693 3300005616 Bacteria 1712
84 Ga0068859_100139401 3300005617 Bacteria 2499
85 Ga0068859_100526007 3300005617 Bacteria 1277
86 Ga0068864_100047089 3300005618 Bacteria 3701
87 Ga0068864_100089894 3300005618 Bacteria 2706
88 Ga0068864_100210514 3300005618 Bacteria 1790
89 Ga0068866_10000071 3300005718 Bacteria 40521
90 Ga0068861_100000604 3300005719 Bacteria 21267
91 Ga0068861_100106520 3300005719 Bacteria 2240
92 Ga0068861_100187871 3300005719 Bacteria 1725
93 Ga0068851_10058799 3300005834 Bacteria 1965
94 Ga0068870_10028274 3300005840 Bacteria 2814
95 Ga0068863_100027393 3300005841 Bacteria 5435
96 Ga0068863_100090723 3300005841 Bacteria 2897
97 Ga0068863_100092086 3300005841 Bacteria 2875
98 Ga0068863_100218193 3300005841 Bacteria 1837
99 Ga0068858_100000890 3300005842 Bacteria 31011
100 Ga0068858_100001410 3300005842 Bacteria 24676
101 Ga0068858_100110243 3300005842 Bacteria 2570
102 Ga0068858_100360472 3300005842 Bacteria 1393
103 Ga0068860_100056574 3300005843 Bacteria 3728
104 Ga0068860_100226083 3300005843 Bacteria 1818
105 Ga0068860_100284369 3300005843 Bacteria 1617
106 Ga0068862_100001545 3300005844 Bacteria 21055
107 Ga0068862_100011362 3300005844 Bacteria 7352
108 Ga0068862_100498990 3300005844 Bacteria 1155
109 Ga0075364_10016545 3300006051 Bacteria 4589
110 Ga0070715_10063965 3300006163 Bacteria 1623
111 Ga0075366_10004474 3300006195 Bacteria 7500
112 Ga0097621_100006216 3300006237 Bacteria 8467
113 Ga0097621_100078358 3300006237 Bacteria 2745
114 Ga0097621_100143871 3300006237 Bacteria 2039
115 Ga0097621_100231582 3300006237 Bacteria 1613
116 Ga0097621_100340166 3300006237 Bacteria 1332
117 Ga0068871_100002080 3300006358 Bacteria 13535
118 Ga0068871_100019576 3300006358 Bacteria 5170
119 Ga0068871_100048306 3300006358 Bacteria 3435
120 Ga0068871_100335759 3300006358 Bacteria 1334
121 Ga0075428_100010059 3300006844 Bacteria 10510
122 Ga0075434_100061322 3300006871 Bacteria 3742
123 Ga0075434_100108121 3300006871 Bacteria 2792
124 Ga0075434_100543167 3300006871 Bacteria 1182
125 Ga0075429_100196291 3300006880 Bacteria 1768
126 Ga0068865_100000179 3300006881 Bacteria 35156
127 Ga0075436_100001144 3300006914 Bacteria 17940
128 Ga0075436_100091316 3300006914 Bacteria 2117
129 Ga0075436_100097355 3300006914 Bacteria 2047
130 Ga0097620_100139401 3300006931 Bacteria 2499
131 Ga0097620_100525992 3300006931 Bacteria 1277
132 Ga0105240_10008480 3300009093 Bacteria 14698
133 Ga0111539_10001740 3300009094 Bacteria 28934
134 Ga0105245_10000414 3300009098 Bacteria 39803
135 Ga0105245_10057190 3300009098 Bacteria 3507
136 Ga0105243_10000212 3300009148 Bacteria 67614
137 Ga0105243_10444007 3300009148 Bacteria 1215
138 Ga0105243_10640791 3300009148 Bacteria 1029
139 Ga0105241_10043652 3300009174 Bacteria 3396
140 Ga0105242_10000291 3300009176 Bacteria 39986
141 Ga0105242_10010157 3300009176 Bacteria 7212
142 Ga0105242_10124883 3300009176 Bacteria 2214
143 Ga0105248_10121093 3300009177 Bacteria 2951
144 Ga0105248_10145281 3300009177 Bacteria 2677
145 Ga0105238_10009455 3300009551 Bacteria 9756
