F409673

General Info

Members Datasets Scaffolds Average Seq Length
329 201 658 317

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10405965|Ga0157379_104059652
Length 346
Sequence VKLKKKLQHQTFTKNSILQTQTLTVREALFIKKNKERWERVQHSPSSNPDEMARDFTQLVDDLAYAKTFYPSGKVTQYINSQASRIYLGIYKNKKEASSRILRFWKIELPLVVRRYHREILYAFIIFLLFAILAAFSAAHDETFVRGVLGDGYIEMTEDNIAKGDPFGVYKNGDQVSMFMFIAEHNIQVSFLVFVAGLFFSIGTVWLLFTNGVMLGAFQYYFFAKGLGWKSVLVIWIHGTLEISSIIIAGAAGLILGNSLLFPGTYKRIDSLKRGAKDGLKCLIGLVPIFITAAFLEGFVTRYATMPIWASISILTISLSFIIWYFVIYPIRVSKKIKLSSSSEKP

Samples

Sample ID Description Type Environment
1 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
84 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
85 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
88 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
132 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
138 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
139 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
140 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
143 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
144 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
145 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
146 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
151 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
154 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
155 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
164 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
185 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
186 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
187 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
188 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
189 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
190 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
191 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
192 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
193 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
194 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
197 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
198 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
199 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
200 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
201 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.18
Metatranscriptomes 0
Isolates 1.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.03
Nodule 0
Rhizoplane 0
Rhizosphere 83.89
Stem 0
Stem Tuber 0
Unclassified 9.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157379_10405965 3300014968 Bacteria 1253
2 MRS1b_contig_24268 2162886011 Bacteria 2254
3 JGI25154J39366_1000001 3300002738 Bacteria 483450
4 JGI25157J39369_1006806 3300002741 Bacteria 1704
5 rootH2_10101040 3300003320 Bacteria 2640
6 rootH2_10348254 3300003320 Bacteria 1055
7 rootL2_10044712 3300003322 Bacteria 4616
8 rootL2_10177018 3300003322 Bacteria 4636
9 rootH1_10009170 3300003323 Bacteria 4471
10 rootH1_10220434 3300003323 Unclassified 2357
11 rootH1_10352017 3300003323 Bacteria 3193
12 JGI25160J50197_1001169 3300003354 Bacteria 13382
13 JGI25160J50197_1010133 3300003354 Bacteria 3431
14 Ga0055526_1040807 3300003771 Unclassified 1165
15 Ga0055528_1002064 3300003790 Bacteria 11220
16 Ga0055530_10000393 3300003791 Bacteria 39108
17 Ga0065165_1000105 3300005262 Bacteria 140409
18 Ga0065165_1020153 3300005262 Bacteria 2357
19 Ga0065714_10087575 3300005288 Unclassified 2052
