F409990

General Info

Members Datasets Scaffolds Average Seq Length
330 210 327 316

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100204059|Ga0070708_1002040592
Length 375
Sequence MFAARADARFPGQESFIVHAGRRIAACPPYFPNYYLVPHQSLCGSISLCDVCLKTDLGSMPILASPQFPKEQSESGEFVRQQDAFRRWITSDPQGELPPTPHRYHLYVSWACPWAHRIIIVRHLKGLEKIIGMTVVDPIRDDKGWAFRDVPGASRDPINGFRYLSEAYLATTPGYEGRVTVPVLWDKETKQIVSNSDDDLMRILNSAFNEVTGNQVDLYPAQHRAEIDSLNETIYETVNDGVYRAGFATSQRAYETAAFALFKTLDELDDRLATRRFLFGAQPLETDWRLFVTLIRFDAVYHGHFKCNVRRILDYRNLYGYLRDLYQQPGIAETVNFDHIKRHYYYTHDDINPTRIVPIGPKQDLNSPHGRDGVG

Samples

Sample ID Description Type Environment
1 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
2 2952252522 Salinicola sp. DM10 Isolate Unclassified
3 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
100 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
101 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
102 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
103 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
104 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
117 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
118 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
119 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
120 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
121 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
122 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
123 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
124 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
125 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
126 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
127 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
128 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
129 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
130 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
131 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
132 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
133 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
134 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
139 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
140 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
150 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
151 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
152 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
153 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
167 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
168 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
169 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
170 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
171 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
172 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
173 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
174 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
175 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
176 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
177 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
178 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
179 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
180 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
181 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
182 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
183 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
184 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
185 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
186 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
187 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
188 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
189 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
190 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
191 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
192 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
193 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
198 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
201 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
202 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
203 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
204 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
205 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
209 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
210 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.18
Metatranscriptomes 0.91
Isolates 0.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 3.33
Rhizosphere 91.21
Stem 0
Stem Tuber 0
Unclassified 5.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1000106 3300000545 Bacteria 15432
2 rootH2_10013746 3300003320 Bacteria 17486
3 rootH1_10170806 3300003323 Bacteria 3551
4 Ga0065704_10013125 3300005289 Unclassified 3496
5 Ga0065715_10252842 3300005293 Bacteria 1161
6 Ga0070658_10092071 3300005327 Bacteria 2499
7 Ga0070676_10030879 3300005328 Bacteria 3058
8 Ga0070683_100041107 3300005329 Bacteria 4251
9 Ga0070690_100003591 3300005330 Bacteria 8520
10 Ga0070670_100015728 3300005331 Bacteria 6496
11 Ga0070670_100166866 3300005331 Bacteria 1909
12 Ga0070670_100192929 3300005331 Bacteria 1770
13 Ga0070677_10013734 3300005333 Bacteria 2838
14 Ga0070666_10021278 3300005335 Bacteria 4202
15 Ga0070666_10090778 3300005335 Bacteria 2098
16 Ga0070666_10180872 3300005335 Bacteria 1479
17 Ga0070660_100078971 3300005339 Unclassified 2581
18 Ga0070689_100065032 3300005340 Unclassified 2840
19 Ga0070661_100042332 3300005344 Bacteria 3324
20 Ga0070661_100070941 3300005344 Bacteria 2563
21 Ga0070668_100012873 3300005347 Bacteria 6228
22 Ga0070668_100028775 3300005347 Bacteria 4216
23 Ga0070668_100041632 3300005347 Unclassified 3520
24 Ga0070668_100121291 3300005347 Bacteria 2090
25 Ga0070669_100076901 3300005353 Bacteria 2478
26 Ga0070669_100108636 3300005353 Bacteria 2102
27 Ga0070675_100032034 3300005354 Unclassified 4252
28 Ga0070675_100032733 3300005354 Bacteria 4208
29 Ga0070675_100078142 3300005354 Bacteria 2755
30 Ga0070675_100322279 3300005354 Bacteria 1365
31 Ga0070671_100011048 3300005355 Bacteria 7247
32 Ga0070671_100119363 3300005355 Bacteria 2219
33 Ga0070674_100022529 3300005356 Bacteria 4064
34 Ga0070673_100000190 3300005364 Bacteria 30180
35 Ga0070673_100013363 3300005364 Bacteria 5676
36 Ga0070688_100009586 3300005365 Bacteria 5304
37 Ga0070667_100005386 3300005367 Bacteria 10689
38 Ga0070667_100023650 3300005367 Bacteria 5099
39 Ga0070667_100044018 3300005367 Bacteria 3748
40 Ga0070709_10170537 3300005434 Bacteria 1520
41 Ga0070714_100002019 3300005435 Bacteria 14861
42 Ga0070714_100013266 3300005435 Bacteria 6599
43 Ga0070714_100026880 3300005435 Bacteria 4760