146 Ga0105238_10074067 3300009551 Bacteria 3398
147 Ga0105249_10040644 3300009553 Bacteria 4225
148 Ga0105249_10081290 3300009553 Bacteria 3012
149 Ga0157369_10003314 3300013105 Bacteria 19138
150 Ga0157369_10463440 3300013105 Bacteria 1312
151 Ga0157369_10495430 3300013105 Bacteria 1264
152 Ga0157374_10022398 3300013296 Bacteria 5636
153 Ga0157374_10171073 3300013296 Bacteria 2119
154 Ga0157378_10001356 3300013297 Bacteria 22016
155 Ga0157378_10382215 3300013297 Bacteria 1383
156 Ga0163162_10012691 3300013306 Bacteria 8224
157 Ga0163162_10353031 3300013306 Bacteria 1603
158 Ga0157372_10001380 3300013307 Bacteria 26204
159 Ga0157375_10100751 3300013308 Bacteria 2970
160 Ga0157375_10377563 3300013308 Bacteria 1584
161 Ga0157380_10015914 3300014326 Bacteria 5535
162 Ga0157380_10031469 3300014326 Bacteria 4073
163 Ga0157379_10017917 3300014968 Bacteria 6239
164 Ga0163161_10421940 3300017792 Bacteria 1073
165 Ga0213872_10005558 3300021361 Bacteria 6455
166 Ga0207697_10031766 3300025315 Bacteria 2160
167 Ga0207642_10001746 3300025899 Bacteria 6707
168 Ga0207688_10035090 3300025901 Bacteria 2778
169 Ga0207699_10114103 3300025906 Bacteria 1737
170 Ga0207645_10183629 3300025907 Bacteria 1373
171 Ga0207643_10025968 3300025908 Bacteria 3240
172 Ga0207643_10113747 3300025908 Bacteria 1596
173 Ga0207643_10196730 3300025908 Bacteria 1226
174 Ga0207705_10016737 3300025909 Bacteria 5251
175 Ga0207705_10022223 3300025909 Bacteria 4524
176 Ga0207705_10032317 3300025909 Bacteria 3739
177 Ga0207705_10083709 3300025909 Bacteria 2328
178 Ga0207684_10093234 3300025910 Bacteria 2567
179 Ga0207707_10009302 3300025912 Bacteria 8521
180 Ga0207695_10042983 3300025913 Bacteria 4820
181 Ga0207695_10045730 3300025913 Bacteria 4645
182 Ga0207663_10086877 3300025916 Bacteria 2064
183 Ga0207652_10015012 3300025921 Bacteria 6283
184 Ga0207681_10213687 3300025923 Bacteria 1488
185 Ga0207650_10008238 3300025925 Bacteria 7115
186 Ga0207650_10396585 3300025925 Bacteria 1142
187 Ga0207659_10005795 3300025926 Bacteria 7528
188 Ga0207687_10000873 3300025927 Bacteria 20408
189 Ga0207687_10071082 3300025927 Bacteria 2486
190 Ga0207687_10150466 3300025927 Bacteria 1775
191 Ga0207700_10021477 3300025928 Bacteria 4408
192 Ga0207664_10034440 3300025929 Bacteria 3901
193 Ga0207664_10133809 3300025929 Bacteria 2090
194 Ga0207644_10129428 3300025931 Bacteria 1931
195 Ga0207686_10000366 3300025934 Bacteria 31802
196 Ga0207686_10055638 3300025934 Bacteria 2483
197 Ga0207686_10184941 3300025934 Bacteria 1480
198 Ga0207670_10014903 3300025936 Bacteria 4630
199 Ga0207670_10079367 3300025936 Bacteria 2291
200 Ga0207669_10061930 3300025937 Bacteria 2302
201 Ga0207669_10093250 3300025937 Bacteria 1967
202 Ga0207669_10099318 3300025937 Bacteria 1919
203 Ga0207704_10000183 3300025938 Bacteria 32999
204 Ga0207665_10179107 3300025939 Bacteria 1534
205 Ga0207691_10020539 3300025940 Bacteria 6245
206 Ga0207691_10103126 3300025940 Bacteria 2544
207 Ga0207691_10145964 3300025940 Bacteria 2083
208 Ga0207691_10146964 3300025940 Bacteria 2075