20 Ga0065704_10072793 3300005289 Bacteria 8003
21 Ga0065712_10091434 3300005290 Bacteria 2372
22 Ga0070658_10243964 3300005327 Bacteria 1523
23 Ga0070676_10007539 3300005328 Bacteria 5845
24 Ga0070676_10028012 3300005328 Bacteria 3199
25 Ga0070683_100066026 3300005329 Bacteria 3370
26 Ga0070683_100089910 3300005329 Bacteria 2882
27 Ga0070683_100104601 3300005329 Bacteria 2668
28 Ga0070690_100130618 3300005330 Unclassified 1696
29 Ga0068869_100033230 3300005334 Bacteria 3641
30 Ga0068869_100047770 3300005334 Bacteria 3092
31 Ga0070666_10001617 3300005335 Bacteria 13695
32 Ga0070682_100006447 3300005337 Bacteria 6597
33 Ga0070689_100020835 3300005340 Bacteria 4871
34 Ga0070691_10006462 3300005341 Bacteria 5359
35 Ga0070691_10010910 3300005341 Bacteria 4149
36 Ga0070691_10033343 3300005341 Bacteria 2423
37 Ga0070687_100027217 3300005343 Bacteria 2760
38 Ga0070668_100006287 3300005347 Bacteria 8791
39 Ga0070668_100037412 3300005347 Bacteria 3706
40 Ga0070669_100019758 3300005353 Unclassified 4813
41 Ga0070675_100066963 3300005354 Bacteria 2971
42 Ga0070673_100002312 3300005364 Bacteria 11581
43 Ga0070667_100000492 3300005367 Bacteria 40164
44 Ga0070713_100456541 3300005436 Bacteria 1201
45 Ga0070678_100129423 3300005456 Bacteria 2003
46 Ga0070678_100186365 3300005456 Bacteria 1703
47 Ga0070662_100007380 3300005457 Bacteria 7124
48 Ga0068867_100049229 3300005459 Bacteria 3102
49 Ga0068867_100107556 3300005459 Bacteria 2138
50 Ga0070698_100011755 3300005471 Bacteria 9287
51 Ga0070684_100010886 3300005535 Bacteria 7227
52 Ga0068853_100005363 3300005539 Bacteria 10041
53 Ga0068853_100086887 3300005539 Bacteria 2743
54 Ga0068853_100102269 3300005539 Bacteria 2535
55 Ga0068853_100242871 3300005539 Bacteria 1651
56 Ga0068853_100419769 3300005539 Unclassified 1254
57 Ga0070672_100002526 3300005543 Bacteria 11648
58 Ga0070672_100003897 3300005543 Bacteria 9722
59 Ga0070665_100000009 3300005548 Bacteria 562640
60 Ga0070665_100006195 3300005548 Bacteria 12241
61 Ga0068855_100001225 3300005563 Bacteria 31850
62 Ga0068855_100045831 3300005563 Bacteria 5170
63 Ga0068855_100049644 3300005563 Bacteria 4948
64 Ga0070664_100071975 3300005564 Bacteria 2964
65 Ga0068857_100001841 3300005577 Bacteria 17068
66 Ga0068857_100030524 3300005577 Bacteria 4759
67 Ga0068854_100154507 3300005578 Unclassified 1772
68 Ga0068856_100277270 3300005614 Bacteria 1693
69 Ga0068852_100000795 3300005616 Bacteria 20782
70 Ga0068852_100016877 3300005616 Bacteria 5711
71 Ga0068852_100044529 3300005616 Bacteria 3769
72 Ga0068852_100102139 3300005616 Bacteria 2590
73 Ga0068852_100262449 3300005616 Bacteria 1659
74 Ga0068852_100476042 3300005616 Bacteria 1240
75 Ga0068859_100032789 3300005617 Bacteria 5218
76 Ga0068864_100002625 3300005618 Bacteria 14840
77 Ga0068864_100398820 3300005618 Bacteria 1307
78 Ga0068861_100087754 3300005719 Bacteria 2448
79 Ga0068851_10003017 3300005834 Bacteria 7435
80 Ga0068870_10024293 3300005840 Bacteria 2998
81 Ga0068863_100012655 3300005841 Bacteria 8138
82 Ga0068858_100005957 3300005842 Bacteria 11905
83 Ga0068860_100000078 3300005843 Bacteria 171062
84 Ga0068860_100009128 3300005843 Bacteria 9864
85 Ga0075366_10013023 3300006195 Bacteria 4729
86 Ga0075366_10172695 3300006195 Bacteria 1312
87 Ga0097621_100210962 3300006237 Bacteria 1690
88 Ga0068871_100024189 3300006358 Bacteria 4707
89 Ga0068871_100083172 3300006358 Unclassified 2655
90 Ga0075431_100038869 3300006847 Bacteria 4902
91 Ga0075429_100018746 3300006880 Bacteria 5992
