F410035

General Info

Members Datasets Scaffolds Average Seq Length
330 199 325 272

Family's Representative Sequence

Representative Sequence 3300006195|Ga0075366_10098313|Ga0075366_100983133
Length 319
Sequence MQPPRDVHVAAWAQLKEPIMQIRVGYELVYDCPQPTPMMLMLNIHYTRAADIVVPDHLVTSPVIPVASYRDGFGNWCSRLVAPKGQVRISTSAVLNDSGAPETIARSAEQHAVQDLPDECLQFLLGSRYCETDRLSETAWALFGKTPTGAARVQAICDYVHRRIAFGYENARSTKTAWEAFNEKKGVCRDYAHLAIAFCRCMNIPARYCTGYLGDIGVPPPYGPMDFAAWFEAYVGGAWHVFDPRNNVPRIGRVLIARGRDATDVAISNTFGPNTLLGFKVVTDEVDVPAPVFGPPTIGSGDLAGHAGAGQHGTAVPPV

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
3 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
4 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
5 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
6 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
106 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
109 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
110 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
111 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
112 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
113 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
114 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
115 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
116 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
117 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
120 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
123 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
124 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
125 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
126 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
127 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
128 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
129 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
134 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
135 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
136 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
137 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
140 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
144 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
147 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
155 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
156 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
157 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
163 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
172 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
181 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
182 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
183 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
186 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
190 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
191 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
192 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
193 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
194 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
195 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
196 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
197 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
198 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.67
Metatranscriptomes 1.82
Isolates 1.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.24
Nodule 0
Rhizoplane 2.42
Rhizosphere 89.39
Stem 0
Stem Tuber 0
Unclassified 3.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1000775 3300001976 Bacteria 4296
2 JGI24751J29686_10017713 3300002459 Bacteria 1471
3 Ga0055530_10001918 3300003791 Bacteria 14199
4 Ga0065707_10089203 3300005295 Bacteria 4439
5 Ga0070683_100008146 3300005329 Bacteria 8903
6 Ga0070690_100046208 3300005330 Bacteria 2768
7 Ga0070690_100600829 3300005330 Bacteria 835
8 Ga0070670_100009872 3300005331 Bacteria 8152
9 Ga0070666_10000500 3300005335 Bacteria 23605
10 Ga0070668_100001821 3300005347 Bacteria 15511
11 Ga0070668_100008138 3300005347 Bacteria 7790
12 Ga0070668_100082271 3300005347 Bacteria 2525
13 Ga0070669_100000018 3300005353 Bacteria 195789
14 Ga0070675_100064051 3300005354 Bacteria 3039
15 Ga0070675_100166542 3300005354 Bacteria 1898
16 Ga0070671_100000011 3300005355 Bacteria 202057
17 Ga0070673_100007947 3300005364 Bacteria 7029
18 Ga0070667_100051359 3300005367 Bacteria 3476
19 Ga0070709_10035194 3300005434 Bacteria 3042
20 Ga0070713_100418440 3300005436 Bacteria 1254
21 Ga0070705_100111605 3300005440 Bacteria 1748
22 Ga0070700_100177013 3300005441 Bacteria 1481
23 Ga0070708_100064078 3300005445 Bacteria 3292
24 Ga0070708_100492589 3300005445 Bacteria 1156