209 Ga0207711_10200428 3300025941 Bacteria 1821
210 Ga0207711_10246025 3300025941 Bacteria 1641
211 Ga0207689_10001513 3300025942 Bacteria 22121
212 Ga0207689_10024569 3300025942 Bacteria 5054
213 Ga0207689_10058782 3300025942 Bacteria 3163
214 Ga0207689_10060634 3300025942 Bacteria 3111
215 Ga0207661_10123912 3300025944 Bacteria 2205
216 Ga0207679_10013729 3300025945 Bacteria 5311
217 Ga0207667_10024029 3300025949 Bacteria 6702
218 Ga0207651_10183518 3300025960 Bacteria 1662
219 Ga0207712_10095470 3300025961 Bacteria 2199
220 Ga0207712_10237810 3300025961 Bacteria 1466
221 Ga0207668_10005390 3300025972 Bacteria 7530
222 Ga0207668_10025357 3300025972 Bacteria 3837
223 Ga0207640_10319273 3300025981 Bacteria 1236
224 Ga0207658_10324318 3300025986 Bacteria 1334
225 Ga0207658_10501721 3300025986 Bacteria 1081
226 Ga0207703_10019987 3300026035 Bacteria 5233
227 Ga0207703_10065914 3300026035 Bacteria 2977
228 Ga0207703_10195547 3300026035 Bacteria 1794
229 Ga0207703_10270134 3300026035 Bacteria 1540
230 Ga0207639_10088388 3300026041 Bacteria 2472
231 Ga0207678_10030811 3300026067 Bacteria 4684
232 Ga0207678_10161414 3300026067 Bacteria 1914
233 Ga0207708_10000058 3300026075 Bacteria 95656
234 Ga0207708_10119816 3300026075 Bacteria 2050
235 Ga0207702_10187272 3300026078 Bacteria 1910
236 Ga0207648_10000635 3300026089 Bacteria 39416
237 Ga0207648_10004079 3300026089 Bacteria 15140
238 Ga0207648_10025705 3300026089 Bacteria 5242
239 Ga0207648_10048393 3300026089 Bacteria 3722
240 Ga0207676_10040103 3300026095 Bacteria 3587
241 Ga0207674_10227678 3300026116 Bacteria 1812
242 Ga0207675_100000480 3300026118 Bacteria 38807
243 Ga0207675_100065462 3300026118 Bacteria 3397
244 Ga0207675_100105412 3300026118 Bacteria 2657
245 Ga0207683_10001329 3300026121 Bacteria 22302
246 Ga0207683_10006552 3300026121 Bacteria 9968
247 Ga0207683_10042893 3300026121 Bacteria 3951
248 Ga0207683_10166893 3300026121 Bacteria 1992
249 Ga0207683_10168415 3300026121 Bacteria 1983
250 Ga0207698_10119006 3300026142 Bacteria 2231
251 Ga0207698_10120269 3300026142 Bacteria 2221
252 Ga0207698_10560235 3300026142 Bacteria 1122
253 Ga0207428_10002211 3300027907 Bacteria 19536
254 Ga0268266_10108735 3300028379 Bacteria 2454
255 Ga0268266_10158806 3300028379 Bacteria 2044
256 Ga0268266_10211832 3300028379 Bacteria 1777
257 Ga0268266_10391600 3300028379 Bacteria 1312
258 Ga0268265_10008954 3300028380 Bacteria 6769
259 Ga0268265_10011458 3300028380 Bacteria 5996
260 Ga0268265_10044905 3300028380 Bacteria 3293
261 Ga0268265_10504241 3300028380 Bacteria 1141
262 Ga0268264_10080753 3300028381 Bacteria 2777
263 Ga0268264_10185748 3300028381 Bacteria 1891
264 Ga0268264_10340670 3300028381 Bacteria 1424
265 Ga0307408_100246572 3300031548 Bacteria 1471
266 Ga0307408_100289695 3300031548 Bacteria 1367
267 Ga0307516_10131788 3300031730 Bacteria 2278
268 Ga0307407_10215242 3300031903 Bacteria 1296
269 Ga0307412_10239421 3300031911 Bacteria 1403
270 Ga0307409_100381063 3300031995 Bacteria 1341