92 Ga0097620_100032787 3300006931 Bacteria 5218
93 Ga0097620_100197715 3300006931 Bacteria 2095
94 Ga0105240_10000263 3300009093 Bacteria 103973
95 Ga0105240_10001595 3300009093 Bacteria 38516
96 Ga0105240_10002139 3300009093 Bacteria 32274
97 Ga0105240_10002434 3300009093 Bacteria 29930
98 Ga0105240_10011818 3300009093 Bacteria 12124
99 Ga0111539_10010171 3300009094 Bacteria 11856
100 Ga0111539_10034513 3300009094 Bacteria 6133
101 Ga0105247_10098472 3300009101 Bacteria 1867
102 Ga0114129_10013499 3300009147 Bacteria 11641
103 Ga0105241_10000537 3300009174 Bacteria 28565
104 Ga0105241_10001444 3300009174 Bacteria 18210
105 Ga0105241_10079296 3300009174 Unclassified 2567
106 Ga0105242_10305768 3300009176 Bacteria 1453
107 Ga0105242_10401312 3300009176 Bacteria 1280
108 Ga0105237_10000113 3300009545 Bacteria 114034
109 Ga0105237_10003490 3300009545 Bacteria 18656
110 Ga0105237_10006520 3300009545 Bacteria 12919
111 Ga0105237_10085845 3300009545 Unclassified 3137
112 Ga0105237_10265355 3300009545 Bacteria 1720
113 Ga0105238_10003420 3300009551 Bacteria 15826
114 Ga0105238_10021601 3300009551 Bacteria 6556
115 Ga0105238_10051925 3300009551 Bacteria 4122
116 Ga0105238_10113128 3300009551 Bacteria 2694
117 Ga0105249_10027908 3300009553 Bacteria 5095
118 Ga0105249_10037036 3300009553 Bacteria 4427
119 Ga0105239_10000797 3300010375 Bacteria 44708
120 Ga0105239_10009432 3300010375 Bacteria 10998
121 Ga0105239_10021280 3300010375 Bacteria 7150
122 Ga0105239_10021360 3300010375 Bacteria 7137
123 Ga0105239_10075581 3300010375 Bacteria 3704
124 Ga0105239_10094296 3300010375 Unclassified 3306
125 Ga0105239_10355786 3300010375 Bacteria 1653
126 Ga0105239_10369483 3300010375 Bacteria 1621
127 Ga0157373_10146934 3300013100 Unclassified 1658
128 Ga0157371_10055398 3300013102 Bacteria 2814
129 Ga0157370_10002300 3300013104 Bacteria 23142
130 Ga0157370_10013600 3300013104 Bacteria 8375
131 Ga0157370_10020851 3300013104 Bacteria 6539
132 Ga0157369_10176058 3300013105 Bacteria 2252
133 Ga0157369_10283439 3300013105 Bacteria 1725
134 Ga0157374_10000002 3300013296 Bacteria 1054226
135 Ga0157374_10011507 3300013296 Bacteria 7667
136 Ga0157374_10024452 3300013296 Bacteria 5417
137 Ga0157374_10027927 3300013296 Bacteria 5094
138 Ga0157378_10193862 3300013297 Bacteria 1918
139 Ga0163162_10000341 3300013306 Bacteria 42456
140 Ga0163162_10001596 3300013306 Bacteria 21205
141 Ga0163162_10042448 3300013306 Bacteria 4552
142 Ga0157372_10000838 3300013307 Bacteria 33401
143 Ga0157372_10001435 3300013307 Bacteria 25757
144 Ga0157372_10019798 3300013307 Bacteria 7252
145 Ga0157372_10024945 3300013307 Bacteria 6498
146 Ga0157372_10032081 3300013307 Bacteria 5756
147 Ga0157372_10034673 3300013307 Bacteria 5551
148 Ga0157372_10156589 3300013307 Bacteria 2632
149 Ga0157372_10352187 3300013307 Bacteria 1715
150 Ga0157375_10007977 3300013308 Bacteria 9270
151 Ga0157375_10058652 3300013308 Bacteria 3809
152 Ga0157375_10157440 3300013308 Bacteria 2411
153 Ga0163163_10009008 3300014325 Bacteria 8892
154 Ga0157380_10001894 3300014326 Bacteria 13872
155 Ga0157380_10252195 3300014326 Bacteria 1598
156 Ga0157377_10004316 3300014745 Bacteria 6526
157 Ga0157379_10001301 3300014968 Bacteria 20316
158 Ga0157379_10033156 3300014968 Bacteria 4605
159 Ga0157376_10002054 3300014969 Bacteria 13503
160 Ga0209646_1000002 3300025246 Bacteria 1425781
161 Ga0209026_1000627 3300025250 Bacteria 22217
162 Ga0209673_1000096 3300025273 Bacteria 194819