25 Ga0070708_100802187 3300005445 Bacteria 885
26 Ga0068867_100040533 3300005459 Bacteria 3400
27 Ga0068867_100165214 3300005459 Bacteria 1748
28 Ga0070707_100353376 3300005468 Bacteria 1427
29 Ga0070684_100004562 3300005535 Bacteria 10553
30 Ga0070672_100159505 3300005543 Bacteria 1870
31 Ga0070672_100270448 3300005543 Bacteria 1435
32 Ga0070686_100229150 3300005544 Bacteria 1347
33 Ga0070665_100063229 3300005548 Bacteria 3711
34 Ga0070665_100181153 3300005548 Bacteria 2108
35 Ga0070664_100035979 3300005564 Bacteria 4158
36 Ga0068856_100200264 3300005614 Bacteria 2011
37 Ga0068859_100001999 3300005617 Bacteria 20813
38 Ga0068859_100138176 3300005617 Bacteria 2510
39 Ga0068864_100000173 3300005618 Bacteria 59516
40 Ga0068864_100124009 3300005618 Bacteria 2313
41 Ga0068864_100146093 3300005618 Bacteria 2138
42 Ga0068864_100317469 3300005618 Bacteria 1462
43 Ga0068866_10008787 3300005718 Bacteria 4267
44 Ga0068861_100058670 3300005719 Bacteria 2944
45 Ga0068861_100094886 3300005719 Bacteria 2361
46 Ga0068861_100311098 3300005719 Bacteria 1368
47 Ga0068870_10236908 3300005840 Bacteria 1125
48 Ga0068863_100013167 3300005841 Bacteria 7980
49 Ga0068858_100000913 3300005842 Bacteria 30617
50 Ga0068858_100189797 3300005842 Bacteria 1942
51 Ga0068860_100003011 3300005843 Bacteria 17409
52 Ga0068860_100008683 3300005843 Bacteria 10122
53 Ga0068862_100001414 3300005844 Bacteria 22242
54 Ga0068862_100027190 3300005844 Bacteria 4814
55 Ga0068862_100231405 3300005844 Bacteria 1677
56 Ga0068862_100287533 3300005844 Bacteria 1509
57 Ga0081455_10000940 3300005937 Bacteria 37224
58 Ga0075367_10121015 3300006178 Bacteria 1613
59 Ga0075366_10098313 3300006195 Bacteria 1756
60 Ga0097621_100466081 3300006237 Bacteria 1140
61 Ga0075430_100130676 3300006846 Bacteria 2093
62 Ga0075434_100033203 3300006871 Bacteria 5092
63 Ga0068865_100042428 3300006881 Bacteria 3102
64 Ga0068865_100397192 3300006881 Bacteria 1128
65 Ga0097620_100001999 3300006931 Bacteria 20813
66 Ga0097620_100138170 3300006931 Bacteria 2510
67 Ga0075435_100119474 3300007076 Bacteria 2198
68 Ga0099794_10016126 3300007265 Bacteria 3309
69 Ga0099794_10023505 3300007265 Bacteria 2820
70 Ga0099794_10083691 3300007265 Bacteria 1577
71 Ga0099795_10000171 3300007788 Bacteria 10747
72 Ga0111539_10345603 3300009094 Bacteria 1731
73 Ga0111539_10511404 3300009094 Bacteria 1399
74 Ga0105247_10004029 3300009101 Bacteria 9453
75 Ga0105247_10005562 3300009101 Bacteria 7918
76 Ga0105243_10008625 3300009148 Bacteria 7820
77 Ga0105248_10015082 3300009177 Bacteria 8510
78 Ga0105248_10053381 3300009177 Bacteria 4536
79 Ga0105248_10078688 3300009177 Bacteria 3706
80 Ga0105248_10830021 3300009177 Bacteria 1043
81 Ga0105249_10004797 3300009553 Bacteria 11672
82 Ga0099796_10000093 3300010159 Bacteria 14500
83 Ga0105239_10075015 3300010375 Bacteria 3718
84 Ga0157374_10545804 3300013296 Bacteria 1167
85 Ga0163162_10003541 3300013306 Bacteria 14939
86 Ga0157375_10037064 3300013308 Bacteria 4669
87 Ga0163163_10013544 3300014325 Bacteria 7472
88 Ga0163163_10277315 3300014325 Bacteria 1728
89 Ga0157380_10029344 3300014326 Bacteria 4204
90 Ga0157379_10002210 3300014968 Bacteria 16189
91 Ga0157376_10020438 3300014969 Bacteria 5122
92 Ga0157376_10175259 3300014969 Bacteria 1956
93 Ga0157376_10728883 3300014969 Bacteria 999
94 Ga0209026_1002042 3300025250 Bacteria 7979
95 Ga0207697_10000382 3300025315 Bacteria 24836
96 Ga0207653_10004410 3300025885 Bacteria 4410
97 Ga0207692_10064218 3300025898 Bacteria 1911
98 Ga0207642_10024497 3300025899 Bacteria 2426
99 Ga0207710_10004201 3300025900 Bacteria 6312
100 Ga0207710_10016256 3300025900 Bacteria 3147
101 Ga0207680_10002061 3300025903 Bacteria 9413
102 Ga0207645_10001196 3300025907 Bacteria 21420
103 Ga0207645_10019249 3300025907 Bacteria 4477
104 Ga0207643_10046783 3300025908 Bacteria 2446
105 Ga0207684_10090073 3300025910 Bacteria 2614
106 Ga0207663_10488972 3300025916 Bacteria 954
107 Ga0207646_10085786 3300025922 Bacteria 2816
108 Ga0207681_10000008 3300025923 Bacteria 414329
109 Ga0207650_10057901 3300025925 Bacteria 2883
110 Ga0207650_10068871 3300025925 Unclassified 2658
111 Ga0207659_10021339 3300025926 Bacteria 4297
112 Ga0207644_10000006 3300025931 Bacteria 408793
113 Ga0207706_10284068 3300025933 Bacteria 1443
114 Ga0207704_10026753 3300025938 Bacteria 3170
115 Ga0207704_10132270 3300025938 Bacteria 1730
116 Ga0207665_10177652 3300025939 Bacteria 1540
117 Ga0207691_10042895 3300025940 Bacteria 4170
118 Ga0207711_10035713 3300025941 Bacteria 4215
119 Ga0207711_10050780 3300025941 Bacteria 3551
120 Ga0207711_10082075 3300025941 Bacteria 2817
121 Ga0207689_10002060 3300025942 Bacteria 18979
122 Ga0207712_10002115 3300025961 Bacteria 12984