44 Ga0070713_100153558 3300005436 Bacteria 2050
45 Ga0070713_100164605 3300005436 Bacteria 1982
46 Ga0070710_10065176 3300005437 Bacteria 2086
47 Ga0070700_100033854 3300005441 Bacteria 3081
48 Ga0070700_100331852 3300005441 Bacteria 1121
49 Ga0070708_100204059 3300005445 Bacteria 1851
50 Ga0070663_100084566 3300005455 Bacteria 2339
51 Ga0070678_100009382 3300005456 Bacteria 5925
52 Ga0070678_100042899 3300005456 Bacteria 3219
53 Ga0068867_100048819 3300005459 Bacteria 3115
54 Ga0068867_100099863 3300005459 Bacteria 2215
55 Ga0070706_100051909 3300005467 Bacteria 3785
56 Ga0070707_100096132 3300005468 Bacteria 2869
57 Ga0070707_100133588 3300005468 Bacteria 2413
58 Ga0070698_100005632 3300005471 Bacteria 13706
59 Ga0070699_100019759 3300005518 Bacteria 5806
60 Ga0070697_100063983 3300005536 Bacteria 3004
61 Ga0070697_100213019 3300005536 Bacteria 1645
62 Ga0070672_100003057 3300005543 Bacteria 10785
63 Ga0068855_100002748 3300005563 Bacteria 21663
64 Ga0068855_100104383 3300005563 Bacteria 3260
65 Ga0068856_100089463 3300005614 Bacteria 3062
66 Ga0068852_100574505 3300005616 Bacteria 1130
67 Ga0068858_100190134 3300005842 Bacteria 1940
68 Ga0068860_100612658 3300005843 Bacteria 1095
69 Ga0081455_10002420 3300005937 Bacteria 22255
70 Ga0070717_10013238 3300006028 Bacteria 6313
71 Ga0070717_10023732 3300006028 Bacteria 4863
72 Ga0068871_100037061 3300006358 Unclassified 3887
73 Ga0068871_100344411 3300006358 Bacteria 1317
74 Ga0075429_100293289 3300006880 Bacteria 1424
75 Ga0099795_10012994 3300007788 Bacteria 2542
76 Ga0105240_10007319 3300009093 Bacteria 16060
77 Ga0105240_10394475 3300009093 Bacteria 1560
78 Ga0111539_10000106 3300009094 Bacteria 90149
79 Ga0105245_10156775 3300009098 Bacteria 2157
80 Ga0105248_10470627 3300009177 Bacteria 1416
81 Ga0105237_10000594 3300009545 Bacteria 50494
82 Ga0105239_10407137 3300010375 Bacteria 1540
83 Ga0157371_10034268 3300013102 Unclassified 3642
84 Ga0157374_10023008 3300013296 Bacteria 5566
85 Ga0157374_10057412 3300013296 Bacteria 3635
86 Ga0157374_10102088 3300013296 Bacteria 2750
87 Ga0157374_10269158 3300013296 Bacteria 1679
88 Ga0157378_10005614 3300013297 Bacteria 10990
89 Ga0163162_10008945 3300013306 Bacteria 9735
90 Ga0163162_10060190 3300013306 Bacteria 3832
91 Ga0163162_10110339 3300013306 Bacteria 2848
92 Ga0163162_10125500 3300013306 Bacteria 2673
93 Ga0163162_10597845 3300013306 Bacteria 1230
94 Ga0157375_10000006 3300013308 Bacteria 384086
95 Ga0157375_10002587 3300013308 Bacteria 15713
96 Ga0157375_10008633 3300013308 Bacteria 8924
97 Ga0157375_10047550 3300013308 Bacteria 4191
98 Ga0163163_10330312 3300014325 Bacteria 1579
99 Ga0157376_10008171 3300014969 Bacteria 7529
100 Ga0157376_10051487 3300014969 Unclassified 3421
101 Ga0157376_10093310 3300014969 Bacteria 2613
102 Ga0213872_10006756 3300021361 Bacteria 5713
103 Ga0213872_10010288 3300021361 Bacteria 4455
104 Ga0213872_10065331 3300021361 Bacteria 1643
105 Ga0213872_10106519 3300021361 Bacteria 1247
106 Ga0213874_10019978 3300021377 Bacteria 1831
107 Ga0213874_10023382 3300021377 Bacteria 1723
108 Ga0213876_10075299 3300021384 Bacteria 1782
109 Ga0213875_10000001 3300021388 Bacteria 2793540
110 Ga0207697_10000060 3300025315 Bacteria 45290
111 Ga0207697_10002476 3300025315 Bacteria 9551
112 Ga0207682_10047502 3300025893 Bacteria 1768
113 Ga0207680_10008727 3300025903 Unclassified 4991
114 Ga0207680_10105180 3300025903 Bacteria 1820
115 Ga0207699_10073347 3300025906 Bacteria 2099
116 Ga0207645_10014856 3300025907 Bacteria 5195
117 Ga0207645_10026831 3300025907 Bacteria 3722
118 Ga0207684_10033661 3300025910 Bacteria 4359
119 Ga0207684_10061769 3300025910 Bacteria 3181
120 Ga0207695_10019227 3300025913 Bacteria 7866
121 Ga0207649_10214188 3300025920 Bacteria 1368
122 Ga0207646_10142112 3300025922 Bacteria 2162
123 Ga0207650_10021823 3300025925 Unclassified 4528
124 Ga0207650_10079398 3300025925 Unclassified 2485
125 Ga0207659_10066894 3300025926 Bacteria 2609
126 Ga0207659_10094527 3300025926 Bacteria 2240
127 Ga0207700_10154118 3300025928 Bacteria 1902
128 Ga0207700_10260897 3300025928 Bacteria 1484
129 Ga0207664_10000667 3300025929 Bacteria 23582
130 Ga0207664_10451510 3300025929 Bacteria 1147
131 Ga0207644_10016131 3300025931 Bacteria 5025
132 Ga0207706_10069600 3300025933 Bacteria 3095
133 Ga0207670_10099089 3300025936 Bacteria 2078
134 Ga0207669_10063856 3300025937 Bacteria 2275
135 Ga0207691_10000015 3300025940 Bacteria 142014
136 Ga0207691_10000142 3300025940 Bacteria 66224
137 Ga0207691_10056977 3300025940 Bacteria 3558
138 Ga0207661_10480882 3300025944 Bacteria 1134
139 Ga0207667_10000362 3300025949 Bacteria 61400
140 Ga0207667_10024526 3300025949 Bacteria 6620
141 Ga0207651_10000209 3300025960 Bacteria 25205
142 Ga0207651_10012260 3300025960 Bacteria 4842
143 Ga0207640_10171879 3300025981 Bacteria 1616
144 Ga0207658_10048287 3300025986 Bacteria 3120
145 Ga0207658_10155642 3300025986 Bacteria 1867
146 Ga0207703_10051208 3300026035 Bacteria 3345
147 Ga0207678_10019537 3300026067 Bacteria 5953
148 Ga0207678_10402404 3300026067 Bacteria 1185
149 Ga0207648_10032695 3300026089 Bacteria 4590
150 Ga0207648_10062989 3300026089 Bacteria 3233
151 Ga0207683_10001736 3300026121 Bacteria 19404
152 Ga0207683_10009796 3300026121 Bacteria 8171
153 Ga0207683_10287280 3300026121 Bacteria 1504
154 Ga0209974_10027165 3300027876 Bacteria 1893
155 Ga0268266_10016109 3300028379 Bacteria 6391
156 Ga0265334_10064784 3300028573 Bacteria 1372
157 Ga0265338_10000089 3300028800 Bacteria 172762
158 Ga0265338_10094741 3300028800 Bacteria 2455
159 Ga0265325_10000059 3300031241 Bacteria 76069
160 Ga0265339_10003220 3300031249 Bacteria 11455
161 Ga0265327_10002542 3300031251 Bacteria 18995
162 Ga0265327_10002964 3300031251 Bacteria 16938
163 Ga0265327_10059197 3300031251 Bacteria 1963
164 Ga0265316_10034489 3300031344 Bacteria 4110
165 Ga0265313_10000043 3300031595 Bacteria 117620
166 Ga0316576_10086839 3300031727 Bacteria 2327
167 Ga0307405_10336638 3300031731 Bacteria 1158
168 Ga0307407_10000079 3300031903 Bacteria 34593
169 Ga0307407_10210057 3300031903 Bacteria 1310
170 Ga0307412_10000052 3300031911 Bacteria 150085
171 Ga0307409_100112973 3300031995 Bacteria 2282
172 Ga0395899_0041542 3300037312 Bacteria 3436
173 Ga0395900_0090400 3300037418 Bacteria 3147
174 Ga0395900_0099477 3300037418 Bacteria 2987
175 Ga0395898_0007431 3300037466 Bacteria 11629
176 Ga0395905_0017783 3300037471 Bacteria 6752
177 Ga0395905_0099830 3300037471 Bacteria 2726
178 Ga0436364_0273345 3300037853 Bacteria 2794207
179 Ga0436364_1228557 3300037853 Bacteria 2393
180 Ga0436364_1514056 3300037853 Bacteria 3969
181 Ga0395901_0043810 3300038443 Bacteria 4641
182 Ga0436365_0006691 3300039437 Bacteria 6290
183 Ga0436365_0743278 3300039437 Bacteria 14541
184 Ga0436365_1425380 3300039437 Bacteria 1846