271 Ga0307414_10066305 3300032004 Bacteria 2580
272 Ga0307411_10141029 3300032005 Bacteria 1777
273 Ga0373954_0002148 3300035118 Bacteria 8184
274 Ga0373955_0067514 3300035172 Bacteria 1991
275 Ga0373955_0074162 3300035172 Bacteria 1909
276 Ga0373931_0046433 3300035691 Bacteria 2296
277 Ga0373927_0003205 3300035695 Bacteria 11785
278 Ga0373927_0017254 3300035695 Bacteria 4753
279 Ga0373937_0004087 3300036401 Bacteria 12375
280 Ga0373937_0028552 3300036401 Bacteria 5049
281 Ga0373937_0103041 3300036401 Bacteria 2650
282 Ga0373925_0169848 3300037068 Bacteria 1721
283 Ga0395899_0244007 3300037312 Bacteria 1235
284 Ga0395900_0036966 3300037418 Bacteria 5034
285 Ga0395905_0052262 3300037471 Bacteria 3825
286 Ga0436365_1726363 3300039437 Bacteria 1862
287 Ga0436361_0085803 3300039447 Bacteria 3873
288 Ga0436361_0823412 3300039447 Bacteria 1640
289 Ga0451577_0524113 3300042876 Bacteria 1076
290 Ga0453683_0131427 3300044673 Bacteria 1578
291 Ga0451576_0038323 3300045051 Bacteria 5073
292 Ga0451576_0119803 3300045051 Bacteria 2740
293 Ga0451576_0576034 3300045051 Bacteria 1183
294 Ga0495592_0004622 3300046454 Bacteria 10085
295 Ga0495628_0009950 3300046516 Bacteria 8094
296 Ga0495652_0123831 3300046529 Bacteria 2057
297 Ga0495587_0016929 3300046536 Bacteria 4534
298 Ga0495645_0007376 3300046543 Bacteria 7648
299 Ga0495667_0004241 3300046559 Bacteria 9657
300 Ga0495667_0046085 3300046559 Bacteria 2884
301 Ga0495635_0055299 3300046663 Bacteria 2734
302 Ga0495599_0009455 3300046678 Bacteria 5959
303 Ga0495599_0172635 3300046678 Bacteria 1333
304 Ga0495623_0006633 3300046679 Bacteria 7534
305 Ga0495604_0016539 3300047317 Bacteria 5897
306 Ga0495684_0091487 3300047471 Bacteria 2304
307 Ga0501067_0040310 3300049583 Bacteria 2594
308 Ga0501069_0005023 3300049585 Bacteria 6861
309 Ga0501070_0002752 3300049586 Bacteria 15349
310 Ga0501074_0001435 3300049590 Bacteria 15927
311 Ga0501209_004135 3300049656 Bacteria 2481
312 Ga0501079_0051527 3300049741 Bacteria 3178
313 Ga0501080_0002145 3300049742 Bacteria 17128
314 Ga0501083_0000252 3300049744 Bacteria 34143
315 Ga0501035_0078942 3300049822 Bacteria 2907
316 Ga0501044_0060290 3300049823 Bacteria 3885
317 Ga0501044_0125025 3300049823 Bacteria 2570
318 nmdc:mga0k408_18978_c1 3300050493 Bacteria 3839
319 nmdc:mga0k408_9027_c1 3300050493 Bacteria 5366
320 nmdc:mga05p37_85374_c1 3300050507 Bacteria 3889
321 nmdc:mga08y16_1258_c1 3300050511 Bacteria 25159
322 nmdc:mga0rr50_164052_c1 3300050513 Bacteria 1805
323 nmdc:mga08x19_35520_c1 3300050514 Bacteria 3154
324 nmdc:mga0a205_25032_c1 3300050515 Bacteria 5682
325 Ga0495601_0009545 3300053077 Bacteria 5745
326 Ga0495595_0007713 3300053084 Bacteria 4409
327 Ga0495619_0046329 3300053085 Bacteria 2859
328 Ga0501084_0157580 3300054114 Bacteria 1915
329 Ga0501082_0033317 3300060353 Bacteria 4445
330 Ga0070706_100364978
331 rootL2_10004552
332 Ga0070658_10006355
333 Ga0070676_10237480
334 Ga0070690_100000412
335 Ga0070690_100029916
336 Ga0070670_100014420
337 Ga0068869_100000446
338 Ga0068869_100111174
339 Ga0068869_100237166