123 Ga0207668_10000484 3300025972 Bacteria 24948
124 Ga0207668_10012776 3300025972 Bacteria 5150
125 Ga0207668_10013884 3300025972 Bacteria 4973
126 Ga0207668_10401468 3300025972 Bacteria 1159
127 Ga0207658_10011170 3300025986 Bacteria 6116
128 Ga0207703_10000690 3300026035 Bacteria 33405
129 Ga0207702_10434221 3300026078 Bacteria 1271
130 Ga0207641_10003636 3300026088 Bacteria 13595
131 Ga0207641_10142516 3300026088 Bacteria 2164
132 Ga0207648_10001404 3300026089 Bacteria 26508
133 Ga0207648_10086482 3300026089 Bacteria 2735
134 Ga0207676_10004358 3300026095 Bacteria 10008
135 Ga0207676_10287405 3300026095 Bacteria 1496
136 Ga0207674_10161233 3300026116 Bacteria 2197
137 Ga0207675_100002076 3300026118 Bacteria 19921
138 Ga0207675_100008737 3300026118 Bacteria 9516
139 Ga0207683_10279636 3300026121 Bacteria 1525
140 Ga0209179_1014489 3300027512 Bacteria 1449
141 Ga0265356_1002799 3300028017 Bacteria 2258
142 Ga0268266_10021358 3300028379 Bacteria 5515
143 Ga0268265_10000064 3300028380 Bacteria 144164
144 Ga0268265_10002438 3300028380 Bacteria 14024
145 Ga0268265_10418357 3300028380 Bacteria 1244
146 Ga0268264_10000010 3300028381 Bacteria 596543
147 Ga0268264_10000055 3300028381 Bacteria 314947
148 Ga0265318_10000167 3300028577 Bacteria 58161
149 Ga0265318_10000177 3300028577 Bacteria 56517
150 Ga0265318_10002111 3300028577 Bacteria 10854
151 Ga0265318_10057439 3300028577 Bacteria 1454
152 Ga0307517_10122176 3300028786 Bacteria 1920
153 Ga0265338_10133305 3300028800 Bacteria 1957
154 Ga0265330_10000083 3300031235 Bacteria 79358
155 Ga0265330_10000868 3300031235 Bacteria 18881
156 Ga0265330_10050600 3300031235 Bacteria 1822
157 Ga0265330_10071508 3300031235 Bacteria 1501
158 Ga0265330_10086802 3300031235 Bacteria 1345
159 Ga0265332_10000290 3300031238 Bacteria 39493
160 Ga0265332_10000400 3300031238 Bacteria 31440
161 Ga0265332_10001878 3300031238 Bacteria 11164
162 Ga0265332_10008961 3300031238 Bacteria 4474
163 Ga0265328_10001065 3300031239 Bacteria 12645
164 Ga0265328_10056405 3300031239 Bacteria 1442
165 Ga0265320_10000083 3300031240 Bacteria 79436
166 Ga0265320_10000867 3300031240 Bacteria 22866
167 Ga0265325_10000212 3300031241 Bacteria 41485
168 Ga0265325_10004884 3300031241 Bacteria 8376
169 Ga0265325_10174842 3300031241 Bacteria 1003
170 Ga0265329_10000042 3300031242 Bacteria 53592
171 Ga0265329_10013223 3300031242 Bacteria 2949
172 Ga0265340_10000569 3300031247 Bacteria 20525
173 Ga0265340_10001921 3300031247 Bacteria 11875
174 Ga0265340_10003109 3300031247 Bacteria 9414
175 Ga0265340_10007479 3300031247 Bacteria 5930
176 Ga0265339_10000152 3300031249 Bacteria 57034
177 Ga0265339_10011579 3300031249 Bacteria 5420
178 Ga0265331_10000173 3300031250 Bacteria 79421
179 Ga0265331_10000539 3300031250 Bacteria 34679
180 Ga0265327_10000382 3300031251 Bacteria 83557
181 Ga0265316_10000739 3300031344 Bacteria 36142
182 Ga0265316_10001754 3300031344 Bacteria 22947
183 Ga0265316_10002128 3300031344 Bacteria 20811
184 Ga0265316_10014938 3300031344 Bacteria 6810
185 Ga0265316_10062218 3300031344 Bacteria 2897
186 Ga0265316_10227880 3300031344 Bacteria 1373
187 Ga0265313_10000422 3300031595 Bacteria 45310
188 Ga0265313_10000530 3300031595 Bacteria 39902
189 Ga0265313_10000731 3300031595 Bacteria 33776
190 Ga0265313_10006377 3300031595 Bacteria 8383
191 Ga0316579_10001517 3300031691 Bacteria 8446
192 Ga0316579_10007811 3300031691 Bacteria 4432
193 Ga0316579_10030540 3300031691 Bacteria 2463
194 Ga0316579_10039829 3300031691 Bacteria 2178
195 Ga0316579_10076743 3300031691 Bacteria 1588
196 Ga0316579_10160520 3300031691 Bacteria 1086
197 Ga0265314_10000217 3300031711 Bacteria 85291
198 Ga0265314_10000254 3300031711 Bacteria 79030
199 Ga0265314_10001482 3300031711 Bacteria 26124
200 Ga0265314_10147482 3300031711 Bacteria 1447
201 Ga0265342_10000199 3300031712 Bacteria 67101
202 Ga0265342_10003613 3300031712 Bacteria 12602
203 Ga0265342_10008980 3300031712 Bacteria 7099
204 Ga0265342_10017898 3300031712 Bacteria 4600
205 Ga0265342_10029659 3300031712 Bacteria 3395
206 Ga0316576_10023129 3300031727 Bacteria 4325
207 Ga0316576_10027923 3300031727 Bacteria 3971
208 Ga0316576_10051034 3300031727 Bacteria 3009
209 Ga0316576_10117110 3300031727 Bacteria 1999
210 Ga0316576_10201977 3300031727 Bacteria 1497
211 Ga0316578_10000061 3300031728 Bacteria 23517
212 Ga0316578_10010953 3300031728 Bacteria 4725
213 Ga0316578_10028132 3300031728 Bacteria 3182
214 Ga0316578_10094925 3300031728 Bacteria 1784
215 Ga0316578_10100669 3300031728 Bacteria 1732
216 Ga0316578_10123284 3300031728 Bacteria 1558
217 Ga0316578_10198808 3300031728 Bacteria 1207
218 Ga0307516_10000706 3300031730 Bacteria 45397
219 Ga0307516_10008009 3300031730 Bacteria 12025