185 Ga0436365_1764954 3300039437 Bacteria 1189
186 Ga0436360_0170634 3300039438 Bacteria 1882
187 Ga0436360_0524709 3300039438 Bacteria 1738
188 Ga0436360_0907395 3300039438 Bacteria 2124
189 Ga0436360_1023826 3300039438 Bacteria 2507
190 Ga0436360_1095117 3300039438 Bacteria 6571
191 Ga0436360_1110476 3300039438 Bacteria 1261
192 Ga0436360_1323800 3300039438 Bacteria 1867
193 Ga0436361_0109025 3300039447 Bacteria 2551
194 Ga0436361_0211350 3300039447 Bacteria 33803
195 Ga0436361_0547362 3300039447 Bacteria 2682
196 Ga0436361_0589265 3300039447 Bacteria 45710
197 Ga0436361_0959265 3300039447 Bacteria 8175
198 Ga0436361_1148770 3300039447 Bacteria 1753
199 Ga0436361_1158837 3300039447 Bacteria 2392
200 Ga0436363_0992517 3300039450 Bacteria 3562
201 Ga0436363_1492231 3300039450 Bacteria 10441
202 Ga0436362_0214881 3300039453 Bacteria 6381
203 Ga0436362_0741466 3300039453 Bacteria 1548
204 Ga0436362_0924010 3300039453 Bacteria 2313
205 Ga0436362_1023869 3300039453 Bacteria 11645
206 Ga0439447_013582 3300041407 Bacteria 2306
207 Ga0439461_0006592 3300041410 Bacteria 2028
208 Ga0439431_0019397 3300041997 Bacteria 1617
209 Ga0439448_0030583 3300042005 Bacteria 1709
210 Ga0439452_002472 3300042010 Bacteria 6794
211 Ga0450891_000817 3300042129 Bacteria 3260
212 Ga0450892_000110 3300042130 Bacteria 9211
213 Ga0439434_0035123 3300042435 Bacteria 1532
214 Ga0439464_0076718 3300042439 Bacteria 994
215 Ga0439460_0022449 3300042461 Bacteria 1731
216 Ga0450893_0000012 3300042532 Bacteria 17927
217 Ga0450893_0000194 3300042532 Bacteria 7997
218 Ga0451577_0261927 3300042876 Bacteria 1566
219 Ga0466969_0007679 3300044656 Bacteria 5733
220 Ga0466966_0029763 3300044684 Bacteria 3550
221 Ga0466959_0005049 3300045049 Bacteria 8969
222 Ga0451576_0283780 3300045051 Bacteria 1731
223 Ga0466958_0034592 3300045836 Bacteria 3015
224 Ga0466958_0136922 3300045836 Bacteria 1540
225 Ga0466967_0007832 3300045976 Bacteria 7760
226 Ga0466967_0038647 3300045976 Bacteria 4095
227 Ga0495643_0000169 3300046522 Bacteria 103635
228 Ga0495672_0021349 3300047320 Bacteria 4225
229 Ga0496100_0100200 3300048903 Bacteria 1995
230 Ga0496101_0065825 3300048904 Bacteria 2642
231 Ga0496104_0111971 3300048907 Bacteria 2617
232 Ga0496104_0134300 3300048907 Bacteria 2377
233 Ga0496105_0219233 3300048908 Bacteria 1549
234 Ga0496109_0003171 3300048912 Bacteria 13708
235 Ga0496110_0064310 3300048913 Unclassified 3242
236 Ga0496111_0049314 3300048914 Unclassified 3036
237 Ga0496114_0005304 3300048917 Bacteria 10073
238 Ga0496114_0034963 3300048917 Bacteria 4149
239 Ga0496115_0008738 3300048918 Bacteria 7509
240 Ga0501290_001273 3300049513 Bacteria 3511
241 Ga0501299_000039 3300049522 Bacteria 14911
242 Ga0501300_001716 3300049523 Bacteria 3283
243 Ga0501301_001598 3300049524 Bacteria 1445
244 Ga0501031_0002023 3300049568 Bacteria 12755
245 Ga0501031_0052596 3300049568 Bacteria 2654
246 Ga0501031_0213249 3300049568 Bacteria 1258
247 Ga0501032_0000684 3300049569 Bacteria 27560
248 Ga0501036_0082294 3300049572 Bacteria 2721
249 Ga0501037_0004003 3300049573 Bacteria 10683
250 Ga0501037_0007130 3300049573 Bacteria 8169
251 Ga0501039_0004064 3300049575 Bacteria 11001
252 Ga0501039_0063489 3300049575 Bacteria 2862
253 Ga0501040_0009799 3300049576 Bacteria 6254
254 Ga0501040_0061665 3300049576 Bacteria 2580
255 Ga0501040_0071097 3300049576 Bacteria 2402
256 Ga0501041_0010329 3300049577 Bacteria 5501
257 Ga0501042_0002801 3300049578 Bacteria 10788
258 Ga0501042_0006527 3300049578 Bacteria 7578
259 Ga0501042_0048647 3300049578 Bacteria 3023
260 Ga0501042_0135217 3300049578 Bacteria 1777
261 Ga0501046_0003735 3300049580 Bacteria 13934
262 Ga0501046_0015512 3300049580 Bacteria 6400
263 Ga0501046_0024873 3300049580 Bacteria 4905
264 Ga0501046_0026997 3300049580 Bacteria 4688
265 Ga0501046_0054365 3300049580 Bacteria 3150
266 Ga0501047_0019627 3300049581 Bacteria 6486
267 Ga0501047_0030947 3300049581 Bacteria 5159
268 Ga0501047_0071310 3300049581 Bacteria 3344
269 Ga0501048_0002048 3300049582 Bacteria 15313
270 Ga0501048_0007991 3300049582 Bacteria 8008
271 Ga0501048_0037543 3300049582 Bacteria 3479
272 Ga0501071_0004827 3300049587 Bacteria 8591
273 Ga0501071_0048925 3300049587 Bacteria 3042
274 Ga0501071_0094633 3300049587 Bacteria 2198
275 Ga0501071_0213950 3300049587 Bacteria 1450
276 Ga0501074_0187964 3300049590 Bacteria 1473
277 Ga0501075_0089613 3300049591 Bacteria 2332
278 Ga0501075_0373439 3300049591 Bacteria 1087
279 Ga0501076_0038736 3300049592 Bacteria 3743
280 Ga0501076_0102319 3300049592 Bacteria 2309
281 Ga0501206_001766 3300049653 Bacteria 2714
282 Ga0501209_000264 3300049656 Bacteria 6333
283 Ga0501230_005225 3300049667 Bacteria 1826
284 Ga0501233_000414 3300049668 Bacteria 6708
285 Ga0501235_001569 3300049669 Bacteria 4896
286 Ga0501243_000123 3300049675 Bacteria 8569
287 Ga0501252_000956 3300049682 Bacteria 2501
288 Ga0501253_000437 3300049683 Bacteria 3525
289 Ga0501260_001034 3300049689 Bacteria 2248
290 Ga0501261_000426 3300049690 Bacteria 5505
291 Ga0501225_0007281 3300049705 Bacteria 3208
292 Ga0501229_000410 3300049706 Bacteria 4813
293 Ga0501234_001026 3300049707 Bacteria 4412
294 Ga0501245_001080 3300049708 Bacteria 3511
295 Ga0501081_0058956 3300049743 Bacteria 2657
296 Ga0501081_0153722 3300049743 Bacteria 1654
297 Ga0501266_001234 3300049763 Bacteria 3252
298 Ga0501268_002187 3300049765 Bacteria 2550
299 Ga0501270_000242 3300049767 Bacteria 4634
300 Ga0501272_000190 3300049769 Bacteria 5048
301 Ga0501275_001379 3300049772 Bacteria 2410
302 Ga0501278_000457 3300049774 Bacteria 3168
303 Ga0501279_000352 3300049775 Bacteria 6149
304 Ga0501280_012725 3300049776 Bacteria 1184
305 Ga0501281_00508 3300049777 Bacteria 3607
306 Ga0501282_001890 3300049778 Bacteria 2307
307 Ga0501283_000783 3300049779 Bacteria 4179
308 Ga0501035_0004333 3300049822 Bacteria 13470
309 Ga0501035_0013066 3300049822 Bacteria 7661
310 Ga0501035_0021523 3300049822 Bacteria 5928
311 Ga0501035_0071656 3300049822 Bacteria 3068
312 Ga0501044_0000025 3300049823 Bacteria 187867
313 Ga0501045_0072498 3300049824 Bacteria 2536
314 Ga0501045_0131172 3300049824 Bacteria 1863
315 Ga0501212_009514 3300049851 Bacteria 1371
316 Ga0501226_001906 3300049853 Bacteria 2612
317 nmdc:mga05p37_51197_c1 3300050507 Bacteria 5079
318 nmdc:mga06r32_156365_c1 3300050510 Bacteria 2261
319 nmdc:mga08x19_120162_c1 3300050514 Bacteria 1761
320 nmdc:mga0a205_215624_c1 3300050515 Bacteria 1806
321 Ga0500555_000024 3300053103 Bacteria 134279
322 Ga0501084_0167920 3300054114 Bacteria 1852
323 Ga0587080_009882 3300059503 Bacteria 1397
324 Ga0587106_012960 3300059605 Unclassified 1126
325 Ga0587071_007319 3300060344 Bacteria 1756
326 Ga0501082_0255380 3300060353 Bacteria 1525
327 Ga0530510_0247277 3300061734 Bacteria 1329