163 Ga0209564_1006836 3300025295 Bacteria 6024
164 Ga0209564_1009150 3300025295 Bacteria 4762
165 Ga0209758_1005330 3300025297 Bacteria 10004
166 Ga0209758_1006375 3300025297 Bacteria 8521
167 Ga0209050_1000207 3300025298 Bacteria 131328
168 Ga0207426_1000009 3300025302 Bacteria 797229
169 Ga0207426_1000571 3300025302 Bacteria 49864
170 Ga0207426_1001112 3300025302 Bacteria 24702
171 Ga0207697_10040236 3300025315 Bacteria 1919
172 Ga0207656_10008985 3300025321 Bacteria 3703
173 Ga0207647_10005334 3300025904 Bacteria 9450
174 Ga0207645_10003861 3300025907 Bacteria 11216
175 Ga0207645_10028243 3300025907 Bacteria 3623
176 Ga0207705_10045028 3300025909 Bacteria 3172
177 Ga0207705_10052804 3300025909 Unclassified 2927
178 Ga0207654_10002512 3300025911 Bacteria 9323
179 Ga0207707_10000051 3300025912 Bacteria 117204
180 Ga0207695_10000016 3300025913 Bacteria 771991
181 Ga0207695_10000128 3300025913 Bacteria 226098
182 Ga0207695_10000296 3300025913 Bacteria 123322
183 Ga0207695_10017314 3300025913 Bacteria 8390
184 Ga0207695_10084186 3300025913 Bacteria 3211
185 Ga0207695_10127731 3300025913 Bacteria 2503
186 Ga0207671_10005552 3300025914 Bacteria 11590
187 Ga0207671_10200718 3300025914 Bacteria 1557
188 Ga0207660_10002571 3300025917 Bacteria 11922
189 Ga0207652_10000384 3300025921 Bacteria 46082
190 Ga0207681_10154128 3300025923 Bacteria 1725
191 Ga0207694_10018106 3300025924 Bacteria 5325
192 Ga0207650_10051307 3300025925 Bacteria 3052
193 Ga0207650_10108978 3300025925 Unclassified 2141
194 Ga0207659_10047897 3300025926 Bacteria 3025
195 Ga0207659_10056442 3300025926 Bacteria 2813
196 Ga0207706_10009946 3300025933 Bacteria 8718
197 Ga0207706_10071824 3300025933 Bacteria 3045
198 Ga0207670_10017121 3300025936 Bacteria 4374
199 Ga0207691_10000001 3300025940 Bacteria 220829
200 Ga0207689_10024584 3300025942 Bacteria 5053
201 Ga0207689_10196366 3300025942 Bacteria 1665
202 Ga0207661_10083862 3300025944 Bacteria 2638
203 Ga0207661_10085557 3300025944 Bacteria 2614
204 Ga0207667_10000143 3300025949 Bacteria 108717
205 Ga0207667_10000275 3300025949 Bacteria 71281
206 Ga0207667_10020057 3300025949 Bacteria 7443
207 Ga0207667_10099883 3300025949 Bacteria 2994
208 Ga0207651_10003677 3300025960 Bacteria 7578
209 Ga0207651_10038168 3300025960 Bacteria 3154
210 Ga0207712_10111605 3300025961 Bacteria 2052
211 Ga0207668_10000540 3300025972 Bacteria 23750
212 Ga0207640_10116970 3300025981 Unclassified 1902
213 Ga0207658_10000946 3300025986 Bacteria 23945
214 Ga0207677_10006862 3300026023 Bacteria 6258
215 Ga0207703_10001644 3300026035 Bacteria 20118
216 Ga0207639_10001509 3300026041 Bacteria 15642
217 Ga0207639_10017324 3300026041 Bacteria 5107
218 Ga0207639_10057641 3300026041 Unclassified 2984
219 Ga0207639_10128934 3300026041 Bacteria 2091
220 Ga0207702_10036132 3300026078 Unclassified 4132
221 Ga0207702_10230139 3300026078 Bacteria 1732
222 Ga0207648_10002506 3300026089 Bacteria 19710
223 Ga0207648_10197345 3300026089 Bacteria 1784
224 Ga0207676_10001871 3300026095 Bacteria 15411
225 Ga0207676_10364889 3300026095 Bacteria 1340
226 Ga0207674_10001433 3300026116 Bacteria 30815
227 Ga0207674_10073922 3300026116 Bacteria 3421
228 Ga0207675_100007111 3300026118 Bacteria 10578
229 Ga0207675_100070723 3300026118 Unclassified 3262
230 Ga0207683_10157407 3300026121 Unclassified 2052
231 Ga0207683_10173691 3300026121 Bacteria 1952
232 Ga0207698_10124311 3300026142 Bacteria 2190
233 Ga0207698_10177333 3300026142 Unclassified 1883