220 Ga0307516_10305358 3300031730 Bacteria 1266
221 Ga0316577_10000796 3300031733 Bacteria 13637
222 Ga0316577_10018709 3300031733 Bacteria 3832
223 Ga0316577_10200963 3300031733 Bacteria 1126
224 Ga0316583_10005744 3300032133 Bacteria 4459
225 Ga0316583_10026012 3300032133 Bacteria 2088
226 Ga0316580_10032780 3300032139 Bacteria 1608
227 Ga0316580_10078323 3300032139 Bacteria 1011
228 Ga0316593_10028468 3300032168 Bacteria 1801
229 Ga0316592_1007929 3300033524 Bacteria 2083
230 Ga0316588_1001119 3300033528 Bacteria 4256
231 Ga0316588_1013931 3300033528 Bacteria 1753
232 Ga0316588_1023692 3300033528 Bacteria 1410
233 Ga0316596_1023132 3300033541 Bacteria 1590
234 Ga0373934_0038814 3300035086 Bacteria 1876
235 Ga0373953_0022984 3300035117 Bacteria 2357
236 Ga0373954_0084080 3300035118 Bacteria 1523
237 Ga0373956_0017344 3300035119 Bacteria 3035
238 Ga0373957_0008337 3300035120 Bacteria 3351
239 Ga0373955_0010090 3300035172 Bacteria 4447
240 Ga0373955_0168846 3300035172 Bacteria 1294
241 Ga0316574_0001614 3300035398 Bacteria 10820
242 Ga0316574_0004979 3300035398 Bacteria 7043
243 Ga0316574_0011136 3300035398 Bacteria 5103
244 Ga0316574_0056296 3300035398 Bacteria 2460
245 Ga0316574_0256492 3300035398 Bacteria 1117
246 Ga0373933_0020949 3300035724 Bacteria 3708
247 Ga0373933_0130539 3300035724 Bacteria 1580
248 Ga0373933_0166074 3300035724 Bacteria 1403
249 Ga0373933_0166826 3300035724 Bacteria 1400
250 Ga0373947_0063683 3300035725 Bacteria 2247
251 Ga0373937_0002807 3300036401 Bacteria 14561
252 Ga0373937_0078079 3300036401 Bacteria 3059
253 Ga0373937_0101240 3300036401 Bacteria 2674
254 Ga0373937_0601458 3300036401 Bacteria 1044
255 Ga0316582_0025163 3300036647 Bacteria 3571
256 Ga0316582_0036788 3300036647 Bacteria 3031
257 Ga0316582_0148902 3300036647 Bacteria 1581
258 Ga0316582_0241638 3300036647 Bacteria 1237
259 Ga0316584_0004430 3300036712 Bacteria 9303
260 Ga0316584_0008459 3300036712 Bacteria 7093
261 Ga0316584_0009740 3300036712 Bacteria 6686
262 Ga0316584_0038667 3300036712 Bacteria 3550
263 Ga0316584_0050821 3300036712 Bacteria 3099
264 Ga0373925_0083671 3300037068 Bacteria 2431
265 Ga0373925_0170330 3300037068 Bacteria 1719
266 Ga0316581_0017481 3300037588 Bacteria 2072
267 Ga0436361_0340017 3300039447 Bacteria 3258
268 Ga0495638_0007754 3300046460 Bacteria 7664
269 Ga0495651_0005964 3300046462 Bacteria 9293
270 Ga0495664_0133459 3300046477 Bacteria 1504
271 Ga0495664_0225485 3300046477 Bacteria 1134
272 Ga0495608_0092970 3300046511 Bacteria 1949
273 Ga0495648_0024099 3300046524 Bacteria 4154
274 Ga0495667_0112971 3300046559 Bacteria 1755
275 Ga0495634_0000873 3300046642 Bacteria 29017
276 Ga0495634_0120943 3300046642 Bacteria 1677
277 Ga0495635_0017326 3300046663 Bacteria 5033
278 Ga0495588_0110162 3300046674 Bacteria 1450
279 Ga0495657_0263292 3300046675 Bacteria 1035
280 Ga0495658_0249018 3300046683 Bacteria 1117
281 Ga0495674_0000487 3300047319 Bacteria 36181
282 Ga0495680_0024492 3300047322 Bacteria 5007
283 Ga0495684_0041073 3300047471 Bacteria 3545
284 Ga0495686_0027364 3300047472 Bacteria 3724
285 Ga0495602_0281723 3300048088 Bacteria 1224
286 Ga0496101_0088294 3300048904 Bacteria 2303
287 Ga0496102_0427347 3300048905 Bacteria 1244
288 Ga0496104_0083316 3300048907 Bacteria 3050
289 Ga0496104_0117378 3300048907 Bacteria 2554
290 Ga0496106_0160791 3300048909 Bacteria 1776
291 Ga0496110_0093144 3300048913 Bacteria 2697
292 Ga0496112_0133307 3300048915 Bacteria 2455
293 Ga0496114_0565081 3300048917 Bacteria 1004
294 Ga0496119_0010555 3300048922 Bacteria 7755
295 Ga0496120_0104422 3300048923 Bacteria 1491
296 Ga0496121_0009911 3300048924 Bacteria 10843
297 Ga0496124_0415706 3300048927 Bacteria 929
298 Ga0501037_0071043 3300049573 Bacteria 2533
299 Ga0501038_0177044 3300049574 Bacteria 1723
300 Ga0501047_0021412 3300049581 Bacteria 6206
301 Ga0501073_0240439 3300049589 Bacteria 1250
302 Ga0501080_0079066 3300049742 Bacteria 3058
303 Ga0501080_0131704 3300049742 Bacteria 2315
304 Ga0501083_0000802 3300049744 Bacteria 20586
305 nmdc:mga00v17_158914_c1 3300050491 Bacteria 1454
306 nmdc:mga0k408_30187_c1 3300050493 Bacteria 3089
307 nmdc:mga06z11_63802_c1 3300050494 Bacteria 1928
308 nmdc:mga0n895_118119_c1 3300050512 Bacteria 2672
309 nmdc:mga0n895_770080_c1 3300050512 Bacteria 954
310 nmdc:mga0rr50_105919_c1 3300050513 Bacteria 2218
311 nmdc:mga08x19_14716_c1 3300050514 Bacteria 4751
312 nmdc:mga0a205_177786_c1 3300050515 Bacteria 2023
313 Ga0495601_0015605 3300053077 Bacteria 4592
314 Ga0495601_0044383 3300053077 Bacteria 2794
315 Ga0495595_0045554 3300053084 Bacteria 2018
316 Ga0495619_0266306 3300053085 Bacteria 1187
317 Ga0500578_0091936 3300053086 Bacteria 1925
318 Ga0500643_054555 3300053087 Bacteria 1134