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031903 Ga0307407_10210057 Ga0307407_102100572 288
2 3300025907 Ga0207645_10014856 Ga0207645_100148562 298
3 3300005441 Ga0070700_100331852 Ga0070700_1003318521 299
4 3300005616 Ga0068852_100574505 Ga0068852_1005745051 299
5 3300009098 Ga0105245_10156775 Ga0105245_101567753 299
6 3300009177 Ga0105248_10470627 Ga0105248_104706271 299
7 3300025981 Ga0207640_10171879 Ga0207640_101718793 299
8 3300042005 Ga0439448_0030583 Ga0439448_0030583_486_1409 299
9 3300042439 Ga0439464_0076718 Ga0439464_0076718_10_933 299
10 3300042461 Ga0439460_0022449 Ga0439460_0022449_706_1629 299
11 3300005435 Ga0070714_100002019 Ga0070714_10000201914 300
12 3300021361 Ga0213872_10010288 Ga0213872_100102883 300
13 3300021361 Ga0213872_10065331 Ga0213872_100653312 300
14 3300025929 Ga0207664_10000667 Ga0207664_100006672 300
15 3300031251 Ga0265327_10002964 Ga0265327_1000296415 300
16 3300039447 Ga0436361_0211350 Ga0436361_0211350_2622_3539 300
17 3300039447 Ga0436361_1158837 Ga0436361_1158837_905_1819 300
18 3300049743 Ga0501081_0058956 Ga0501081_0058956_811_1773 300
19 3300039438 Ga0436360_0524709 Ga0436360_0524709_690_1613 301
20 3300039447 Ga0436361_0547362 Ga0436361_0547362_1003_1926 301
21 3300026121 Ga0207683_10287280 Ga0207683_102872801 302
22 3300009093 Ga0105240_10007319 Ga0105240_1000731911 303
23 3300025913 Ga0207695_10019227 Ga0207695_100192275 303
24 3300025929 Ga0207664_10451510 Ga0207664_104515102 303
25 3300005327 Ga0070658_10092071 Ga0070658_100920712 306
26 3300005455 Ga0070663_100084566 Ga0070663_1000845661 306
27 3300005563 Ga0068855_100002748 Ga0068855_1000027483 306
28 3300005563 Ga0068855_100104383 Ga0068855_1001043833 306
29 3300005842 Ga0068858_100190134 Ga0068858_1001901342 306
30 3300009545 Ga0105237_10000594 Ga0105237_1000059434 306
31 3300010375 Ga0105239_10407137 Ga0105239_104071372 306
32 3300013306 Ga0163162_10110339 Ga0163162_101103392 306
33 3300025949 Ga0207667_10000362 Ga0207667_1000036250 306
34 3300025949 Ga0207667_10024526 Ga0207667_100245268 306
35 3300026035 Ga0207703_10051208 Ga0207703_100512083 306
36 3300026067 Ga0207678_10019537 Ga0207678_100195372 306
37 3300049576 Ga0501040_0071097 Ga0501040_0071097_1251_2171 306
38 3300049580 Ga0501046_0054365 Ga0501046_0054365_775_1695 306
39 3300049582 Ga0501048_0037543 Ga0501048_0037543_1115_2035 306
40 3300049591 Ga0501075_0373439 Ga0501075_0373439_107_1027 306
41 3300061734 Ga0530510_0247277 Ga0530510_0247277_118_1038 306
42 3300003320 rootH2_10013746 rootH2_1001374614 307
43 3300005435 Ga0070714_100013266 Ga0070714_1000132663 307
44 3300031251 Ga0265327_10002542 Ga0265327_100025427 307
45 3300031727 Ga0316576_10086839 Ga0316576_100868393 307
46 3300031911 Ga0307412_10000052 Ga0307412_1000005299 307
47 3300037471 Ga0395905_0099830 Ga0395905_0099830_1318_2277 307
48 3300042532 Ga0450893_0000012 Ga0450893_0000012_5474_6403 307
49 3300044656 Ga0466969_0007679 Ga0466969_0007679_2315_3256 307
50 3300045049 Ga0466959_0005049 Ga0466959_0005049_5001_5942 307
51 3300045051 Ga0451576_0283780 Ga0451576_0283780_37_999 307
52 3300039437 Ga0436365_1425380 Ga0436365_1425380_257_1198 308
53 3300039447 Ga0436361_0109025 Ga0436361_0109025_1443_2375 308
54 3300045976 Ga0466967_0038647 Ga0466967_0038647_1167_2105 308
55 3300048912 Ga0496109_0003171 Ga0496109_0003171_10627_11580 308
56 3300005614 Ga0068856_100089463 Ga0068856_1000894632 309
57 3300028800 Ga0265338_10094741 Ga0265338_100947412 309
58 3300039438 Ga0436360_0170634 Ga0436360_0170634_539_1480 309
59 3300047320 Ga0495672_0021349 Ga0495672_0021349_3068_4021 309
60 3300049581 Ga0501047_0019627 Ga0501047_0019627_291_1247 309
61 3300005335 Ga0070666_10090778 Ga0070666_100907782 310
62 3300005434 Ga0070709_10170537 Ga0070709_101705371 310
63 3300005435 Ga0070714_100026880 Ga0070714_1000268805 310
64 3300005436 Ga0070713_100153558 Ga0070713_1001535581 310
65 3300005436 Ga0070713_100164605 Ga0070713_1001646051 310
66 3300005437 Ga0070710_10065176 Ga0070710_100651763 310
67 3300013308 Ga0157375_10000006 Ga0157375_10000006193 310
68 3300021361 Ga0213872_10006756 Ga0213872_100067567 310
69 3300021361 Ga0213872_10106519 Ga0213872_101065192 310
70 3300021377 Ga0213874_10023382 Ga0213874_100233822 310
71 3300021384 Ga0213876_10075299 Ga0213876_100752992 310
72 3300021388 Ga0213875_10000001 Ga0213875_10000001457 310
73 3300025906 Ga0207699_10073347 Ga0207699_100733473 310
74 3300025928 Ga0207700_10154118 Ga0207700_101541182 310
75 3300025928 Ga0207700_10260897 Ga0207700_102608971 310
76 3300028573 Ga0265334_10064784 Ga0265334_100647842 310
77 3300028800 Ga0265338_10000089 Ga0265338_1000008950 310
78 3300031241 Ga0265325_10000059 Ga0265325_1000005932 310
79 3300031249 Ga0265339_10003220 Ga0265339_100032209 310
80 3300031251 Ga0265327_10059197 Ga0265327_100591972 310
81 3300031344 Ga0265316_10034489 Ga0265316_100344895 310
82 3300031595 Ga0265313_10000043 Ga0265313_1000004363 310
83 3300037418 Ga0395900_0090400 Ga0395900_0090400_1958_2905 310
84 3300037471 Ga0395905_0017783 Ga0395905_0017783_1157_2104 310