234 Ga0207698_10278376 3300026142 Unclassified 1546
235 Ga0207698_10391918 3300026142 Bacteria 1325
236 Ga0268266_10000014 3300028379 Bacteria 644033
237 Ga0268266_10008318 3300028379 Bacteria 9239
238 Ga0268265_10041680 3300028380 Bacteria 3400
239 Ga0268264_10000105 3300028381 Bacteria 212531
240 Ga0268264_10005175 3300028381 Bacteria 11053
241 Ga0268264_10006865 3300028381 Bacteria 9557
242 Ga0307515_10272024 3300028794 Bacteria 1414
243 Ga0265338_10019995 3300028800 Bacteria 7068
244 Ga0265338_10036027 3300028800 Bacteria 4744
245 Ga0307509_10053309 3300031507 Bacteria 4314
246 Ga0307516_10024872 3300031730 Bacteria 6109
247 Ga0307516_10062688 3300031730 Bacteria 3602
248 Ga0373937_0029713 3300036401 Bacteria 4951
249 Ga0373937_0253874 3300036401 Unclassified 1658
250 Ga0373925_0297374 3300037068 Bacteria 1303
251 Ga0395900_0475155 3300037418 Bacteria 1203
252 Ga0395905_0000001 3300037471 Bacteria 2037079
253 Ga0439436_0023101 3300041404 Bacteria 1840
254 Ga0439449_0043532 3300042007 Unclassified 1667
255 Ga0439457_000201 3300042014 Bacteria 15715
256 Ga0466972_0000064 3300044658 Bacteria 104558
257 Ga0466972_0000523 3300044658 Bacteria 18994
258 Ga0466972_0066066 3300044658 Bacteria 1729
259 Ga0466966_0123840 3300044684 Bacteria 1586
260 Ga0466961_0012025 3300044693 Bacteria 5530
261 Ga0466964_0081747 3300044706 Unclassified 1388
262 Ga0466971_0010759 3300044719 Bacteria 4003
263 Ga0466968_0018461 3300044735 Unclassified 2798
264 Ga0466970_0002271 3300044765 Bacteria 9286
265 Ga0466957_0047475 3300044842 Bacteria 2609
266 Ga0466959_0000111 3300045049 Bacteria 52637
267 Ga0466959_0000979 3300045049 Bacteria 16984
268 Ga0495629_0083433 3300046459 Bacteria 2230
269 Ga0495638_0069434 3300046460 Bacteria 2160
270 Ga0495651_0256483 3300046462 Bacteria 1192
271 Ga0495580_0109420 3300046472 Bacteria 1918
272 Ga0495630_0061855 3300046517 Bacteria 2812
273 Ga0495648_0001767 3300046524 Bacteria 20861
274 Ga0495586_0044389 3300046535 Bacteria 2395
275 Ga0495587_0195461 3300046536 Bacteria 1145
276 Ga0495667_0061769 3300046559 Bacteria 2456
277 Ga0495625_0107477 3300046660 Bacteria 1910
278 Ga0495635_0092401 3300046663 Bacteria 2069
279 Ga0495613_0166134 3300046689 Bacteria 1568
280 Ga0495581_0183139 3300047315 Bacteria 1225
281 Ga0495674_0006964 3300047319 Bacteria 10816
282 Ga0495676_0100217 3300047321 Bacteria 2145
283 Ga0495687_000056 3300047443 Bacteria 188227
284 Ga0495686_0000016 3300047472 Bacteria 443701
285 Ga0501031_0068586 3300049568 Unclassified 2310
286 Ga0501034_0051773 3300049571 Bacteria 4140
287 Ga0501034_0145087 3300049571 Bacteria 2351
288 Ga0501034_0492628 3300049571 Bacteria 1140
289 Ga0501036_0010850 3300049572 Bacteria 7527
290 Ga0501037_0040729 3300049573 Bacteria 3418
291 Ga0501037_0073705 3300049573 Bacteria 2482
292 Ga0501038_0082487 3300049574 Bacteria 2707
293 Ga0501039_0014238 3300049575 Bacteria 6089
294 Ga0501046_0062948 3300049580 Bacteria 2898
295 Ga0501047_0022507 3300049581 Bacteria 6053
296 Ga0501069_0068604 3300049585 Bacteria 1984
297 Ga0501071_0100808 3300049587 Bacteria 2129
298 Ga0501074_0149898 3300049590 Bacteria 1668
299 Ga0501080_0186448 3300049742 Unclassified 1907
300 Ga0501080_0407503 3300049742 Bacteria 1223
301 Ga0501083_0004582 3300049744 Bacteria 9765
302 Ga0501044_0014739 3300049823 Bacteria 8427
303 Ga0501044_0033506 3300049823 Bacteria 5398
304 Ga0501044_0034712 3300049823 Bacteria 5287
305 nmdc:mga0k408_37451_c1 3300050493 Bacteria 2785
306 nmdc:mga0k408_69601_c1 3300050493 Unclassified 2054