319 Ga0500641_0007131 3300053096 Bacteria 3979
320 Ga0500562_020571 3300053108 Bacteria 1713
321 Ga0500652_022177 3300053131 Bacteria 2401
322 Ga0500616_0009618 3300053153 Bacteria 5863
323 Ga0500622_0040146 3300053156 Bacteria 2437
324 Ga0500645_000559 3300053730 Bacteria 24493
325 Ga0501082_0081944 3300060353 Bacteria 2784

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031235 Ga0265330_10086802 Ga0265330_100868021 241
2 3300009148 Ga0105243_10008625 Ga0105243_100086255 247
3 3300005543 Ga0070672_100159505 Ga0070672_1001595052 249
4 3300005544 Ga0070686_100229150 Ga0070686_1002291502 249
5 3300005617 Ga0068859_100138176 Ga0068859_1001381763 249
6 3300005618 Ga0068864_100124009 Ga0068864_1001240093 249
7 3300005842 Ga0068858_100189797 Ga0068858_1001897972 249
8 3300006881 Ga0068865_100397192 Ga0068865_1003971922 249
9 3300006931 Ga0097620_100138170 Ga0097620_1001381703 249
10 3300014325 Ga0163163_10277315 Ga0163163_102773152 249
11 3300014326 Ga0157380_10029344 Ga0157380_100293443 249
12 3300035398 Ga0316574_0256492 Ga0316574_0256492_310_1080 249
13 3300036647 Ga0316582_0025163 Ga0316582_0025163_2182_2958 249
14 3300037588 Ga0316581_0017481 Ga0316581_0017481_755_1531 249
15 3300049742 Ga0501080_0079066 Ga0501080_0079066_1024_1830 255
16 iso_pu_bacteria 2885366525 2885371700 255
17 3300005330 Ga0070690_100046208 Ga0070690_1000462082 257
18 3300005354 Ga0070675_100166542 Ga0070675_1001665422 257
19 3300005459 Ga0068867_100165214 Ga0068867_1001652142 257
20 3300005718 Ga0068866_10008787 Ga0068866_100087874 257
21 3300005719 Ga0068861_100094886 Ga0068861_1000948862 257
22 3300025899 Ga0207642_10024497 Ga0207642_100244973 257
23 3300025907 Ga0207645_10019249 Ga0207645_100192495 257
24 3300025938 Ga0207704_10132270 Ga0207704_101322702 257
25 3300025942 Ga0207689_10002060 Ga0207689_100020602 257
26 3300026089 Ga0207648_10001404 Ga0207648_100014042 257
27 3300026118 Ga0207675_100008737 Ga0207675_10000873710 257
28 3300031691 Ga0316579_10030540 Ga0316579_100305401 258
29 3300049744 Ga0501083_0000802 Ga0501083_0000802_12253_13059 261
30 3300060353 Ga0501082_0081944 Ga0501082_0081944_1865_2671 261
31 3300007265 Ga0099794_10016126 Ga0099794_100161261 263
32 3300037068 Ga0373925_0083671 Ga0373925_0083671_1107_1910 263
33 3300046683 Ga0495658_0249018 Ga0495658_0249018_166_969 263
34 3300048904 Ga0496101_0088294 Ga0496101_0088294_1071_1868 263
35 3300048909 Ga0496106_0160791 Ga0496106_0160791_45_842 263
36 3300048917 Ga0496114_0565081 Ga0496114_0565081_173_994 263
37 iso_pu_bacteria 2511231003 2511250384 263
38 iso_pu_bacteria 2738541281 2738746499 263
39 iso_pu_bacteria 2738543032 2739355729 263
40 iso_pu_bacteria 2842698319 2842701603 263
41 3300005844 Ga0068862_100231405 Ga0068862_1002314051 264
42 3300046674 Ga0495588_0110162 Ga0495588_0110162_75_899 265
43 3300003791 Ga0055530_10001918 Ga0055530_1000191812 266
44 3300005347 Ga0070668_100001821 Ga0070668_1000018212 266
45 3300005843 Ga0068860_100008683 Ga0068860_1000086835 266
46 3300005844 Ga0068862_100027190 Ga0068862_1000271904 266
47 3300009177 Ga0105248_10015082 Ga0105248_100150829 266
48 3300025250 Ga0209026_1002042 Ga0209026_10020425 266
49 3300025972 Ga0207668_10013884 Ga0207668_100138842 266
50 3300028380 Ga0268265_10002438 Ga0268265_100024384 266
51 3300028381 Ga0268264_10000055 Ga0268264_100000558 266
52 3300028786 Ga0307517_10122176 Ga0307517_101221762 266
53 3300031727 Ga0316576_10117110 Ga0316576_101171102 266
54 3300001976 JGI24752J21851_1000775 JGI24752J21851_10007754 267
55 3300002459 JGI24751J29686_10017713 JGI24751J29686_100177131 267
56 3300005295 Ga0065707_10089203 Ga0065707_100892034 267
57 3300005329 Ga0070683_100008146 Ga0070683_1000081464 267
58 3300005330 Ga0070690_100600829 Ga0070690_1006008291 267
59 3300005331 Ga0070670_100009872 Ga0070670_1000098723 267
60 3300005335 Ga0070666_10000500 Ga0070666_1000050011 267
61 3300005347 Ga0070668_100008138 Ga0070668_1000081382 267
62 3300005347 Ga0070668_100082271 Ga0070668_1000822714 267
63 3300005353 Ga0070669_100000018 Ga0070669_100000018173 267
64 3300005354 Ga0070675_100064051 Ga0070675_1000640512 267
65 3300005355 Ga0070671_100000011 Ga0070671_10000001125 267
66 3300005364 Ga0070673_100007947 Ga0070673_1000079474 267
67 3300005367 Ga0070667_100051359 Ga0070667_1000513594 267
68 3300005434 Ga0070709_10035194 Ga0070709_100351942 267
69 3300005436 Ga0070713_100418440 Ga0070713_1004184401 267
70 3300005440 Ga0070705_100111605 Ga0070705_1001116052 267
71 3300005441 Ga0070700_100177013 Ga0070700_1001770132 267
72 3300005445 Ga0070708_100064078 Ga0070708_1000640782 267
73 3300005445 Ga0070708_100492589 Ga0070708_1004925892 267
74 3300005445 Ga0070708_100802187 Ga0070708_1008021871 267