85 3300037853 Ga0436364_0273345 Ga0436364_0273345_452715_453659 310
86 3300037853 Ga0436364_1228557 Ga0436364_1228557_1052_1990 310
87 3300037853 Ga0436364_1514056 Ga0436364_1514056_2959_3909 310
88 3300039437 Ga0436365_0006691 Ga0436365_0006691_4031_4981 310
89 3300039437 Ga0436365_0743278 Ga0436365_0743278_10804_11748 310
90 3300039438 Ga0436360_1095117 Ga0436360_1095117_793_1731 310
91 3300039447 Ga0436361_0589265 Ga0436361_0589265_32824_33768 310
92 3300039450 Ga0436363_0992517 Ga0436363_0992517_1716_2663 310
93 3300039450 Ga0436363_1492231 Ga0436363_1492231_6176_7126 310
94 3300039453 Ga0436362_0214881 Ga0436362_0214881_942_1886 310
95 3300039453 Ga0436362_0741466 Ga0436362_0741466_563_1507 310
96 3300039453 Ga0436362_1023869 Ga0436362_1023869_6027_6977 310
97 3300041997 Ga0439431_0019397 Ga0439431_0019397_480_1421 310
98 3300042435 Ga0439434_0035123 Ga0439434_0035123_216_1157 310
99 3300045836 Ga0466958_0034592 Ga0466958_0034592_1331_2275 310
100 3300045836 Ga0466958_0136922 Ga0466958_0136922_137_1078 310
101 3300048903 Ga0496100_0100200 Ga0496100_0100200_816_1757 310
102 3300048907 Ga0496104_0111971 Ga0496104_0111971_1317_2258 310
103 3300048908 Ga0496105_0219233 Ga0496105_0219233_125_1066 310
104 3300048917 Ga0496114_0034963 Ga0496114_0034963_1459_2400 310
105 3300048918 Ga0496115_0008738 Ga0496115_0008738_3737_4678 310
106 3300049569 Ga0501032_0000684 Ga0501032_0000684_24140_25084 310
107 3300049580 Ga0501046_0003735 Ga0501046_0003735_2354_3298 310
108 3300049580 Ga0501046_0024873 Ga0501046_0024873_1260_2204 310
109 3300049581 Ga0501047_0030947 Ga0501047_0030947_1676_2620 310
110 3300049581 Ga0501047_0071310 Ga0501047_0071310_773_1717 310
111 3300049822 Ga0501035_0004333 Ga0501035_0004333_10915_11859 310
112 3300049823 Ga0501044_0000025 Ga0501044_0000025_15479_16423 310
113 3300050510 nmdc:mga06r32_156365_c1 nmdc:mga06r32_156365_c1_107_1039 310
114 3300005293 Ga0065715_10252842 Ga0065715_102528421 311
115 3300005328 Ga0070676_10030879 Ga0070676_100308792 311
116 3300005330 Ga0070690_100003591 Ga0070690_1000035917 311
117 3300005331 Ga0070670_100192929 Ga0070670_1001929292 311
118 3300005333 Ga0070677_10013734 Ga0070677_100137343 311
119 3300005339 Ga0070660_100078971 Ga0070660_1000789711 311
120 3300005344 Ga0070661_100042332 Ga0070661_1000423322 311
121 3300005347 Ga0070668_100041632 Ga0070668_1000416321 311
122 3300005354 Ga0070675_100032034 Ga0070675_1000320343 311
123 3300005355 Ga0070671_100011048 Ga0070671_1000110485 311
124 3300005364 Ga0070673_100000190 Ga0070673_10000019020 311
125 3300005367 Ga0070667_100005386 Ga0070667_1000053864 311
126 3300005441 Ga0070700_100033854 Ga0070700_1000338541 311
127 3300005445 Ga0070708_100204059 Ga0070708_1002040592 311
128 3300005456 Ga0070678_100009382 Ga0070678_1000093826 311
129 3300005459 Ga0068867_100099863 Ga0068867_1000998632 311
130 3300005468 Ga0070707_100133588 Ga0070707_1001335882 311
131 3300005471 Ga0070698_100005632 Ga0070698_1000056321 311
132 3300005518 Ga0070699_100019759 Ga0070699_1000197593 311
133 3300005536 Ga0070697_100213019 Ga0070697_1002130191 311
134 3300005543 Ga0070672_100003057 Ga0070672_1000030578 311
135 3300005937 Ga0081455_10002420 Ga0081455_100024204 311
136 3300006028 Ga0070717_10013238 Ga0070717_100132382 311
137 3300006358 Ga0068871_100037061 Ga0068871_1000370612 311
138 3300006880 Ga0075429_100293289 Ga0075429_1002932892 311
139 3300009094 Ga0111539_10000106 Ga0111539_1000010627 311
140 3300013102 Ga0157371_10034268 Ga0157371_100342682 311
141 3300013296 Ga0157374_10023008 Ga0157374_100230081 311
142 3300013297 Ga0157378_10005614 Ga0157378_100056149 311
143 3300013306 Ga0163162_10060190 Ga0163162_100601902 311
144 3300013308 Ga0157375_10008633 Ga0157375_100086332 311
145 3300014969 Ga0157376_10008171 Ga0157376_100081716 311
146 3300025893 Ga0207682_10047502 Ga0207682_100475022 311
147 3300025903 Ga0207680_10008727 Ga0207680_100087277 311
148 3300025910 Ga0207684_10033661 Ga0207684_100336612 311
149 3300025922 Ga0207646_10142112 Ga0207646_101421122 311
150 3300025925 Ga0207650_10021823 Ga0207650_100218232 311
151 3300025933 Ga0207706_10069600 Ga0207706_100696002 311
152 3300025936 Ga0207670_10099089 Ga0207670_100990892 311
153 3300025940 Ga0207691_10000015 Ga0207691_1000001564 311
154 3300025960 Ga0207651_10000209 Ga0207651_1000020918 311
155 3300025986 Ga0207658_10155642 Ga0207658_101556422 311
156 3300026067 Ga0207678_10402404 Ga0207678_104024041 311
157 3300026089 Ga0207648_10062989 Ga0207648_100629893 311
158 3300026121 Ga0207683_10009796 Ga0207683_100097964 311
159 3300027876 Ga0209974_10027165 Ga0209974_100271652 311
160 3300031731 Ga0307405_10336638 Ga0307405_103366381 311
161 3300031903 Ga0307407_10000079 Ga0307407_100000793 311
162 3300031995 Ga0307409_100112973 Ga0307409_1001129732 311
163 3300037312 Ga0395899_0041542 Ga0395899_0041542_266_1210 311
164 3300037418 Ga0395900_0099477 Ga0395900_0099477_1411_2355 311
165 3300037466 Ga0395898_0007431 Ga0395898_0007431_2251_3195 311
166 3300038443 Ga0395901_0043810 Ga0395901_0043810_2227_3171 311
