F409941

General Info

Members Datasets Scaffolds Average Seq Length
330 148 330 195

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10488834|Ga0065715_104888341
Length 218
Sequence MGGASFVGGAALALREHFGKGARMTENSQPPRRNLKQVRILLWVLVALAVAGAAAILLYPRGQANPLTETEVVSAKAGFGGPFSLVGAIYFGYTRCGDVCPITLGRLVKLRKQAGDEGKLNIVFVTIDPANDGPKEVGQYADLFGSPIIGLTGSKMQIDQIKKQYGIYAEPEPMTGGGMKMNHTATVLLFDRDEKLAGTITTDEPDSAALAKVKRLAT

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
119 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
131 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
134 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
147 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
148 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.15
Rhizosphere 94.85
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002212 3300001979 Bacteria 8890
2 JGI24735J21928_10006309 3300002067 Bacteria 3912
3 Ga0065715_10284194 3300005293 Bacteria 1079
4 Ga0065715_10488834 3300005293 Bacteria 781
5 Ga0070658_10165719 3300005327 Bacteria 1855
6 Ga0070658_10489515 3300005327 Bacteria 1062
7 Ga0070658_10586853 3300005327 Bacteria 965
8 Ga0070658_10816128 3300005327 Unclassified 810
9 Ga0070658_10960279 3300005327 Unclassified 743
10 Ga0070670_100050123 3300005331 Bacteria 3588
11 Ga0070670_100150037 3300005331 Bacteria 2017
12 Ga0068869_100085328 3300005334 Bacteria 2365
13 Ga0070666_10007473 3300005335 Bacteria 6735
14 Ga0070666_10060880 3300005335 Bacteria 2555
15 Ga0070680_100004760 3300005336 Bacteria 10216
16 Ga0070680_100130373 3300005336 Bacteria 2103
17 Ga0070680_100398126 3300005336 Bacteria 1174
18 Ga0068868_100030214 3300005338 Bacteria 4154
19 Ga0068868_100282163 3300005338 Bacteria 1406
20 Ga0070660_100003837 3300005339 Bacteria 10378
21 Ga0070660_100004058 3300005339 Bacteria 10100
22 Ga0070660_100049108 3300005339 Bacteria 3243
23 Ga0070660_100084179 3300005339 Bacteria 2499
24 Ga0070660_100308010 3300005339 Bacteria 1299
25 Ga0070661_100034767 3300005344 Bacteria 3656
26 Ga0070661_100264441 3300005344 Bacteria 1330
27 Ga0070661_100271386 3300005344 Bacteria 1314
28 Ga0070661_100367587 3300005344 Bacteria 1132
29 Ga0070692_10002274 3300005345 Bacteria 7377
30 Ga0070668_100018273 3300005347 Bacteria 5261
31 Ga0070668_100087663 3300005347 Bacteria 2449
32 Ga0070668_100111139 3300005347 Bacteria 2181
33 Ga0070668_100350233 3300005347 Bacteria 1250
34 Ga0070669_100067133 3300005353 Bacteria 2645
35 Ga0070669_100078012 3300005353 Bacteria 2461
36 Ga0070669_100220323 3300005353 Bacteria 1500
37 Ga0070669_100226406 3300005353 Bacteria 1480
38 Ga0070669_100481445 3300005353 Bacteria 1027
39 Ga0070675_100317825 3300005354 Bacteria 1375
40 Ga0070675_100379314 3300005354 Bacteria 1258
41 Ga0070671_100017725 3300005355 Bacteria 5772
42 Ga0070671_100036819 3300005355 Bacteria 4057
43 Ga0070671_100055990 3300005355 Bacteria 3281
44 Ga0070671_100119394 3300005355 Bacteria 2218
45 Ga0070674_100432315 3300005356 Bacteria 1083
46 Ga0070673_100276156 3300005364 Bacteria 1472
47 Ga0070673_100329530 3300005364 Bacteria 1350
48 Ga0070659_100000470 3300005366 Bacteria 29706
49 Ga0070659_100007854 3300005366 Bacteria 7768
50 Ga0070659_100221796 3300005366 Bacteria 1561
51 Ga0070659_100243698 3300005366 Bacteria 1488
52 Ga0070667_100033149 3300005367 Bacteria 4314
53 Ga0070667_100081192 3300005367 Bacteria 2774
54 Ga0070667_100095143 3300005367 Bacteria 2567
55 Ga0070667_100576923 3300005367 Bacteria 1035
56 Ga0070714_100024983 3300005435 Bacteria 4926
57 Ga0070694_100001237 3300005444 Bacteria 14786
58 Ga0070663_100021214 3300005455 Bacteria 4317
59 Ga0070663_100118286 3300005455 Bacteria 1999
60 Ga0070663_100479876 3300005455 Bacteria 1029
61 Ga0070662_100000794 3300005457 Bacteria 19386
62 Ga0070662_100304301 3300005457 Bacteria 1296
63 Ga0070681_10456529 3300005458 Bacteria 1190
64 Ga0068867_100135185 3300005459 Bacteria 1921
65 Ga0070679_100010435 3300005530 Bacteria 8812
66 Ga0070679_100154426 3300005530 Bacteria 2271
67 Ga0068853_100015449 3300005539 Bacteria 6272
68 Ga0068853_100024968 3300005539 Bacteria 5015
69 Ga0068853_100097772 3300005539 Bacteria 2592
70 Ga0068853_100790996 3300005539 Bacteria 908
71 Ga0070672_100025320 3300005543 Bacteria 4398
72 Ga0070672_100034874 3300005543 Bacteria 3821
73 Ga0070686_100194405 3300005544 Bacteria 1450
74 Ga0070693_100011018 3300005547 Bacteria 4545
75 Ga0070693_100208907 3300005547 Bacteria 1273
76 Ga0070665_100150199 3300005548 Unclassified 2332
77 Ga0070704_100057928 3300005549 Bacteria 2758
78 Ga0068855_100061773 3300005563 Bacteria 4376
79 Ga0068855_100098452 3300005563 Bacteria 3369
80 Ga0068855_100111790 3300005563 Bacteria 3136
81 Ga0070664_100003122 3300005564 Bacteria 13393
82 Ga0070664_100005157 3300005564 Bacteria 10487