75 3300005459 Ga0068867_100040533 Ga0068867_1000405334 267
76 3300005468 Ga0070707_100353376 Ga0070707_1003533762 267
77 3300005535 Ga0070684_100004562 Ga0070684_1000045626 267
78 3300005543 Ga0070672_100270448 Ga0070672_1002704482 267
79 3300005548 Ga0070665_100063229 Ga0070665_1000632292 267
80 3300005548 Ga0070665_100181153 Ga0070665_1001811532 267
81 3300005564 Ga0070664_100035979 Ga0070664_1000359794 267
82 3300005614 Ga0068856_100200264 Ga0068856_1002002641 267
83 3300005617 Ga0068859_100001999 Ga0068859_10000199913 267
84 3300005618 Ga0068864_100000173 Ga0068864_10000017326 267
85 3300005618 Ga0068864_100146093 Ga0068864_1001460932 267
86 3300005618 Ga0068864_100317469 Ga0068864_1003174692 267
87 3300005719 Ga0068861_100058670 Ga0068861_1000586702 267
88 3300005719 Ga0068861_100311098 Ga0068861_1003110982 267
89 3300005840 Ga0068870_10236908 Ga0068870_102369082 267
90 3300005841 Ga0068863_100013167 Ga0068863_1000131672 267
91 3300005842 Ga0068858_100000913 Ga0068858_10000091316 267
92 3300005843 Ga0068860_100003011 Ga0068860_1000030113 267
93 3300005844 Ga0068862_100001414 Ga0068862_10000141415 267
94 3300005844 Ga0068862_100287533 Ga0068862_1002875332 267
95 3300005937 Ga0081455_10000940 Ga0081455_1000094028 267
96 3300006178 Ga0075367_10121015 Ga0075367_101210152 267
97 3300006195 Ga0075366_10098313 Ga0075366_100983133 267
98 3300006237 Ga0097621_100466081 Ga0097621_1004660812 267
99 3300006846 Ga0075430_100130676 Ga0075430_1001306763 267
100 3300006871 Ga0075434_100033203 Ga0075434_1000332033 267
101 3300006881 Ga0068865_100042428 Ga0068865_1000424283 267
102 3300006931 Ga0097620_100001999 Ga0097620_10000199913 267
103 3300007076 Ga0075435_100119474 Ga0075435_1001194742 267
104 3300007265 Ga0099794_10023505 Ga0099794_100235052 267
105 3300007265 Ga0099794_10083691 Ga0099794_100836912 267
106 3300007788 Ga0099795_10000171 Ga0099795_100001719 267
107 3300009094 Ga0111539_10345603 Ga0111539_103456032 267
108 3300009094 Ga0111539_10511404 Ga0111539_105114042 267
109 3300009101 Ga0105247_10004029 Ga0105247_100040297 267
110 3300009101 Ga0105247_10005562 Ga0105247_100055622 267
111 3300009177 Ga0105248_10053381 Ga0105248_100533816 267
112 3300009177 Ga0105248_10078688 Ga0105248_100786885 267
113 3300009177 Ga0105248_10830021 Ga0105248_108300211 267
114 3300009553 Ga0105249_10004797 Ga0105249_1000479711 267
115 3300010159 Ga0099796_10000093 Ga0099796_1000009313 267
116 3300010375 Ga0105239_10075015 Ga0105239_100750152 267
117 3300013296 Ga0157374_10545804 Ga0157374_105458042 267
118 3300013306 Ga0163162_10003541 Ga0163162_1000354114 267
119 3300013308 Ga0157375_10037064 Ga0157375_100370645 267
120 3300014325 Ga0163163_10013544 Ga0163163_100135449 267
121 3300014968 Ga0157379_10002210 Ga0157379_100022105 267
122 3300014969 Ga0157376_10020438 Ga0157376_100204384 267
123 3300014969 Ga0157376_10175259 Ga0157376_101752592 267
124 3300014969 Ga0157376_10728883 Ga0157376_107288832 267
125 3300025315 Ga0207697_10000382 Ga0207697_1000038219 267
126 3300025885 Ga0207653_10004410 Ga0207653_100044102 267
127 3300025898 Ga0207692_10064218 Ga0207692_100642181 267
128 3300025900 Ga0207710_10004201 Ga0207710_100042015 267
129 3300025900 Ga0207710_10016256 Ga0207710_100162562 267
130 3300025903 Ga0207680_10002061 Ga0207680_1000206111 267
131 3300025907 Ga0207645_10001196 Ga0207645_1000119614 267
132 3300025908 Ga0207643_10046783 Ga0207643_100467831 267
133 3300025910 Ga0207684_10090073 Ga0207684_100900732 267
134 3300025916 Ga0207663_10488972 Ga0207663_104889721 267
135 3300025922 Ga0207646_10085786 Ga0207646_100857862 267
136 3300025923 Ga0207681_10000008 Ga0207681_10000008395 267
137 3300025925 Ga0207650_10057901 Ga0207650_100579014 267
138 3300025925 Ga0207650_10068871 Ga0207650_100688714 267
139 3300025926 Ga0207659_10021339 Ga0207659_100213392 267
140 3300025931 Ga0207644_10000006 Ga0207644_10000006387 267
141 3300025933 Ga0207706_10284068 Ga0207706_102840682 267
142 3300025938 Ga0207704_10026753 Ga0207704_100267533 267
143 3300025939 Ga0207665_10177652 Ga0207665_101776522 267
144 3300025940 Ga0207691_10042895 Ga0207691_100428954 267
145 3300025941 Ga0207711_10035713 Ga0207711_100357132 267
146 3300025941 Ga0207711_10050780 Ga0207711_100507802 267
147 3300025941 Ga0207711_10082075 Ga0207711_100820752 267
148 3300025961 Ga0207712_10002115 Ga0207712_1000211512 267
149 3300025972 Ga0207668_10000484 Ga0207668_1000048416 267
150 3300025972 Ga0207668_10012776 Ga0207668_100127762 267
151 3300025972 Ga0207668_10401468 Ga0207668_104014682 267
152 3300025986 Ga0207658_10011170 Ga0207658_100111706 267
153 3300026035 Ga0207703_10000690 Ga0207703_1000069029 267
154 3300026078 Ga0207702_10434221 Ga0207702_104342211 267