167 3300039438 Ga0436360_0907395 Ga0436360_0907395_74_1024 311
168 3300039438 Ga0436360_1110476 Ga0436360_1110476_92_1048 311
169 3300041407 Ga0439447_013582 Ga0439447_013582_341_1285 311
170 3300041410 Ga0439461_0006592 Ga0439461_0006592_780_1724 311
171 3300042010 Ga0439452_002472 Ga0439452_002472_4387_5331 311
172 3300042876 Ga0451577_0261927 Ga0451577_0261927_470_1414 311
173 3300045976 Ga0466967_0007832 Ga0466967_0007832_5377_6321 311
174 3300046522 Ga0495643_0000169 Ga0495643_0000169_36866_37801 311
175 3300048904 Ga0496101_0065825 Ga0496101_0065825_738_1682 311
176 3300048907 Ga0496104_0134300 Ga0496104_0134300_978_1922 311
177 3300048913 Ga0496110_0064310 Ga0496110_0064310_2008_2952 311
178 3300048914 Ga0496111_0049314 Ga0496111_0049314_1626_2570 311
179 3300048917 Ga0496114_0005304 Ga0496114_0005304_6119_7063 311
180 3300049513 Ga0501290_001273 Ga0501290_001273_90_1046 311
181 3300049522 Ga0501299_000039 Ga0501299_000039_4188_5144 311
182 3300049523 Ga0501300_001716 Ga0501300_001716_394_1350 311
183 3300049524 Ga0501301_001598 Ga0501301_001598_351_1307 311
184 3300049568 Ga0501031_0002023 Ga0501031_0002023_1489_2433 311
185 3300049568 Ga0501031_0052596 Ga0501031_0052596_1043_1987 311
186 3300049572 Ga0501036_0082294 Ga0501036_0082294_1118_2062 311
187 3300049573 Ga0501037_0007130 Ga0501037_0007130_2900_3844 311
188 3300049575 Ga0501039_0063489 Ga0501039_0063489_139_1083 311
189 3300049576 Ga0501040_0009799 Ga0501040_0009799_2889_3833 311
190 3300049576 Ga0501040_0061665 Ga0501040_0061665_294_1238 311
191 3300049578 Ga0501042_0002801 Ga0501042_0002801_8496_9440 311
192 3300049578 Ga0501042_0006527 Ga0501042_0006527_242_1186 311
193 3300049578 Ga0501042_0135217 Ga0501042_0135217_500_1444 311
194 3300049580 Ga0501046_0015512 Ga0501046_0015512_2791_3735 311
195 3300049580 Ga0501046_0026997 Ga0501046_0026997_3505_4446 311
196 3300049582 Ga0501048_0002048 Ga0501048_0002048_10211_11155 311
197 3300049582 Ga0501048_0007991 Ga0501048_0007991_5914_6855 311
198 3300049587 Ga0501071_0004827 Ga0501071_0004827_6461_7402 311
199 3300049587 Ga0501071_0048925 Ga0501071_0048925_1684_2628 311
200 3300049587 Ga0501071_0094633 Ga0501071_0094633_364_1308 311
201 3300049587 Ga0501071_0213950 Ga0501071_0213950_436_1380 311
202 3300049590 Ga0501074_0187964 Ga0501074_0187964_207_1151 311
203 3300049591 Ga0501075_0089613 Ga0501075_0089613_1349_2317 311
204 3300049592 Ga0501076_0038736 Ga0501076_0038736_566_1510 311
205 3300049592 Ga0501076_0102319 Ga0501076_0102319_1349_2290 311
206 3300049653 Ga0501206_001766 Ga0501206_001766_430_1386 311
207 3300049656 Ga0501209_000264 Ga0501209_000264_1045_2001 311
208 3300049667 Ga0501230_005225 Ga0501230_005225_50_1006 311
209 3300049668 Ga0501233_000414 Ga0501233_000414_3224_4180 311
210 3300049669 Ga0501235_001569 Ga0501235_001569_941_1897 311
211 3300049682 Ga0501252_000956 Ga0501252_000956_1015_1971 311
212 3300049683 Ga0501253_000437 Ga0501253_000437_715_1671 311
213 3300049689 Ga0501260_001034 Ga0501260_001034_330_1286 311
214 3300049690 Ga0501261_000426 Ga0501261_000426_1913_2869 311
215 3300049705 Ga0501225_0007281 Ga0501225_0007281_1022_1978 311
216 3300049706 Ga0501229_000410 Ga0501229_000410_2588_3544 311
217 3300049707 Ga0501234_001026 Ga0501234_001026_3384_4340 311
218 3300049708 Ga0501245_001080 Ga0501245_001080_964_1920 311
219 3300049743 Ga0501081_0153722 Ga0501081_0153722_359_1303 311
220 3300049763 Ga0501266_001234 Ga0501266_001234_2122_3078 311
221 3300049765 Ga0501268_002187 Ga0501268_002187_720_1676 311
222 3300049767 Ga0501270_000242 Ga0501270_000242_2426_3382 311
223 3300049769 Ga0501272_000190 Ga0501272_000190_1364_2320 311
224 3300049772 Ga0501275_001379 Ga0501275_001379_1440_2396 311
225 3300049774 Ga0501278_000457 Ga0501278_000457_572_1528 311
226 3300049775 Ga0501279_000352 Ga0501279_000352_422_1378 311
227 3300049776 Ga0501280_012725 Ga0501280_012725_171_1127 311
228 3300049777 Ga0501281_00508 Ga0501281_00508_83_1039 311
229 3300049778 Ga0501282_001890 Ga0501282_001890_1241_2197 311
230 3300049779 Ga0501283_000783 Ga0501283_000783_1140_2096 311
231 3300049822 Ga0501035_0013066 Ga0501035_0013066_1112_2056 311
232 3300049822 Ga0501035_0071656 Ga0501035_0071656_273_1217 311
233 3300049824 Ga0501045_0072498 Ga0501045_0072498_614_1558 311
234 3300049824 Ga0501045_0131172 Ga0501045_0131172_833_1777 311
235 3300049851 Ga0501212_009514 Ga0501212_009514_83_1039 311
236 3300049853 Ga0501226_001906 Ga0501226_001906_716_1672 311
237 3300050507 nmdc:mga05p37_51197_c1 nmdc:mga05p37_51197_c1_3656_4693 311
238 3300050514 nmdc:mga08x19_120162_c1 nmdc:mga08x19_120162_c1_631_1575 311
239 3300050515 nmdc:mga0a205_215624_c1 nmdc:mga0a205_215624_c1_298_1242 311
240 3300054114 Ga0501084_0167920 Ga0501084_0167920_110_1054 311
241 3300059503 Ga0587080_009882 Ga0587080_009882_383_1345 311
242 3300059605 Ga0587106_012960 Ga0587106_012960_53_1015 311
243 3300060344 Ga0587071_007319 Ga0587071_007319_661_1623 311
244 3300060353 Ga0501082_0255380 Ga0501082_0255380_470_1414 311
245 iso_pu_bacteria 2687453129 2687579603 311