83 Ga0070664_100330558 3300005564 Bacteria 1383
84 Ga0070664_100465391 3300005564 Bacteria 1162
85 Ga0070664_100858308 3300005564 Bacteria 850
86 Ga0068857_100022975 3300005577 Bacteria 5484
87 Ga0068857_100055085 3300005577 Bacteria 3529
88 Ga0068857_100098782 3300005577 Bacteria 2618
89 Ga0068857_100260847 3300005577 Bacteria 1590
90 Ga0068854_100353865 3300005578 Bacteria 1203
91 Ga0068856_100029714 3300005614 Bacteria 5338
92 Ga0068856_100167947 3300005614 Bacteria 2205
93 Ga0068856_100344058 3300005614 Bacteria 1510
94 Ga0068856_100374923 3300005614 Bacteria 1442
95 Ga0068852_100025191 3300005616 Bacteria 4817
96 Ga0068852_100343799 3300005616 Bacteria 1455
97 Ga0068852_100365382 3300005616 Bacteria 1412
98 Ga0068852_100411318 3300005616 Bacteria 1332
99 Ga0068852_100591974 3300005616 Bacteria 1113
100 Ga0068859_100070179 3300005617 Bacteria 3539
101 Ga0068859_100268961 3300005617 Bacteria 1796
102 Ga0068859_100382140 3300005617 Bacteria 1504
103 Ga0068864_100023140 3300005618 Bacteria 5217
104 Ga0068864_100188292 3300005618 Bacteria 1890
105 Ga0068864_100385331 3300005618 Bacteria 1329
106 Ga0068863_100189122 3300005841 Bacteria 1978
107 Ga0068858_100021048 3300005842 Bacteria 6092
108 Ga0068858_100048649 3300005842 Bacteria 3927
109 Ga0068860_100004969 3300005843 Bacteria 13552
110 Ga0068860_100047015 3300005843 Bacteria 4113
111 Ga0068860_100167435 3300005843 Bacteria 2122
112 Ga0068860_100927086 3300005843 Bacteria 888
113 Ga0068862_100034412 3300005844 Bacteria 4286
114 Ga0097621_100074543 3300006237 Bacteria 2811
115 Ga0097621_100135221 3300006237 Bacteria 2102
116 Ga0097621_100419678 3300006237 Bacteria 1201
117 Ga0068871_100134006 3300006358 Bacteria 2102
118 Ga0068871_100395753 3300006358 Bacteria 1229
119 Ga0075431_100247705 3300006847 Bacteria 1811
120 Ga0075434_100625162 3300006871 Bacteria 1096
121 Ga0097620_100070178 3300006931 Bacteria 3539
122 Ga0097620_100268958 3300006931 Bacteria 1796
123 Ga0097620_100382120 3300006931 Bacteria 1504
124 Ga0075435_100490573 3300007076 Bacteria 1062
125 Ga0105251_10074126 3300009011 Bacteria 1581
126 Ga0105245_11113914 3300009098 Bacteria 836
127 Ga0105247_10477541 3300009101 Bacteria 904
128 Ga0105243_10010659 3300009148 Bacteria 6971
129 Ga0105242_10167332 3300009176 Bacteria 1929
130 Ga0105248_10008543 3300009177 Bacteria 11242
131 Ga0105237_10635029 3300009545 Bacteria 1075
132 Ga0105238_10076804 3300009551 Bacteria 3332
133 Ga0105238_10709560 3300009551 Bacteria 1018
134 Ga0105249_10001260 3300009553 Bacteria 22219
135 Ga0105239_10016097 3300010375 Bacteria 8273
136 Ga0105246_10030026 3300011119 Bacteria 3586
137 Ga0105246_10062125 3300011119 Bacteria 2601
138 Ga0157373_10017025 3300013100 Bacteria 5292
139 Ga0157373_10032249 3300013100 Bacteria 3771
140 Ga0157373_10328430 3300013100 Unclassified 1089
141 Ga0157373_10334146 3300013100 Bacteria 1079
142 Ga0157373_10751432 3300013100 Unclassified 717
143 Ga0157371_10037049 3300013102 Bacteria 3493
144 Ga0157371_10165666 3300013102 Bacteria 1578
145 Ga0157371_10178824 3300013102 Bacteria 1517
146 Ga0157371_10391483 3300013102 Bacteria 1016
147 Ga0157370_10004683 3300013104 Bacteria 15605
148 Ga0157369_10279423 3300013105 Bacteria 1739
149 Ga0163162_10115638 3300013306 Bacteria 2783
150 Ga0157372_10377410 3300013307 Bacteria 1652
151 Ga0157372_10746824 3300013307 Bacteria 1138
152 Ga0157372_10962641 3300013307 Bacteria 989
153 Ga0157375_10002742 3300013308 Bacteria 15223
154 Ga0163163_10204812 3300014325 Bacteria 2021
155 Ga0157377_10063067 3300014745 Bacteria 2122
156 Ga0157379_10022322 3300014968 Bacteria 5607
157 Ga0157379_10344015 3300014968 Bacteria 1364
158 Ga0157379_10362706 3300014968 Bacteria 1328
159 Ga0157376_10833546 3300014969 Unclassified 937
160 Ga0163161_10010948 3300017792 Bacteria 6285
161 Ga0207680_10259672 3300025903 Bacteria 1202
162 Ga0207647_10000509 3300025904 Bacteria 31126
163 Ga0207647_10196292 3300025904 Bacteria 1168
164 Ga0207645_10075845 3300025907 Bacteria 2152
165 Ga0207705_10001418 3300025909 Bacteria 19073
166 Ga0207705_10061849 3300025909 Bacteria 2705
167 Ga0207705_10112604 3300025909 Bacteria 2012
168 Ga0207707_10075362 3300025912 Bacteria 2943
169 Ga0207707_10249630 3300025912 Bacteria 1541
170 Ga0207707_10264900 3300025912 Bacteria 1490
171 Ga0207671_10405744 3300025914 Bacteria 1084
172 Ga0207660_10003939 3300025917 Bacteria 9669
173 Ga0207660_10279003 3300025917 Bacteria 1326
174 Ga0207657_10001882 3300025919 Bacteria 22683
175 Ga0207657_10004489 3300025919 Bacteria 14750
176 Ga0207657_10015077 3300025919 Bacteria 7506
177 Ga0207657_10015690 3300025919 Bacteria 7327
178 Ga0207657_10023372 3300025919 Bacteria 5756
179 Ga0207657_10100009 3300025919 Bacteria 2408
180 Ga0207657_10123771 3300025919 Bacteria 2125