155 3300026088 Ga0207641_10003636 Ga0207641_1000363617 267
156 3300026088 Ga0207641_10142516 Ga0207641_101425163 267
157 3300026089 Ga0207648_10086482 Ga0207648_100864822 267
158 3300026095 Ga0207676_10004358 Ga0207676_100043587 267
159 3300026095 Ga0207676_10287405 Ga0207676_102874051 267
160 3300026116 Ga0207674_10161233 Ga0207674_101612333 267
161 3300026118 Ga0207675_100002076 Ga0207675_10000207612 267
162 3300026121 Ga0207683_10279636 Ga0207683_102796362 267
163 3300027512 Ga0209179_1014489 Ga0209179_10144891 267
164 3300028017 Ga0265356_1002799 Ga0265356_10027992 267
165 3300028379 Ga0268266_10021358 Ga0268266_100213584 267
166 3300028380 Ga0268265_10000064 Ga0268265_1000006423 267
167 3300028380 Ga0268265_10418357 Ga0268265_104183572 267
168 3300028381 Ga0268264_10000010 Ga0268264_10000010180 267
169 3300028577 Ga0265318_10000167 Ga0265318_1000016725 267
170 3300028577 Ga0265318_10000177 Ga0265318_1000017742 267
171 3300028577 Ga0265318_10002111 Ga0265318_100021113 267
172 3300028577 Ga0265318_10057439 Ga0265318_100574391 267
173 3300028800 Ga0265338_10133305 Ga0265338_101333052 267
174 3300031235 Ga0265330_10000083 Ga0265330_1000008331 267
175 3300031235 Ga0265330_10000868 Ga0265330_100008687 267
176 3300031235 Ga0265330_10050600 Ga0265330_100506002 267
177 3300031235 Ga0265330_10071508 Ga0265330_100715083 267
178 3300031238 Ga0265332_10000290 Ga0265332_100002902 267
179 3300031238 Ga0265332_10000400 Ga0265332_1000040017 267
180 3300031238 Ga0265332_10001878 Ga0265332_100018786 267
181 3300031238 Ga0265332_10008961 Ga0265332_100089612 267
182 3300031239 Ga0265328_10001065 Ga0265328_100010659 267
183 3300031239 Ga0265328_10056405 Ga0265328_100564052 267
184 3300031240 Ga0265320_10000083 Ga0265320_1000008325 267
185 3300031240 Ga0265320_10000867 Ga0265320_100008676 267
186 3300031241 Ga0265325_10000212 Ga0265325_100002122 267
187 3300031241 Ga0265325_10004884 Ga0265325_100048847 267
188 3300031241 Ga0265325_10174842 Ga0265325_101748421 267
189 3300031242 Ga0265329_10000042 Ga0265329_1000004246 267
190 3300031242 Ga0265329_10013223 Ga0265329_100132232 267
191 3300031247 Ga0265340_10000569 Ga0265340_1000056914 267
192 3300031247 Ga0265340_10001921 Ga0265340_1000192110 267
193 3300031247 Ga0265340_10003109 Ga0265340_100031096 267
194 3300031247 Ga0265340_10007479 Ga0265340_100074797 267
195 3300031249 Ga0265339_10000152 Ga0265339_1000015218 267
196 3300031249 Ga0265339_10011579 Ga0265339_100115794 267
197 3300031250 Ga0265331_10000173 Ga0265331_1000017331 267
198 3300031250 Ga0265331_10000539 Ga0265331_100005396 267
199 3300031251 Ga0265327_10000382 Ga0265327_1000038248 267
200 3300031344 Ga0265316_10000739 Ga0265316_1000073927 267
201 3300031344 Ga0265316_10001754 Ga0265316_100017549 267
202 3300031344 Ga0265316_10002128 Ga0265316_1000212811 267
203 3300031344 Ga0265316_10014938 Ga0265316_100149382 267
204 3300031344 Ga0265316_10062218 Ga0265316_100622182 267
205 3300031344 Ga0265316_10227880 Ga0265316_102278802 267
206 3300031595 Ga0265313_10000422 Ga0265313_1000042224 267
207 3300031595 Ga0265313_10000530 Ga0265313_1000053011 267
208 3300031595 Ga0265313_10000731 Ga0265313_1000073114 267
209 3300031595 Ga0265313_10006377 Ga0265313_100063778 267
210 3300031691 Ga0316579_10001517 Ga0316579_1000151711 267
211 3300031691 Ga0316579_10007811 Ga0316579_100078111 267
212 3300031691 Ga0316579_10039829 Ga0316579_100398291 267
213 3300031691 Ga0316579_10076743 Ga0316579_100767432 267
214 3300031691 Ga0316579_10160520 Ga0316579_101605201 267
215 3300031711 Ga0265314_10000217 Ga0265314_1000021725 267
216 3300031711 Ga0265314_10000254 Ga0265314_100002544 267
217 3300031711 Ga0265314_10001482 Ga0265314_100014828 267
218 3300031711 Ga0265314_10147482 Ga0265314_101474822 267
219 3300031712 Ga0265342_10000199 Ga0265342_1000019946 267
220 3300031712 Ga0265342_10003613 Ga0265342_100036137 267
221 3300031712 Ga0265342_10008980 Ga0265342_100089804 267
222 3300031712 Ga0265342_10017898 Ga0265342_100178983 267
223 3300031712 Ga0265342_10029659 Ga0265342_100296592 267
224 3300031727 Ga0316576_10023129 Ga0316576_100231294 267
225 3300031727 Ga0316576_10027923 Ga0316576_100279233 267
226 3300031727 Ga0316576_10051034 Ga0316576_100510342 267
227 3300031727 Ga0316576_10201977 Ga0316576_102019772 267
228 3300031728 Ga0316578_10000061 Ga0316578_1000006111 267
229 3300031728 Ga0316578_10010953 Ga0316578_100109532 267
230 3300031728 Ga0316578_10028132 Ga0316578_100281322 267
231 3300031728 Ga0316578_10094925 Ga0316578_100949251 267
232 3300031728 Ga0316578_10100669 Ga0316578_101006691 267
233 3300031728 Ga0316578_10123284 Ga0316578_101232842 267
234 3300031728 Ga0316578_10198808 Ga0316578_101988081 267