246 iso_pu_bacteria 2952252522 2952254587 311
247 iso_pu_bacteria 8057160832 8057161219 311
248 3300003323 rootH1_10170806 rootH1_101708061 312
249 3300005289 Ga0065704_10013125 Ga0065704_100131251 312
250 3300005331 Ga0070670_100166866 Ga0070670_1001668662 312
251 3300005347 Ga0070668_100121291 Ga0070668_1001212911 312
252 3300005467 Ga0070706_100051909 Ga0070706_1000519095 312
253 3300013306 Ga0163162_10597845 Ga0163162_105978451 312
254 3300025910 Ga0207684_10061769 Ga0207684_100617693 312
255 3300039438 Ga0436360_1023826 Ga0436360_1023826_280_1227 312
256 3300044684 Ga0466966_0029763 Ga0466966_0029763_1737_2687 312
257 3300049568 Ga0501031_0213249 Ga0501031_0213249_267_1214 312
258 3300049675 Ga0501243_000123 Ga0501243_000123_5290_6255 312
259 3300053103 Ga0500555_000024 Ga0500555_000024_70736_71683 312
260 3300000545 CNXas_1000106 CNXas_10001065 313
261 3300005329 Ga0070683_100041107 Ga0070683_1000411074 313
262 3300005331 Ga0070670_100015728 Ga0070670_1000157286 313
263 3300005335 Ga0070666_10021278 Ga0070666_100212781 313
264 3300005335 Ga0070666_10180872 Ga0070666_101808721 313
265 3300005340 Ga0070689_100065032 Ga0070689_1000650321 313
266 3300005344 Ga0070661_100070941 Ga0070661_1000709412 313
267 3300005347 Ga0070668_100012873 Ga0070668_1000128733 313
268 3300005347 Ga0070668_100028775 Ga0070668_1000287752 313
269 3300005353 Ga0070669_100076901 Ga0070669_1000769012 313
270 3300005353 Ga0070669_100108636 Ga0070669_1001086361 313
271 3300005354 Ga0070675_100032733 Ga0070675_1000327334 313
272 3300005354 Ga0070675_100078142 Ga0070675_1000781423 313
273 3300005354 Ga0070675_100322279 Ga0070675_1003222791 313
274 3300005355 Ga0070671_100119363 Ga0070671_1001193632 313
275 3300005356 Ga0070674_100022529 Ga0070674_1000225292 313
276 3300005364 Ga0070673_100013363 Ga0070673_1000133632 313
277 3300005365 Ga0070688_100009586 Ga0070688_1000095865 313
278 3300005367 Ga0070667_100023650 Ga0070667_1000236504 313
279 3300005367 Ga0070667_100044018 Ga0070667_1000440183 313
280 3300005456 Ga0070678_100042899 Ga0070678_1000428995 313
281 3300005459 Ga0068867_100048819 Ga0068867_1000488194 313
282 3300005468 Ga0070707_100096132 Ga0070707_1000961322 313
283 3300005536 Ga0070697_100063983 Ga0070697_1000639832 313
284 3300005843 Ga0068860_100612658 Ga0068860_1006126581 313
285 3300006028 Ga0070717_10023732 Ga0070717_100237322 313
286 3300006358 Ga0068871_100344411 Ga0068871_1003444112 313
287 3300007788 Ga0099795_10012994 Ga0099795_100129943 313
288 3300009093 Ga0105240_10394475 Ga0105240_103944751 313
289 3300013296 Ga0157374_10057412 Ga0157374_100574122 313
290 3300013296 Ga0157374_10102088 Ga0157374_101020882 313
291 3300013296 Ga0157374_10269158 Ga0157374_102691582 313
292 3300013306 Ga0163162_10008945 Ga0163162_100089453 313
293 3300013306 Ga0163162_10125500 Ga0163162_101255001 313
294 3300013308 Ga0157375_10002587 Ga0157375_1000258715 313
295 3300013308 Ga0157375_10047550 Ga0157375_100475504 313
296 3300014325 Ga0163163_10330312 Ga0163163_103303121 313
297 3300014969 Ga0157376_10051487 Ga0157376_100514872 313
298 3300014969 Ga0157376_10093310 Ga0157376_100933102 313
299 3300021377 Ga0213874_10019978 Ga0213874_100199782 313
300 3300025315 Ga0207697_10000060 Ga0207697_1000006010 313
301 3300025315 Ga0207697_10002476 Ga0207697_100024763 313
302 3300025903 Ga0207680_10105180 Ga0207680_101051801 313
303 3300025907 Ga0207645_10026831 Ga0207645_100268313 313
304 3300025920 Ga0207649_10214188 Ga0207649_102141881 313
305 3300025925 Ga0207650_10079398 Ga0207650_100793982 313
306 3300025926 Ga0207659_10066894 Ga0207659_100668942 313
307 3300025926 Ga0207659_10094527 Ga0207659_100945272 313
308 3300025931 Ga0207644_10016131 Ga0207644_100161314 313
309 3300025937 Ga0207669_10063856 Ga0207669_100638562 313
310 3300025940 Ga0207691_10000142 Ga0207691_1000014261 313
311 3300025940 Ga0207691_10056977 Ga0207691_100569773 313
312 3300025944 Ga0207661_10480882 Ga0207661_104808821 313
313 3300025960 Ga0207651_10012260 Ga0207651_100122603 313
314 3300025986 Ga0207658_10048287 Ga0207658_100482873 313
315 3300026089 Ga0207648_10032695 Ga0207648_100326952 313
316 3300026121 Ga0207683_10001736 Ga0207683_1000173615 313
317 3300028379 Ga0268266_10016109 Ga0268266_100161097 313
318 3300039437 Ga0436365_1764954 Ga0436365_1764954_151_1107 313
319 3300039438 Ga0436360_1323800 Ga0436360_1323800_845_1795 313
320 3300039447 Ga0436361_0959265 Ga0436361_0959265_3418_4368 313
321 3300039447 Ga0436361_1148770 Ga0436361_1148770_647_1597 313
322 3300039453 Ga0436362_0924010 Ga0436362_0924010_216_1190 313
323 3300042129 Ga0450891_000817 Ga0450891_000817_1398_2387 313
324 3300042130 Ga0450892_000110 Ga0450892_000110_4917_5906 313
325 3300042532 Ga0450893_0000194 Ga0450893_0000194_1747_2736 313
326 3300049573 Ga0501037_0004003 Ga0501037_0004003_5845_6795 313
327 3300049575 Ga0501039_0004064 Ga0501039_0004064_5275_6225 313
328 3300049577 Ga0501041_0010329 Ga0501041_0010329_3699_4649 313
329 3300049578 Ga0501042_0048647 Ga0501042_0048647_709_1659 313
330 3300049822 Ga0501035_0021523 Ga0501035_0021523_1879_2829 313