307 nmdc:mga05p37_8076_c1 3300050507 Bacteria 12434
308 nmdc:mga09592_203157_c1 3300050508 Unclassified 1716
309 nmdc:mga06r32_48860_c1 3300050510 Bacteria 4045
310 Ga0500635_0010643 3300053080 Bacteria 2591
311 Ga0500578_0001683 3300053086 Bacteria 21230
312 Ga0500583_0000031 3300053092 Bacteria 104319
313 Ga0500583_0000523 3300053092 Bacteria 11716
314 Ga0500642_0083783 3300053130 Bacteria 1467
315 Ga0500652_008642 3300053131 Bacteria 3405
316 Ga0500568_0017864 3300053139 Unclassified 3120
317 Ga0500568_0067807 3300053139 Bacteria 1370
318 Ga0500588_0120381 3300053146 Bacteria 925
319 Ga0500622_0005714 3300053156 Bacteria 7394
320 Ga0500624_000472 3300053157 Bacteria 11992
321 Ga0500639_108758 3300053163 Bacteria 1352
322 Ga0500636_0083565 3300053177 Bacteria 1837
323 Ga0501084_0041605 3300054114 Unclassified 3844
324 2840678610 2840677318 Bacteria 2664183
325 2884795771 2884791551 Bacteria 8511252
326 2896086428 2896085136 Bacteria 6129793
327 2896113271 2896109856 Bacteria 7140722
328 2929923060 2929921140 Bacteria 8649150
329 8003152397 8003151029 Bacteria 8187759
330 Ga0157379_10405965
331 MRS1b_contig_24268
332 JGI25154J39366_1000001
333 JGI25157J39369_1006806
334 rootH2_10101040
335 rootH2_10348254
336 rootL2_10044712
337 rootL2_10177018
338 rootH1_10009170
339 rootH1_10220434
340 rootH1_10352017
341 JGI25160J50197_1001169
342 JGI25160J50197_1010133
343 Ga0055526_1040807
344 Ga0055528_1002064
345 Ga0055530_10000393
346 Ga0065165_1000105
347 Ga0065165_1020153
348 Ga0065714_10087575
349 Ga0065704_10072793
350 Ga0065712_10091434
351 Ga0070658_10243964
352 Ga0070676_10007539
353 Ga0070676_10028012
354 Ga0070683_100066026
355 Ga0070683_100089910
356 Ga0070683_100104601
357 Ga0070690_100130618
358 Ga0068869_100033230
359 Ga0068869_100047770
360 Ga0070666_10001617
361 Ga0070682_100006447
362 Ga0070689_100020835
363 Ga0070691_10006462
364 Ga0070691_10010910
365 Ga0070691_10033343
366 Ga0070687_100027217
367 Ga0070668_100006287
368 Ga0070668_100037412
369 Ga0070669_100019758
370 Ga0070675_100066963
371 Ga0070673_100002312
372 Ga0070667_100000492
373 Ga0070713_100456541
374 Ga0070678_100129423
375 Ga0070678_100186365
376 Ga0070662_100007380
377 Ga0068867_100049229
378 Ga0068867_100107556
379 Ga0070698_100011755
380 Ga0070684_100010886
381 Ga0068853_100005363
382 Ga0068853_100086887
383 Ga0068853_100102269
384 Ga0068853_100242871
385 Ga0068853_100419769
386 Ga0070672_100002526
387 Ga0070672_100003897
388 Ga0070665_100000009
389 Ga0070665_100006195
390 Ga0068855_100001225
391 Ga0068855_100045831
392 Ga0068855_100049644
393 Ga0070664_100071975
394 Ga0068857_100001841
395 Ga0068857_100030524
396 Ga0068854_100154507
397 Ga0068856_100277270
398 Ga0068852_100000795
399 Ga0068852_100016877
400 Ga0068852_100044529
401 Ga0068852_100102139
402 Ga0068852_100262449
403 Ga0068852_100476042
404 Ga0068859_100032789
405 Ga0068864_100002625
406 Ga0068864_100398820
407 Ga0068861_100087754
408 Ga0068851_10003017
409 Ga0068870_10024293
410 Ga0068863_100012655
411 Ga0068858_100005957
412 Ga0068860_100000078
413 Ga0068860_100009128
414 Ga0075366_10013023
415 Ga0075366_10172695
416 Ga0097621_100210962
417 Ga0068871_100024189
418 Ga0068871_100083172
419 Ga0075431_100038869
420 Ga0075429_100018746
421 Ga0097620_100032787
422 Ga0097620_100197715
423 Ga0105240_10000263
424 Ga0105240_10001595
425 Ga0105240_10002139
426 Ga0105240_10002434
427 Ga0105240_10011818
428 Ga0111539_10010171
429 Ga0111539_10034513