181 Ga0207649_10009802 3300025920 Bacteria 5248
182 Ga0207649_10132745 3300025920 Bacteria 1694
183 Ga0207652_10012949 3300025921 Bacteria 6747
184 Ga0207652_10325748 3300025921 Bacteria 1387
185 Ga0207652_10690429 3300025921 Bacteria 911
186 Ga0207681_10036842 3300025923 Bacteria 3229
187 Ga0207681_10066188 3300025923 Bacteria 2501
188 Ga0207650_10009400 3300025925 Bacteria 6682
189 Ga0207650_10076630 3300025925 Bacteria 2526
190 Ga0207659_10067446 3300025926 Bacteria 2599
191 Ga0207659_10122095 3300025926 Unclassified 1997
192 Ga0207659_10372630 3300025926 Bacteria 1189
193 Ga0207664_10033402 3300025929 Bacteria 3952
194 Ga0207644_10060313 3300025931 Bacteria 2745
195 Ga0207644_10362301 3300025931 Bacteria 1179
196 Ga0207690_10001059 3300025932 Bacteria 17615
197 Ga0207690_10091002 3300025932 Bacteria 2155
198 Ga0207690_10362617 3300025932 Bacteria 1148
199 Ga0207706_10017644 3300025933 Bacteria 6431
200 Ga0207706_10020718 3300025933 Bacteria 5907
201 Ga0207706_10025153 3300025933 Bacteria 5337
202 Ga0207706_10043029 3300025933 Bacteria 4003
203 Ga0207706_10126034 3300025933 Bacteria 2252
204 Ga0207706_10379798 3300025933 Bacteria 1226
205 Ga0207686_10018526 3300025934 Bacteria 3943
206 Ga0207669_10374287 3300025937 Bacteria 1108
207 Ga0207669_10672661 3300025937 Unclassified 848
208 Ga0207691_10020611 3300025940 Bacteria 6233
209 Ga0207691_10048964 3300025940 Bacteria 3872
210 Ga0207711_10029094 3300025941 Bacteria 4657
211 Ga0207711_10889354 3300025941 Bacteria 828
212 Ga0207689_10013609 3300025942 Bacteria 6937
213 Ga0207689_10030204 3300025942 Bacteria 4516
214 Ga0207661_10119042 3300025944 Bacteria 2246
215 Ga0207679_10008390 3300025945 Bacteria 6580
216 Ga0207679_10032960 3300025945 Bacteria 3642
217 Ga0207679_10256756 3300025945 Bacteria 1489
218 Ga0207679_10515977 3300025945 Bacteria 1068
219 Ga0207667_10094639 3300025949 Bacteria 3084
220 Ga0207667_10646511 3300025949 Bacteria 1063
221 Ga0207651_10107176 3300025960 Bacteria 2088
222 Ga0207651_10284176 3300025960 Bacteria 1369
223 Ga0207712_10000280 3300025961 Bacteria 48628
224 Ga0207712_10162399 3300025961 Bacteria 1738
225 Ga0207668_10006892 3300025972 Bacteria 6742
226 Ga0207668_10318780 3300025972 Bacteria 1289
227 Ga0207668_10330862 3300025972 Bacteria 1267
228 Ga0207668_10433990 3300025972 Bacteria 1118
229 Ga0207640_10631571 3300025981 Bacteria 910
230 Ga0207658_10114257 3300025986 Bacteria 2140
231 Ga0207658_10495171 3300025986 Bacteria 1088
232 Ga0207658_10540959 3300025986 Bacteria 1041
233 Ga0207677_10009893 3300026023 Bacteria 5376
234 Ga0207677_10364810 3300026023 Bacteria 1214
235 Ga0207703_10001844 3300026035 Bacteria 18887
236 Ga0207703_10071242 3300026035 Bacteria 2871
237 Ga0207703_10655276 3300026035 Bacteria 996
238 Ga0207639_10039350 3300026041 Bacteria 3523
239 Ga0207639_10213127 3300026041 Bacteria 1664
240 Ga0207639_10582436 3300026041 Bacteria 1030
241 Ga0207678_10000961 3300026067 Bacteria 26351
242 Ga0207678_10008848 3300026067 Bacteria 8864
243 Ga0207678_10011057 3300026067 Bacteria 7929
244 Ga0207678_10031483 3300026067 Bacteria 4628
245 Ga0207678_10337900 3300026067 Bacteria 1297
246 Ga0207702_10113847 3300026078 Bacteria 2410
247 Ga0207702_10133931 3300026078 Bacteria 2233
248 Ga0207702_10348274 3300026078 Bacteria 1417
249 Ga0207641_10096187 3300026088 Bacteria 2600
250 Ga0207648_10164911 3300026089 Bacteria 1958
251 Ga0207676_10337734 3300026095 Bacteria 1388
252 Ga0207676_10494450 3300026095 Bacteria 1160
253 Ga0207676_10565829 3300026095 Bacteria 1088
254 Ga0207674_10002193 3300026116 Bacteria 24722
255 Ga0207674_10005941 3300026116 Bacteria 14439
256 Ga0207674_10010652 3300026116 Bacteria 10396
257 Ga0207674_10023477 3300026116 Bacteria 6605
258 Ga0207674_10261344 3300026116 Bacteria 1678
259 Ga0207698_10061135 3300026142 Bacteria 2934
260 Ga0207698_10792464 3300026142 Bacteria 949
261 Ga0268266_10129743 3300028379 Unclassified 2253
262 Ga0268265_10019969 3300028380 Bacteria 4667
263 Ga0268265_10063244 3300028380 Bacteria 2846
264 Ga0268265_10250459 3300028380 Bacteria 1568
265 Ga0268264_10000750 3300028381 Bacteria 36591
266 Ga0268264_10147018 3300028381 Bacteria 2109
267 Ga0268264_10335115 3300028381 Bacteria 1435
268 Ga0316181_1068800 3300030744 Bacteria 1386
269 Ga0316182_1423338 3300030745 Bacteria 1456
270 Ga0307409_100086219 3300031995 Bacteria 2555
271 Ga0395899_0017607 3300037312 Bacteria 5441
272 Ga0395899_0140762 3300037312 Bacteria 1716
273 Ga0395899_0160748 3300037312 Bacteria 1587
274 Ga0395899_0169035 3300037312 Bacteria 1540
275 Ga0395899_0201478 3300037312 Bacteria 1387
276 Ga0395899_0413095 3300037312 Bacteria 891
277 Ga0395900_0080760 3300037418 Bacteria 3341
278 Ga0395900_0322727 3300037418 Bacteria 1524
279 Ga0395900_0445126 3300037418 Bacteria 1252