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

251

324

0.88

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

111

207

0.64

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gzf-assembly1.cif.gz_A xi class gst from natrialba magadii 0.9869 21 309
3r3e-assembly1.cif.gz_B the glutathione bound structure of yqjg, a glutathione transferase homolog from escherichia coli k-12 0.9763 21 308
4uss-assembly1.cif.gz_A-2 populus trichocarpa glutathione transferase x1-1 (ghr1), complexed with glutathione 0.9751 17 309
3ppu-assembly1.cif.gz_B crystal structure of the glutathione-s-transferase xi from phanerochaete chrysosporium 0.9739 14 297
3ppu-assembly1.cif.gz_A crystal structure of the glutathione-s-transferase xi from phanerochaete chrysosporium 0.9738 8 297
ID Description Score Start End Superfamily
3r3eB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9962 153 263 1.20.1050.10
af_Q9FL98_173_337_1.20.1050.10 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9897 164 310 1.20.1050.10
af_Q54M03_6_175_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9878 4 161 3.40.30.10
3r3eB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9873 153 263 1.20.1050.10
4ptsB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9806 164 310 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A2V5PXW9-F1-model_v4 Glutathione-dependent reductase 0.9997 1 309 GO:0004364
GO:0005737
AF-A0A7C1M7Q3-F1-model_v4 Glutathione S-transferase family protein 0.9988 166 307 GO:0004364
GO:0005737
AF-A0A7W1YZG9-F1-model_v4 Glutathione S-transferase C-terminal domain-containing protein 0.9981 171 312 GO:0004364
GO:0005737
AF-A0A532DXW6-F1-model_v4 Glutathione S-transferase family protein 0.9979 1 268 GO:0004364
GO:0005737
AF-A0A369AJB2-F1-model_v4 Glutathione S-transferase-like protein 0.9976 174 299 GO:0004364
GO:0005737

Feature Viewer

pLDDT pTM Quality
95.22 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map