430 Ga0105247_10098472
431 Ga0114129_10013499
432 Ga0105241_10000537
433 Ga0105241_10001444
434 Ga0105241_10079296
435 Ga0105242_10305768
436 Ga0105242_10401312
437 Ga0105237_10000113
438 Ga0105237_10003490
439 Ga0105237_10006520
440 Ga0105237_10085845
441 Ga0105237_10265355
442 Ga0105238_10003420
443 Ga0105238_10021601
444 Ga0105238_10051925
445 Ga0105238_10113128
446 Ga0105249_10027908
447 Ga0105249_10037036
448 Ga0105239_10000797
449 Ga0105239_10009432
450 Ga0105239_10021280
451 Ga0105239_10021360
452 Ga0105239_10075581
453 Ga0105239_10094296
454 Ga0105239_10355786
455 Ga0105239_10369483
456 Ga0157373_10146934
457 Ga0157371_10055398
458 Ga0157370_10002300
459 Ga0157370_10013600
460 Ga0157370_10020851
461 Ga0157369_10176058
462 Ga0157369_10283439
463 Ga0157374_10000002
464 Ga0157374_10011507
465 Ga0157374_10024452
466 Ga0157374_10027927
467 Ga0157378_10193862
468 Ga0163162_10000341
469 Ga0163162_10001596
470 Ga0163162_10042448
471 Ga0157372_10000838
472 Ga0157372_10001435
473 Ga0157372_10019798
474 Ga0157372_10024945
475 Ga0157372_10032081
476 Ga0157372_10034673
477 Ga0157372_10156589
478 Ga0157372_10352187
479 Ga0157375_10007977
480 Ga0157375_10058652
481 Ga0157375_10157440
482 Ga0163163_10009008
483 Ga0157380_10001894
484 Ga0157380_10252195
485 Ga0157377_10004316
486 Ga0157379_10001301
487 Ga0157379_10033156
488 Ga0157376_10002054
489 Ga0209646_1000002
490 Ga0209026_1000627
491 Ga0209673_1000096
492 Ga0209564_1006836
493 Ga0209564_1009150
494 Ga0209758_1005330
495 Ga0209758_1006375
496 Ga0209050_1000207
497 Ga0207426_1000009
498 Ga0207426_1000571
499 Ga0207426_1001112
500 Ga0207697_10040236
501 Ga0207656_10008985
502 Ga0207647_10005334
503 Ga0207645_10003861
504 Ga0207645_10028243
505 Ga0207705_10045028
506 Ga0207705_10052804
507 Ga0207654_10002512
508 Ga0207707_10000051
509 Ga0207695_10000016
510 Ga0207695_10000128
511 Ga0207695_10000296
512 Ga0207695_10017314
513 Ga0207695_10084186
514 Ga0207695_10127731
515 Ga0207671_10005552
516 Ga0207671_10200718
517 Ga0207660_10002571
518 Ga0207652_10000384
519 Ga0207681_10154128
520 Ga0207694_10018106
521 Ga0207650_10051307
522 Ga0207650_10108978
523 Ga0207659_10047897
524 Ga0207659_10056442
525 Ga0207706_10009946
526 Ga0207706_10071824
527 Ga0207670_10017121
528 Ga0207691_10000001
529 Ga0207689_10024584
530 Ga0207689_10196366
531 Ga0207661_10083862
532 Ga0207661_10085557
533 Ga0207667_10000143
534 Ga0207667_10000275
535 Ga0207667_10020057
536 Ga0207667_10099883
537 Ga0207651_10003677
538 Ga0207651_10038168
539 Ga0207712_10111605
540 Ga0207668_10000540
541 Ga0207640_10116970
542 Ga0207658_10000946
543 Ga0207677_10006862
544 Ga0207703_10001644
545 Ga0207639_10001509
546 Ga0207639_10017324
547 Ga0207639_10057641
548 Ga0207639_10128934
549 Ga0207702_10036132
550 Ga0207702_10230139
551 Ga0207648_10002506
552 Ga0207648_10197345
553 Ga0207676_10001871
554 Ga0207676_10364889
555 Ga0207674_10001433
556 Ga0207674_10073922
557 Ga0207675_100007111
558 Ga0207675_100070723
559 Ga0207683_10157407
560 Ga0207683_10173691
561 Ga0207698_10124311
562 Ga0207698_10177333
563 Ga0207698_10278376
564 Ga0207698_10391918
565 Ga0268266_10000014
566 Ga0268266_10008318
567 Ga0268265_10041680
568 Ga0268264_10000105
569 Ga0268264_10005175
570 Ga0268264_10006865
571 Ga0307515_10272024
572 Ga0265338_10019995
573 Ga0265338_10036027
574 Ga0307509_10053309
575 Ga0307516_10024872
576 Ga0307516_10062688
577 Ga0373937_0029713
578 Ga0373937_0253874
579 Ga0373925_0297374
580 Ga0395900_0475155
581 Ga0395905_0000001