280 Ga0395898_0009100 3300037466 Bacteria 10459
281 Ga0395898_0076639 3300037466 Bacteria 3228
282 Ga0395898_0150293 3300037466 Bacteria 2229
283 Ga0395898_0193716 3300037466 Bacteria 1942
284 Ga0395898_0417622 3300037466 Bacteria 1279
285 Ga0395898_0613601 3300037466 Unclassified 1030
286 Ga0395898_0690655 3300037466 Unclassified 962
287 Ga0395905_0004819 3300037471 Bacteria 13919
288 Ga0395905_0015344 3300037471 Bacteria 7282
289 Ga0395905_0043165 3300037471 Bacteria 4230
290 Ga0395905_0065656 3300037471 Bacteria 3397
291 Ga0395905_0098700 3300037471 Bacteria 2743
292 Ga0395905_0385579 3300037471 Unclassified 1295
293 Ga0395905_0636799 3300037471 Bacteria 968
294 Ga0395901_0000203 3300038443 Bacteria 74605
295 Ga0395901_0062793 3300038443 Bacteria 3865
296 Ga0395901_0072457 3300038443 Bacteria 3591
297 Ga0395901_0076348 3300038443 Bacteria 3495
298 Ga0395901_0271001 3300038443 Bacteria 1765
299 Ga0395901_0602494 3300038443 Unclassified 1107
300 Ga0439432_065689 3300042006 Bacteria 1112
301 Ga0466963_0020901 3300044694 Bacteria 4122
302 Ga0466958_0027710 3300045836 Bacteria 3354
303 Ga0466967_0022870 3300045976 Bacteria 5111
304 Ga0466967_0043794 3300045976 Bacteria 3877
305 Ga0495663_0091899 3300046525 Bacteria 990
306 Ga0495669_0001406 3300046684 Bacteria 9900
307 Ga0495669_0060666 3300046684 Bacteria 1710
308 Ga0496101_0077552 3300048904 Bacteria 2449
309 Ga0496102_0540010 3300048905 Bacteria 1088
310 Ga0496103_0011488 3300048906 Bacteria 5247
311 Ga0496106_0232577 3300048909 Bacteria 1472
312 Ga0496108_0454782 3300048911 Bacteria 1119
313 Ga0496108_0516402 3300048911 Bacteria 1043
314 Ga0496109_0128594 3300048912 Bacteria 2363
315 Ga0496109_0135054 3300048912 Bacteria 2304
316 Ga0496110_0015428 3300048913 Bacteria 6358
317 Ga0496110_0287044 3300048913 Bacteria 1498
318 Ga0496110_0661285 3300048913 Bacteria 945
319 Ga0496111_0056683 3300048914 Bacteria 2835
320 Ga0496112_0055834 3300048915 Bacteria 3885
321 Ga0496112_0349295 3300048915 Bacteria 1421
322 Ga0496113_0039346 3300048916 Bacteria 3480
323 Ga0496113_0041651 3300048916 Bacteria 3390
324 Ga0496114_0151262 3300048917 Bacteria 2013
325 Ga0501034_0220370 3300049571 Bacteria 1850
326 nmdc:mga06r32_789091_c1 3300050510 Unclassified 911
327 nmdc:mga08y16_944894_c1 3300050511 Bacteria 845
328 nmdc:mga0n895_775618_c1 3300050512 Bacteria 950
329 nmdc:mga0rr50_150014_c1 3300050513 Bacteria 1883
330 nmdc:mga0a205_1958_c1 3300050515 Bacteria 17919

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009177 Ga0105248_10008543 Ga0105248_100085435 169
2 3300013306 Ga0163162_10115638 Ga0163162_101156383 169
3 3300013308 Ga0157375_10002742 Ga0157375_100027427 169
4 3300048904 Ga0496101_0077552 Ga0496101_0077552_1558_2115 169
5 3300048911 Ga0496108_0516402 Ga0496108_0516402_163_720 169
6 3300048912 Ga0496109_0128594 Ga0496109_0128594_1647_2204 169
7 3300048913 Ga0496110_0015428 Ga0496110_0015428_5567_6124 169
8 3300048917 Ga0496114_0151262 Ga0496114_0151262_985_1542 169
9 3300005354 Ga0070675_100379314 Ga0070675_1003793141 177
10 3300005347 Ga0070668_100087663 Ga0070668_1000876633 178
11 3300005353 Ga0070669_100226406 Ga0070669_1002264063 178
12 3300005355 Ga0070671_100036819 Ga0070671_1000368194 178
13 3300005364 Ga0070673_100276156 Ga0070673_1002761562 178
14 3300005457 Ga0070662_100304301 Ga0070662_1003043012 178
15 3300005539 Ga0068853_100024968 Ga0068853_1000249683 178
16 3300005543 Ga0070672_100025320 Ga0070672_1000253205 178
17 3300006358 Ga0068871_100395753 Ga0068871_1003957532 178
18 3300017792 Ga0163161_10010948 Ga0163161_100109484 178
19 3300025931 Ga0207644_10060313 Ga0207644_100603133 178
20 3300025941 Ga0207711_10029094 Ga0207711_100290945 178
21 3300026041 Ga0207639_10039350 Ga0207639_100393503 178
22 3300030744 Ga0316181_1068800 Ga0316181_10688002 178
23 3300030745 Ga0316182_1423338 Ga0316182_14233382 178
24 3300037312 Ga0395899_0413095 Ga0395899_0413095_182_763 178
25 3300037466 Ga0395898_0417622 Ga0395898_0417622_182_763 178
26 3300037471 Ga0395905_0636799 Ga0395905_0636799_365_946 178
27 3300042006 Ga0439432_065689 Ga0439432_065689_116_709 178
28 3300046684 Ga0495669_0060666 Ga0495669_0060666_230_817 178
29 3300005327 Ga0070658_10960279 Ga0070658_109602791 179
30 3300031995 Ga0307409_100086219 Ga0307409_1000862193 179
31 3300037312 Ga0395899_0169035 Ga0395899_0169035_231_815 179
32 3300037466 Ga0395898_0690655 Ga0395898_0690655_231_815 179
33 3300038443 Ga0395901_0062793 Ga0395901_0062793_3051_3635 179
34 3300038443 Ga0395901_0072457 Ga0395901_0072457_337_918 179
35 3300048915 Ga0496112_0349295 Ga0496112_0349295_634_1215 179
36 3300048916 Ga0496113_0041651 Ga0496113_0041651_2078_2659 179
37 3300005577 Ga0068857_100098782 Ga0068857_1000987823 180
38 3300026078 Ga0207702_10348274 Ga0207702_103482742 180