340 Ga0070666_10116735
341 Ga0070666_10251292
342 Ga0070680_100112889
343 Ga0068868_100176824
344 Ga0068868_100242947
345 Ga0070689_100163486
346 Ga0070692_10003660
347 Ga0070668_100012372
348 Ga0070668_100103042
349 Ga0070669_100045332
350 Ga0070669_100090623
351 Ga0070675_100095331
352 Ga0070671_100360507
353 Ga0070674_100007493
354 Ga0070674_100026763
355 Ga0070674_100123837
356 Ga0070674_100239925
357 Ga0070674_100429378
358 Ga0070673_100071889
359 Ga0070667_100104742
360 Ga0070667_100220434
361 Ga0070667_100242900
362 Ga0070709_10155857
363 Ga0070713_100000699
364 Ga0070701_10000095
365 Ga0070711_100102980
366 Ga0070700_100000343
367 Ga0070694_100108782
368 Ga0070694_100359824
369 Ga0070708_100000226
370 Ga0070708_100437210
371 Ga0070678_100003913
372 Ga0070678_100077581
373 Ga0070678_100236264
374 Ga0070662_100208583
375 Ga0070681_10005855
376 Ga0068867_100000224
377 Ga0068867_100073637
378 Ga0068867_100195526
379 Ga0070685_10042714
380 Ga0070706_100179014
381 Ga0070706_100370062
382 Ga0070707_100150610
383 Ga0070698_100009607
384 Ga0070699_100186379
385 Ga0070679_100011828
386 Ga0070697_100018224
387 Ga0070697_100186145
388 Ga0070697_100194697
389 Ga0070672_100014382
390 Ga0070672_100487478
391 Ga0070686_100000448
392 Ga0070695_100003128
393 Ga0070695_100081255
394 Ga0070693_100000709
395 Ga0070693_100003468
396 Ga0070665_100014676
397 Ga0070665_100086235
398 Ga0070665_100128039
399 Ga0070665_100172232
400 Ga0068855_100028360
401 Ga0068855_100040786
402 Ga0068855_100074783
403 Ga0068855_100637236
404 Ga0070664_100012474
405 Ga0070664_100021711
406 Ga0068857_100202666
407 Ga0068854_100072424
408 Ga0068854_100335921
409 Ga0070702_100000034
410 Ga0068852_100058649
411 Ga0068852_100089263
412 Ga0068852_100245693
413 Ga0068859_100139401
414 Ga0068859_100526007
415 Ga0068864_100047089
416 Ga0068864_100089894
417 Ga0068864_100210514
418 Ga0068866_10000071
419 Ga0068861_100000604
420 Ga0068861_100106520
421 Ga0068861_100187871
422 Ga0068851_10058799
423 Ga0068870_10028274
424 Ga0068863_100027393
425 Ga0068863_100090723
426 Ga0068863_100092086
427 Ga0068863_100218193
428 Ga0068858_100000890
429 Ga0068858_100001410
430 Ga0068858_100110243
431 Ga0068858_100360472
432 Ga0068860_100056574
433 Ga0068860_100226083
434 Ga0068860_100284369
435 Ga0068862_100001545
436 Ga0068862_100011362
437 Ga0068862_100498990
438 Ga0075364_10016545
439 Ga0070715_10063965
440 Ga0075366_10004474
441 Ga0097621_100006216
442 Ga0097621_100078358
443 Ga0097621_100143871
444 Ga0097621_100231582
445 Ga0097621_100340166
446 Ga0068871_100002080
447 Ga0068871_100019576
448 Ga0068871_100048306
449 Ga0068871_100335759
450 Ga0075428_100010059
451 Ga0075434_100061322
452 Ga0075434_100108121
453 Ga0075434_100543167
454 Ga0075429_100196291
455 Ga0068865_100000179
456 Ga0075436_100001144
457 Ga0075436_100091316
458 Ga0075436_100097355
459 Ga0097620_100139401
460 Ga0097620_100525992
461 Ga0105240_10008480
462 Ga0111539_10001740
463 Ga0105245_10000414
464 Ga0105245_10057190
465 Ga0105243_10000212
466 Ga0105243_10444007