582 Ga0439436_0023101
583 Ga0439449_0043532
584 Ga0439457_000201
585 Ga0466972_0000064
586 Ga0466972_0000523
587 Ga0466972_0066066
588 Ga0466966_0123840
589 Ga0466961_0012025
590 Ga0466964_0081747
591 Ga0466971_0010759
592 Ga0466968_0018461
593 Ga0466970_0002271
594 Ga0466957_0047475
595 Ga0466959_0000111
596 Ga0466959_0000979
597 Ga0495629_0083433
598 Ga0495638_0069434
599 Ga0495651_0256483
600 Ga0495580_0109420
601 Ga0495630_0061855
602 Ga0495648_0001767
603 Ga0495586_0044389
604 Ga0495587_0195461
605 Ga0495667_0061769
606 Ga0495625_0107477
607 Ga0495635_0092401
608 Ga0495613_0166134
609 Ga0495581_0183139
610 Ga0495674_0006964
611 Ga0495676_0100217
612 Ga0495687_000056
613 Ga0495686_0000016
614 Ga0501031_0068586
615 Ga0501034_0051773
616 Ga0501034_0145087
617 Ga0501034_0492628
618 Ga0501036_0010850
619 Ga0501037_0040729
620 Ga0501037_0073705
621 Ga0501038_0082487
622 Ga0501039_0014238
623 Ga0501046_0062948
624 Ga0501047_0022507
625 Ga0501069_0068604
626 Ga0501071_0100808
627 Ga0501074_0149898
628 Ga0501080_0186448
629 Ga0501080_0407503
630 Ga0501083_0004582
631 Ga0501044_0014739
632 Ga0501044_0033506
633 Ga0501044_0034712
634 nmdc:mga0k408_37451_c1
635 nmdc:mga0k408_69601_c1
636 nmdc:mga05p37_8076_c1
637 nmdc:mga09592_203157_c1
638 nmdc:mga06r32_48860_c1
639 Ga0500635_0010643
640 Ga0500578_0001683
641 Ga0500583_0000031
642 Ga0500583_0000523
643 Ga0500642_0083783
644 Ga0500652_008642
645 Ga0500568_0017864
646 Ga0500568_0067807
647 Ga0500588_0120381
648 Ga0500622_0005714
649 Ga0500624_000472
650 Ga0500639_108758
651 Ga0500636_0083565
652 Ga0501084_0041605
653 2840678610
654 2884795771
655 2896086428
656 2896113271
657 2929923060
658 8003152397

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01944

SpoIIM

Stage II sporulation protein M

123

302

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tcd-assembly1.cif.gz_A lov2-darpin fusion: d13 0.3737 150 265
7o3v-assembly1.cif.gz_I stalk complex structure (trwj/virb5-trwi/virb6) from the fully-assembled r388 type iv secretion system determined by cryo-em. 0.3681 107 307
7o3v-assembly1.cif.gz_I stalk complex structure (trwj/virb5-trwi/virb6) from the fully-assembled r388 type iv secretion system determined by cryo-em. 0.3576 107 307
3aou-assembly1.cif.gz_B structure of the na+ unbound rotor ring modified with n,n f-dicyclohexylcarbodiimide of the na+-transporting v-atpase 0.3413 144 307
3aou-assembly1.cif.gz_B structure of the na+ unbound rotor ring modified with n,n f-dicyclohexylcarbodiimide of the na+-transporting v-atpase 0.3381 144 307
ID Description Score Start End Superfamily
af_O69662_1_106_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.6739 1 94 1.20.120.330
af_O69662_1_106_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.602 1 94 1.20.120.330
af_Q2FXS3_1_94_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4051 164 270 1.10.1760.20
af_Q2FXS3_1_94_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.3775 164 270 1.10.1760.20
af_P47987_32_160_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3704 154 268 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A432IEX6-F1-model_v4 Stage II sporulation protein M 0.9728 148 316 GO:0016020
AF-A0A642C545-F1-model_v4 Stage II sporulation protein M 0.9705 162 304 GO:0016020
AF-A0A4Q3SK05-F1-model_v4 Stage II sporulation protein M 0.9659 87 311 GO:0016020
AF-A0A520B1X1-F1-model_v4 Stage II sporulation protein M 0.9612 105 311 GO:0016020
AF-A0A0M3CFY5-F1-model_v4 deleted 0.9595 98 310

Map