39 3300005455 Ga0070663_100118286 Ga0070663_1001182863 181
40 3300006237 Ga0097621_100074543 Ga0097621_1000745432 181
41 3300025933 Ga0207706_10379798 Ga0207706_103797982 181
42 3300005327 Ga0070658_10586853 Ga0070658_105868532 182
43 3300005344 Ga0070661_100034767 Ga0070661_1000347673 183
44 3300009011 Ga0105251_10074126 Ga0105251_100741262 183
45 3300009101 Ga0105247_10477541 Ga0105247_104775411 183
46 3300009545 Ga0105237_10635029 Ga0105237_106350292 183
47 3300011119 Ga0105246_10062125 Ga0105246_100621251 183
48 3300013102 Ga0157371_10165666 Ga0157371_101656662 183
49 3300013307 Ga0157372_10962641 Ga0157372_109626412 183
50 3300014325 Ga0163163_10204812 Ga0163163_102048122 183
51 3300014968 Ga0157379_10022322 Ga0157379_100223225 183
52 3300048905 Ga0496102_0540010 Ga0496102_0540010_200_802 183
53 3300048906 Ga0496103_0011488 Ga0496103_0011488_4388_4990 183
54 3300048909 Ga0496106_0232577 Ga0496106_0232577_584_1186 183
55 3300048911 Ga0496108_0454782 Ga0496108_0454782_249_851 183
56 3300048912 Ga0496109_0135054 Ga0496109_0135054_458_1060 183
57 3300048913 Ga0496110_0287044 Ga0496110_0287044_328_930 183
58 3300048914 Ga0496111_0056683 Ga0496111_0056683_804_1406 183
59 3300048916 Ga0496113_0039346 Ga0496113_0039346_335_937 183
60 3300005339 Ga0070660_100049108 Ga0070660_1000491082 184
61 3300037466 Ga0395898_0150293 Ga0395898_0150293_1121_1711 184
62 3300038443 Ga0395901_0000203 Ga0395901_0000203_69229_69819 184
63 3300005334 Ga0068869_100085328 Ga0068869_1000853282 187
64 3300005344 Ga0070661_100271386 Ga0070661_1002713862 187
65 3300005347 Ga0070668_100111139 Ga0070668_1001111391 187
66 3300005353 Ga0070669_100078012 Ga0070669_1000780122 187
67 3300005354 Ga0070675_100317825 Ga0070675_1003178252 187
68 3300005539 Ga0068853_100790996 Ga0068853_1007909961 187
69 3300005547 Ga0070693_100011018 Ga0070693_1000110182 187
70 3300005577 Ga0068857_100055085 Ga0068857_1000550852 187
71 3300005617 Ga0068859_100070179 Ga0068859_1000701793 187
72 3300005618 Ga0068864_100188292 Ga0068864_1001882922 187
73 3300005841 Ga0068863_100189122 Ga0068863_1001891222 187
74 3300005842 Ga0068858_100048649 Ga0068858_1000486492 187
75 3300005843 Ga0068860_100047015 Ga0068860_1000470152 187
76 3300005844 Ga0068862_100034412 Ga0068862_1000344122 187
77 3300006931 Ga0097620_100070178 Ga0097620_1000701783 187
78 3300013100 Ga0157373_10032249 Ga0157373_100322493 187
79 3300014968 Ga0157379_10344015 Ga0157379_103440152 187
80 3300025923 Ga0207681_10066188 Ga0207681_100661882 187
81 3300025926 Ga0207659_10067446 Ga0207659_100674461 187
82 3300025941 Ga0207711_10889354 Ga0207711_108893542 187
83 3300025942 Ga0207689_10030204 Ga0207689_100302043 187
84 3300025945 Ga0207679_10256756 Ga0207679_102567561 187
85 3300025961 Ga0207712_10162399 Ga0207712_101623992 187
86 3300025972 Ga0207668_10433990 Ga0207668_104339902 187
87 3300025981 Ga0207640_10631571 Ga0207640_106315712 187
88 3300025986 Ga0207658_10495171 Ga0207658_104951712 187
89 3300026035 Ga0207703_10071242 Ga0207703_100712422 187
90 3300026067 Ga0207678_10031483 Ga0207678_100314833 187
91 3300026088 Ga0207641_10096187 Ga0207641_100961872 187
92 3300026095 Ga0207676_10337734 Ga0207676_103377342 187
93 3300026116 Ga0207674_10010652 Ga0207674_100106528 187
94 3300028380 Ga0268265_10250459 Ga0268265_102504592 187
95 3300028381 Ga0268264_10335115 Ga0268264_103351152 187
96 3300037418 Ga0395900_0322727 Ga0395900_0322727_473_1087 187
97 3300005355 Ga0070671_100055990 Ga0070671_1000559901 190
98 3300005366 Ga0070659_100000470 Ga0070659_10000047030 190
99 3300005563 Ga0068855_100061773 Ga0068855_1000617732 190
100 3300009148 Ga0105243_10010659 Ga0105243_100106596 190
101 3300014969 Ga0157376_10833546 Ga0157376_108335462 190
102 3300044694 Ga0466963_0020901 Ga0466963_0020901_97_735 190
103 3300045976 Ga0466967_0022870 Ga0466967_0022870_1939_2577 190
104 3300046684 Ga0495669_0001406 Ga0495669_0001406_4917_5507 190
105 3300005335 Ga0070666_10060880 Ga0070666_100608802 191
106 3300005353 Ga0070669_100481445 Ga0070669_1004814452 191
107 3300005355 Ga0070671_100119394 Ga0070671_1001193943 191
108 3300005367 Ga0070667_100095143 Ga0070667_1000951432 191
109 3300005459 Ga0068867_100135185 Ga0068867_1001351852 191
110 3300005530 Ga0070679_100154426 Ga0070679_1001544262 191
111 3300005547 Ga0070693_100208907 Ga0070693_1002089072 191
112 3300005614 Ga0068856_100344058 Ga0068856_1003440581 191
113 3300005616 Ga0068852_100365382 Ga0068852_1003653822 191
114 3300013100 Ga0157373_10334146 Ga0157373_103341462 191
115 3300013102 Ga0157371_10178824 Ga0157371_101788242 191
116 3300013307 Ga0157372_10377410 Ga0157372_103774102 191
117 3300025903 Ga0207680_10259672 Ga0207680_102596721 191
118 3300025907 Ga0207645_10075845 Ga0207645_100758453 191