467 Ga0105243_10640791
468 Ga0105241_10043652
469 Ga0105242_10000291
470 Ga0105242_10010157
471 Ga0105242_10124883
472 Ga0105248_10121093
473 Ga0105248_10145281
474 Ga0105238_10009455
475 Ga0105238_10074067
476 Ga0105249_10040644
477 Ga0105249_10081290
478 Ga0157369_10003314
479 Ga0157369_10463440
480 Ga0157369_10495430
481 Ga0157374_10022398
482 Ga0157374_10171073
483 Ga0157378_10001356
484 Ga0157378_10382215
485 Ga0163162_10012691
486 Ga0163162_10353031
487 Ga0157372_10001380
488 Ga0157375_10100751
489 Ga0157375_10377563
490 Ga0157380_10015914
491 Ga0157380_10031469
492 Ga0157379_10017917
493 Ga0163161_10421940
494 Ga0213872_10005558
495 Ga0207697_10031766
496 Ga0207642_10001746
497 Ga0207688_10035090
498 Ga0207699_10114103
499 Ga0207645_10183629
500 Ga0207643_10025968
501 Ga0207643_10113747
502 Ga0207643_10196730
503 Ga0207705_10016737
504 Ga0207705_10022223
505 Ga0207705_10032317
506 Ga0207705_10083709
507 Ga0207684_10093234
508 Ga0207707_10009302
509 Ga0207695_10042983
510 Ga0207695_10045730
511 Ga0207663_10086877
512 Ga0207652_10015012
513 Ga0207681_10213687
514 Ga0207650_10008238
515 Ga0207650_10396585
516 Ga0207659_10005795
517 Ga0207687_10000873
518 Ga0207687_10071082
519 Ga0207687_10150466
520 Ga0207700_10021477
521 Ga0207664_10034440
522 Ga0207664_10133809
523 Ga0207644_10129428
524 Ga0207686_10000366
525 Ga0207686_10055638
526 Ga0207686_10184941
527 Ga0207670_10014903
528 Ga0207670_10079367
529 Ga0207669_10061930
530 Ga0207669_10093250
531 Ga0207669_10099318
532 Ga0207704_10000183
533 Ga0207665_10179107
534 Ga0207691_10020539
535 Ga0207691_10103126
536 Ga0207691_10145964
537 Ga0207691_10146964
538 Ga0207711_10200428
539 Ga0207711_10246025
540 Ga0207689_10001513
541 Ga0207689_10024569
542 Ga0207689_10058782
543 Ga0207689_10060634
544 Ga0207661_10123912
545 Ga0207679_10013729
546 Ga0207667_10024029
547 Ga0207651_10183518
548 Ga0207712_10095470
549 Ga0207712_10237810
550 Ga0207668_10005390
551 Ga0207668_10025357
552 Ga0207640_10319273
553 Ga0207658_10324318
554 Ga0207658_10501721
555 Ga0207703_10019987
556 Ga0207703_10065914
557 Ga0207703_10195547
558 Ga0207703_10270134
559 Ga0207639_10088388
560 Ga0207678_10030811
561 Ga0207678_10161414
562 Ga0207708_10000058
563 Ga0207708_10119816
564 Ga0207702_10187272
565 Ga0207648_10000635
566 Ga0207648_10004079
567 Ga0207648_10025705
568 Ga0207648_10048393
569 Ga0207676_10040103
570 Ga0207674_10227678
571 Ga0207675_100000480
572 Ga0207675_100065462
573 Ga0207675_100105412
574 Ga0207683_10001329
575 Ga0207683_10006552
576 Ga0207683_10042893
577 Ga0207683_10166893
578 Ga0207683_10168415
579 Ga0207698_10119006
580 Ga0207698_10120269
581 Ga0207698_10560235
582 Ga0207428_10002211
583 Ga0268266_10108735
584 Ga0268266_10158806
585 Ga0268266_10211832
586 Ga0268266_10391600
587 Ga0268265_10008954
588 Ga0268265_10011458
589 Ga0268265_10044905
590 Ga0268265_10504241
591 Ga0268264_10080753
592 Ga0268264_10185748
593 Ga0268264_10340670
594 Ga0307408_100246572
595 Ga0307408_100289695
596 Ga0307516_10131788
597 Ga0307407_10215242