119 3300025912 Ga0207707_10264900 Ga0207707_102649002 191
120 3300025919 Ga0207657_10023372 Ga0207657_100233724 191
121 3300025921 Ga0207652_10690429 Ga0207652_106904292 191
122 3300025933 Ga0207706_10025153 Ga0207706_100251532 191
123 3300026023 Ga0207677_10364810 Ga0207677_103648102 191
124 3300026041 Ga0207639_10582436 Ga0207639_105824362 191
125 3300026067 Ga0207678_10011057 Ga0207678_100110576 191
126 3300026078 Ga0207702_10113847 Ga0207702_101138471 191
127 3300026089 Ga0207648_10164911 Ga0207648_101649112 191
128 3300026116 Ga0207674_10261344 Ga0207674_102613442 191
129 3300026142 Ga0207698_10792464 Ga0207698_107924642 191
130 3300005293 Ga0065715_10284194 Ga0065715_102841942 192
131 3300005338 Ga0068868_100282163 Ga0068868_1002821632 192
132 3300005344 Ga0070661_100367587 Ga0070661_1003675871 192
133 3300005347 Ga0070668_100350233 Ga0070668_1003502332 192
134 3300005355 Ga0070671_100017725 Ga0070671_1000177252 192
135 3300005366 Ga0070659_100221796 Ga0070659_1002217962 192
136 3300005367 Ga0070667_100033149 Ga0070667_1000331494 192
137 3300005564 Ga0070664_100005157 Ga0070664_1000051575 192
138 3300005614 Ga0068856_100167947 Ga0068856_1001679472 192
139 3300005614 Ga0068856_100374923 Ga0068856_1003749232 192
140 3300005617 Ga0068859_100382140 Ga0068859_1003821401 192
141 3300005618 Ga0068864_100023140 Ga0068864_1000231404 192
142 3300005843 Ga0068860_100927086 Ga0068860_1009270861 192
143 3300006237 Ga0097621_100419678 Ga0097621_1004196782 192
144 3300006358 Ga0068871_100134006 Ga0068871_1001340062 192
145 3300006931 Ga0097620_100382120 Ga0097620_1003821201 192
146 3300007076 Ga0075435_100490573 Ga0075435_1004905732 192
147 3300013100 Ga0157373_10017025 Ga0157373_100170252 192
148 3300025904 Ga0207647_10196292 Ga0207647_101962922 192
149 3300025914 Ga0207671_10405744 Ga0207671_104057442 192
150 3300025920 Ga0207649_10132745 Ga0207649_101327452 192
151 3300025926 Ga0207659_10122095 Ga0207659_101220951 192
152 3300025931 Ga0207644_10362301 Ga0207644_103623012 192
153 3300025945 Ga0207679_10515977 Ga0207679_105159772 192
154 3300025972 Ga0207668_10318780 Ga0207668_103187802 192
155 3300025972 Ga0207668_10330862 Ga0207668_103308622 192
156 3300025986 Ga0207658_10114257 Ga0207658_101142572 192
157 3300026035 Ga0207703_10655276 Ga0207703_106552762 192
158 3300026078 Ga0207702_10133931 Ga0207702_101339312 192
159 3300026095 Ga0207676_10494450 Ga0207676_104944502 192
160 3300026116 Ga0207674_10002193 Ga0207674_1000219324 192
161 3300048913 Ga0496110_0661285 Ga0496110_0661285_297_929 192
162 3300048915 Ga0496112_0055834 Ga0496112_0055834_2011_2643 192
163 3300050511 nmdc:mga08y16_944894_c1 nmdc:mga08y16_944894_c1_197_784 192
164 3300005293 Ga0065715_10488834 Ga0065715_104888341 193
165 3300005338 Ga0068868_100030214 Ga0068868_1000302143 193
166 3300005339 Ga0070660_100003837 Ga0070660_1000038372 193
167 3300005345 Ga0070692_10002274 Ga0070692_100022742 193
168 3300005347 Ga0070668_100018273 Ga0070668_1000182732 193
169 3300005353 Ga0070669_100067133 Ga0070669_1000671332 193
170 3300005353 Ga0070669_100220323 Ga0070669_1002203232 193
171 3300005366 Ga0070659_100007854 Ga0070659_1000078543 193
172 3300005444 Ga0070694_100001237 Ga0070694_1000012375 193
173 3300005457 Ga0070662_100000794 Ga0070662_1000007945 193
174 3300005539 Ga0068853_100097772 Ga0068853_1000977721 193
175 3300005543 Ga0070672_100034874 Ga0070672_1000348742 193
176 3300005544 Ga0070686_100194405 Ga0070686_1001944052 193
177 3300005549 Ga0070704_100057928 Ga0070704_1000579281 193
178 3300005563 Ga0068855_100111790 Ga0068855_1001117902 193
179 3300005564 Ga0070664_100330558 Ga0070664_1003305582 193
180 3300005578 Ga0068854_100353865 Ga0068854_1003538652 193
181 3300005616 Ga0068852_100025191 Ga0068852_1000251913 193
182 3300005616 Ga0068852_100591974 Ga0068852_1005919742 193
183 3300005843 Ga0068860_100004969 Ga0068860_1000049692 193
184 3300006847 Ga0075431_100247705 Ga0075431_1002477052 193
185 3300006871 Ga0075434_100625162 Ga0075434_1006251622 193
186 3300009176 Ga0105242_10167332 Ga0105242_101673322 193
187 3300009553 Ga0105249_10001260 Ga0105249_1000126016 193
188 3300010375 Ga0105239_10016097 Ga0105239_100160976 193
189 3300011119 Ga0105246_10030026 Ga0105246_100300262 193
190 3300014745 Ga0157377_10063067 Ga0157377_100630672 193
191 3300014968 Ga0157379_10362706 Ga0157379_103627062 193
192 3300025904 Ga0207647_10000509 Ga0207647_1000050923 193
193 3300025919 Ga0207657_10001882 Ga0207657_100018829 193
194 3300025923 Ga0207681_10036842 Ga0207681_100368422 193
195 3300025926 Ga0207659_10372630 Ga0207659_103726302 193
196 3300025932 Ga0207690_10001059 Ga0207690_100010598 193
197 3300025933 Ga0207706_10017644 Ga0207706_100176443 193
198 3300025933 Ga0207706_10043029 Ga0207706_100430292 193
199 3300025934 Ga0207686_10018526 Ga0207686_100185262 193
200 3300025937 Ga0207669_10374287 Ga0207669_103742872 193
201 3300025940 Ga0207691_10020611 Ga0207691_100206113 193
202 3300025942 Ga0207689_10013609 Ga0207689_100136092 193
203 3300025949 Ga0207667_10094639 Ga0207667_100946392 193
204 3300025960 Ga0207651_10284176 Ga0207651_102841762 193
205 3300025961 Ga0207712_10000280 Ga0207712_1000028035 193
206 3300025972 Ga0207668_10006892 Ga0207668_100068924 193
207 3300026023 Ga0207677_10009893 Ga0207677_100098932 193
208 3300026041 Ga0207639_10213127 Ga0207639_102131271 193
209 3300026142 Ga0207698_10061135 Ga0207698_100611352 193
210 3300028380 Ga0268265_10063244 Ga0268265_100632442 193
211 3300028381 Ga0268264_10000750 Ga0268264_100007505 193
212 3300037471 Ga0395905_0098700 Ga0395905_0098700_348_929 193
213 3300050510 nmdc:mga06r32_789091_c1 nmdc:mga06r32_789091_c1_59_694 193
214 3300050512 nmdc:mga0n895_775618_c1 nmdc:mga0n895_775618_c1_302_937 193
215 3300050515 nmdc:mga0a205_1958_c1 nmdc:mga0a205_1958_c1_1998_2633 193
216 3300005327 Ga0070658_10165719 Ga0070658_101657192 194
217 3300005327 Ga0070658_10816128 Ga0070658_108161282 194
218 3300005331 Ga0070670_100050123 Ga0070670_1000501232 194
219 3300005336 Ga0070680_100398126 Ga0070680_1003981262 194
220 3300005339 Ga0070660_100084179 Ga0070660_1000841792 194
221 3300005339 Ga0070660_100308010 Ga0070660_1003080101 194
222 3300005344 Ga0070661_100264441 Ga0070661_1002644411 194
223 3300005435 Ga0070714_100024983 Ga0070714_1000249832 194
224 3300005455 Ga0070663_100479876 Ga0070663_1004798761 194
225 3300005458 Ga0070681_10456529 Ga0070681_104565292 194
226 3300005564 Ga0070664_100858308 Ga0070664_1008583082 194
227 3300005616 Ga0068852_100343799 Ga0068852_1003437992 194
228 3300005617 Ga0068859_100268961 Ga0068859_1002689612 194
229 3300005842 Ga0068858_100021048 Ga0068858_1000210483 194
230 3300006931 Ga0097620_100268958 Ga0097620_1002689582 194
231 3300025909 Ga0207705_10112604 Ga0207705_101126042 194
232 3300025912 Ga0207707_10249630 Ga0207707_102496302 194
233 3300025917 Ga0207660_10279003 Ga0207660_102790032 194
234 3300025919 Ga0207657_10100009 Ga0207657_101000092 194
235 3300025919 Ga0207657_10123771 Ga0207657_101237712 194
236 3300025921 Ga0207652_10325748 Ga0207652_103257481 194
237 3300025925 Ga0207650_10009400 Ga0207650_100094004 194
238 3300025929 Ga0207664_10033402 Ga0207664_100334025 194
239 3300025940 Ga0207691_10048964 Ga0207691_100489642 194
240 3300026035 Ga0207703_10001844 Ga0207703_100018443 194
241 3300028380 Ga0268265_10019969 Ga0268265_100199692 194
242 3300037312 Ga0395899_0201478 Ga0395899_0201478_33_662 194
243 3300037466 Ga0395898_0613601 Ga0395898_0613601_216_845 194
244 3300037471 Ga0395905_0385579 Ga0395905_0385579_306_935 194
245 3300038443 Ga0395901_0602494 Ga0395901_0602494_184_813 194
246 3300045976 Ga0466967_0043794 Ga0466967_0043794_3153_3788 194
247 3300050513 nmdc:mga0rr50_150014_c1 nmdc:mga0rr50_150014_c1_43_747 194
248 3300002067 JGI24735J21928_10006309 JGI24735J21928_100063093 195
249 3300005336 Ga0070680_100130373 Ga0070680_1001303731 195
250 3300005564 Ga0070664_100465391 Ga0070664_1004653911 195
251 3300005577 Ga0068857_100260847 Ga0068857_1002608472 195
252 3300009551 Ga0105238_10709560 Ga0105238_107095602 195
253 3300013102 Ga0157371_10037049 Ga0157371_100370492 195
254 3300013102 Ga0157371_10391483 Ga0157371_103914832 195
255 3300013104 Ga0157370_10004683 Ga0157370_100046838 195
256 3300025925 Ga0207650_10076630 Ga0207650_100766301 195
257 3300025945 Ga0207679_10008390 Ga0207679_100083902 195
258 3300026067 Ga0207678_10337900 Ga0207678_103379002 195
259 3300026116 Ga0207674_10005941 Ga0207674_1000594111 195
260 3300037312 Ga0395899_0017607 Ga0395899_0017607_1148_1777 195
261 3300037418 Ga0395900_0080760 Ga0395900_0080760_2659_3288 195
262 3300037466 Ga0395898_0009100 Ga0395898_0009100_9613_10242 195
263 3300037471 Ga0395905_0004819 Ga0395905_0004819_1991_2620 195
264 3300045836 Ga0466958_0027710 Ga0466958_0027710_1476_2105 195
265 3300046525 Ga0495663_0091899 Ga0495663_0091899_101_736 195
266 3300005356 Ga0070674_100432315 Ga0070674_1004323152 196
267 3300005530 Ga0070679_100010435 Ga0070679_1000104358 196
268 3300005564 Ga0070664_100003122 Ga0070664_1000031225 196
269 3300006237 Ga0097621_100135221 Ga0097621_1001352212 196
270 3300013105 Ga0157369_10279423 Ga0157369_102794232 196
271 3300025920 Ga0207649_10009802 Ga0207649_100098024 196
272 3300025932 Ga0207690_10362617 Ga0207690_103626172 196
273 3300025933 Ga0207706_10126034 Ga0207706_101260342 196
274 3300025937 Ga0207669_10672661 Ga0207669_106726611 196
275 3300025945 Ga0207679_10032960 Ga0207679_100329602 196
276 3300037466 Ga0395898_0076639 Ga0395898_0076639_2376_3005 196