598 Ga0307412_10239421
599 Ga0307409_100381063
600 Ga0307414_10066305
601 Ga0307411_10141029
602 Ga0373954_0002148
603 Ga0373955_0067514
604 Ga0373955_0074162
605 Ga0373931_0046433
606 Ga0373927_0003205
607 Ga0373927_0017254
608 Ga0373937_0004087
609 Ga0373937_0028552
610 Ga0373937_0103041
611 Ga0373925_0169848
612 Ga0395899_0244007
613 Ga0395900_0036966
614 Ga0395905_0052262
615 Ga0436365_1726363
616 Ga0436361_0085803
617 Ga0436361_0823412
618 Ga0451577_0524113
619 Ga0453683_0131427
620 Ga0451576_0038323
621 Ga0451576_0119803
622 Ga0451576_0576034
623 Ga0495592_0004622
624 Ga0495628_0009950
625 Ga0495652_0123831
626 Ga0495587_0016929
627 Ga0495645_0007376
628 Ga0495667_0004241
629 Ga0495667_0046085
630 Ga0495635_0055299
631 Ga0495599_0009455
632 Ga0495599_0172635
633 Ga0495623_0006633
634 Ga0495604_0016539
635 Ga0495684_0091487
636 Ga0501067_0040310
637 Ga0501069_0005023
638 Ga0501070_0002752
639 Ga0501074_0001435
640 Ga0501209_004135
641 Ga0501079_0051527
642 Ga0501080_0002145
643 Ga0501083_0000252
644 Ga0501035_0078942
645 Ga0501044_0060290
646 Ga0501044_0125025
647 nmdc:mga0k408_18978_c1
648 nmdc:mga0k408_9027_c1
649 nmdc:mga05p37_85374_c1
650 nmdc:mga08y16_1258_c1
651 nmdc:mga0rr50_164052_c1
652 nmdc:mga08x19_35520_c1
653 nmdc:mga0a205_25032_c1
654 Ga0495601_0009545
655 Ga0495595_0007713
656 Ga0495619_0046329
657 Ga0501084_0157580
658 Ga0501082_0033317

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

55

197

0.97

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

115

230

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rvc-assembly1.cif.gz_A structure of atp binding subunit of abc transporter 0.942 4 224
7ahd-assembly1.cif.gz_D opua (e190q) occluded 0.9281 4 220
5lil-assembly1.cif.gz_B structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) 0.9279 3 217
5lj7-assembly1.cif.gz_B structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) 0.9277 3 217
8eop-assembly1.cif.gz_A cryo-em structure of nanodisc reconstituted human abca7 eq mutant in atp bound closed state 0.9227 2 223
ID Description Score Start End Superfamily
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9722 1 222 3.40.50.300
af_Q2FVB4_1_230_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9614 3 218 3.40.50.300
af_Q9VRG3_531_774_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9597 3 224 3.40.50.300
af_Q58429_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9535 1 219 3.40.50.300
af_P78363_1926_2175_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9521 2 223 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2E7MAK6-F1-model_v4 3-dehydroquinate dehydratase 0.9703 5 223 GO:0005524
GO:0016887
AF-A0A7C2IZ84-F1-model_v4 ABC transporter ATP-binding protein 0.9668 3 223 GO:0005524
GO:0016887
AF-A0A2N9NVS2-F1-model_v4 ABC transporter-related protein 0.9622 5 224 GO:0005524
GO:0016887
AF-A0A372UIB2-F1-model_v4 ABC transporter ATP-binding protein 0.9619 5 223 GO:0005524
GO:0016887
AF-A0A352BGW5-F1-model_v4 3-dehydroquinate dehydratase 0.9615 5 224 GO:0005524
GO:0016887

Map