277 3300037471 Ga0395905_0015344 Ga0395905_0015344_1344_1973 196
278 3300038443 Ga0395901_0271001 Ga0395901_0271001_94_723 196
279 3300005367 Ga0070667_100576923 Ga0070667_1005769232 197
280 3300025919 Ga0207657_10015077 Ga0207657_100150772 197
281 3300025986 Ga0207658_10540959 Ga0207658_105409592 197
282 3300037312 Ga0395899_0160748 Ga0395899_0160748_298_930 197
283 3300037418 Ga0395900_0445126 Ga0395900_0445126_20_652 197
284 3300037466 Ga0395898_0193716 Ga0395898_0193716_1041_1673 197
285 3300037471 Ga0395905_0043165 Ga0395905_0043165_939_1571 197
286 3300037471 Ga0395905_0065656 Ga0395905_0065656_2099_2731 197
287 3300038443 Ga0395901_0076348 Ga0395901_0076348_2227_2859 197
288 3300005539 Ga0068853_100015449 Ga0068853_1000154494 198
289 3300009551 Ga0105238_10076804 Ga0105238_100768042 198
290 3300005327 Ga0070658_10489515 Ga0070658_104895151 201
291 3300005366 Ga0070659_100243698 Ga0070659_1002436982 201
292 3300025919 Ga0207657_10015690 Ga0207657_100156905 201
293 3300049571 Ga0501034_0220370 Ga0501034_0220370_345_1004 204
294 3300005843 Ga0068860_100167435 Ga0068860_1001674352 207
295 3300028381 Ga0268264_10147018 Ga0268264_101470182 207
296 3300013100 Ga0157373_10751432 Ga0157373_107514321 208
297 3300001979 JGI24740J21852_10002212 JGI24740J21852_100022122 209
298 3300005331 Ga0070670_100150037 Ga0070670_1001500372 209
299 3300005335 Ga0070666_10007473 Ga0070666_100074734 209
300 3300005336 Ga0070680_100004760 Ga0070680_1000047606 209
301 3300005339 Ga0070660_100004058 Ga0070660_1000040587 209
302 3300005364 Ga0070673_100329530 Ga0070673_1003295301 209
303 3300005367 Ga0070667_100081192 Ga0070667_1000811923 209
304 3300005455 Ga0070663_100021214 Ga0070663_1000212142 209
305 3300005548 Ga0070665_100150199 Ga0070665_1001501992 209
306 3300005563 Ga0068855_100098452 Ga0068855_1000984521 209
307 3300005577 Ga0068857_100022975 Ga0068857_1000229754 209
308 3300005614 Ga0068856_100029714 Ga0068856_1000297143 209
309 3300005616 Ga0068852_100411318 Ga0068852_1004113182 209
310 3300005618 Ga0068864_100385331 Ga0068864_1003853312 209
311 3300009098 Ga0105245_11113914 Ga0105245_111139141 209
312 3300013100 Ga0157373_10328430 Ga0157373_103284302 209
313 3300013307 Ga0157372_10746824 Ga0157372_107468242 209
314 3300025909 Ga0207705_10001418 Ga0207705_100014189 209
315 3300025909 Ga0207705_10061849 Ga0207705_100618492 209
316 3300025912 Ga0207707_10075362 Ga0207707_100753622 209
317 3300025917 Ga0207660_10003939 Ga0207660_100039396 209
318 3300025919 Ga0207657_10004489 Ga0207657_100044899 209
319 3300025921 Ga0207652_10012949 Ga0207652_100129496 209
320 3300025932 Ga0207690_10091002 Ga0207690_100910021 209
321 3300025933 Ga0207706_10020718 Ga0207706_100207181 209
322 3300025944 Ga0207661_10119042 Ga0207661_101190422 209
323 3300025949 Ga0207667_10646511 Ga0207667_106465111 209
324 3300025960 Ga0207651_10107176 Ga0207651_101071761 209
325 3300026067 Ga0207678_10000961 Ga0207678_100009614 209
326 3300026067 Ga0207678_10008848 Ga0207678_100088488 209
327 3300026095 Ga0207676_10565829 Ga0207676_105658292 209
328 3300026116 Ga0207674_10023477 Ga0207674_100234772 209
329 3300028379 Ga0268266_10129743 Ga0268266_101297432 209
330 3300037312 Ga0395899_0140762 Ga0395899_0140762_45_674 209

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02630

SCO1-SenC

SCO1/SenC

68

196

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6n5u-assembly2.cif.gz_B crystal structure of arabidopsis thaliana scoi with copper bound 0.8791 48 208
1wp0-assembly1.cif.gz_A human sco1 0.8756 48 206
6n5u-assembly3.cif.gz_C crystal structure of arabidopsis thaliana scoi with copper bound 0.864 48 208
1wp0-assembly1.cif.gz_A human sco1 0.8449 48 206
4wbr-assembly1.cif.gz_D structure of bradyrhizobium japonicum scoi with copper bound 0.8434 48 207
ID Description Score Start End Superfamily
af_K7MTL0_161_316_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8924 71 206 3.40.30.10
af_Q54TT7_154_312_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8809 48 206 3.40.30.10
af_Q4CKJ9_1_119_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8552 104 208 3.40.30.10
af_Q17557_120_303_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8488 51 206 3.40.30.10
af_Q54TT7_154_312_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8444 48 206 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2A3JNI3-F1-model_v4 SCO family protein 0.9315 81 208 GO:0046872
AF-A0A7Y3J3N7-F1-model_v4 SCO family protein 0.927 58 209 GO:0046872
AF-A0A3M0F6Y3-F1-model_v4 deleted 0.926 58 209
AF-X7F1J4-F1-model_v4 Electron transport protein SCO1/SenC 0.9242 80 207 GO:0046872
AF-A0A833MXQ9-F1-model_v4 SCO family protein 0.9216 74 208 GO:0046872

Feature Viewer

pLDDT pTM Quality
82.92 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map