235 3300031730 Ga0307516_10000706 Ga0307516_1000070628 267
236 3300031730 Ga0307516_10008009 Ga0307516_100080092 267
237 3300031730 Ga0307516_10305358 Ga0307516_103053581 267
238 3300031733 Ga0316577_10000796 Ga0316577_100007964 267
239 3300031733 Ga0316577_10018709 Ga0316577_100187094 267
240 3300031733 Ga0316577_10200963 Ga0316577_102009631 267
241 3300032133 Ga0316583_10005744 Ga0316583_100057444 267
242 3300032133 Ga0316583_10026012 Ga0316583_100260121 267
243 3300032139 Ga0316580_10032780 Ga0316580_100327801 267
244 3300032139 Ga0316580_10078323 Ga0316580_100783231 267
245 3300032168 Ga0316593_10028468 Ga0316593_100284682 267
246 3300033524 Ga0316592_1007929 Ga0316592_10079292 267
247 3300033528 Ga0316588_1001119 Ga0316588_10011191 267
248 3300033528 Ga0316588_1013931 Ga0316588_10139312 267
249 3300033528 Ga0316588_1023692 Ga0316588_10236922 267
250 3300033541 Ga0316596_1023132 Ga0316596_10231322 267
251 3300035086 Ga0373934_0038814 Ga0373934_0038814_1001_1831 267
252 3300035117 Ga0373953_0022984 Ga0373953_0022984_1040_1906 267
253 3300035118 Ga0373954_0084080 Ga0373954_0084080_573_1439 267
254 3300035119 Ga0373956_0017344 Ga0373956_0017344_805_1671 267
255 3300035120 Ga0373957_0008337 Ga0373957_0008337_1029_1895 267
256 3300035172 Ga0373955_0010090 Ga0373955_0010090_1278_2108 267
257 3300035172 Ga0373955_0168846 Ga0373955_0168846_229_1032 267
258 3300035398 Ga0316574_0001614 Ga0316574_0001614_9637_10461 267
259 3300035398 Ga0316574_0004979 Ga0316574_0004979_1650_2471 267
260 3300035398 Ga0316574_0011136 Ga0316574_0011136_4065_4889 267
261 3300035398 Ga0316574_0056296 Ga0316574_0056296_437_1294 267
262 3300035724 Ga0373933_0020949 Ga0373933_0020949_2437_3303 267
263 3300035724 Ga0373933_0130539 Ga0373933_0130539_715_1533 267
264 3300035724 Ga0373933_0166074 Ga0373933_0166074_54_857 267
265 3300035724 Ga0373933_0166826 Ga0373933_0166826_479_1288 267
266 3300035725 Ga0373947_0063683 Ga0373947_0063683_988_1803 267
267 3300036401 Ga0373937_0002807 Ga0373937_0002807_17_883 267
268 3300036401 Ga0373937_0078079 Ga0373937_0078079_182_1012 267
269 3300036401 Ga0373937_0101240 Ga0373937_0101240_1810_2640 267
270 3300036401 Ga0373937_0601458 Ga0373937_0601458_99_914 267
271 3300036647 Ga0316582_0036788 Ga0316582_0036788_1651_2472 267
272 3300036647 Ga0316582_0148902 Ga0316582_0148902_502_1326 267
273 3300036647 Ga0316582_0241638 Ga0316582_0241638_123_935 267
274 3300036712 Ga0316584_0004430 Ga0316584_0004430_1350_2159 267
275 3300036712 Ga0316584_0008459 Ga0316584_0008459_1327_2142 267
276 3300036712 Ga0316584_0009740 Ga0316584_0009740_4686_5543 267
277 3300036712 Ga0316584_0038667 Ga0316584_0038667_319_1158 267
278 3300036712 Ga0316584_0050821 Ga0316584_0050821_2199_3017 267
279 3300037068 Ga0373925_0170330 Ga0373925_0170330_542_1372 267
280 3300039447 Ga0436361_0340017 Ga0436361_0340017_1872_2678 267
281 3300046460 Ga0495638_0007754 Ga0495638_0007754_5240_6046 267
282 3300046462 Ga0495651_0005964 Ga0495651_0005964_42_872 267
283 3300046477 Ga0495664_0133459 Ga0495664_0133459_115_951 267
284 3300046477 Ga0495664_0225485 Ga0495664_0225485_41_844 267
285 3300046511 Ga0495608_0092970 Ga0495608_0092970_643_1473 267
286 3300046524 Ga0495648_0024099 Ga0495648_0024099_1569_2399 267
287 3300046559 Ga0495667_0112971 Ga0495667_0112971_465_1280 267
288 3300046642 Ga0495634_0000873 Ga0495634_0000873_2744_3547 267
289 3300046642 Ga0495634_0120943 Ga0495634_0120943_374_1189 267
290 3300046663 Ga0495635_0017326 Ga0495635_0017326_3498_4313 267
291 3300046675 Ga0495657_0263292 Ga0495657_0263292_97_927 267
292 3300047319 Ga0495674_0000487 Ga0495674_0000487_8971_9774 267
293 3300047322 Ga0495680_0024492 Ga0495680_0024492_750_1580 267
294 3300047471 Ga0495684_0041073 Ga0495684_0041073_133_963 267
295 3300047472 Ga0495686_0027364 Ga0495686_0027364_612_1421 267
296 3300048088 Ga0495602_0281723 Ga0495602_0281723_90_926 267
297 3300048905 Ga0496102_0427347 Ga0496102_0427347_189_992 267
298 3300048907 Ga0496104_0083316 Ga0496104_0083316_1047_1856 267
299 3300048907 Ga0496104_0117378 Ga0496104_0117378_1509_2381 267
300 3300048913 Ga0496110_0093144 Ga0496110_0093144_1718_2527 267
301 3300048915 Ga0496112_0133307 Ga0496112_0133307_1518_2321 267
302 3300048922 Ga0496119_0010555 Ga0496119_0010555_6359_7174 267
303 3300048923 Ga0496120_0104422 Ga0496120_0104422_276_1091 267
304 3300048924 Ga0496121_0009911 Ga0496121_0009911_8799_9605 267
305 3300048927 Ga0496124_0415706 Ga0496124_0415706_21_851 267
306 3300049573 Ga0501037_0071043 Ga0501037_0071043_951_1760 267
307 3300049574 Ga0501038_0177044 Ga0501038_0177044_801_1610 267
308 3300049581 Ga0501047_0021412 Ga0501047_0021412_1110_1919 267
309 3300049589 Ga0501073_0240439 Ga0501073_0240439_224_1039 267
310 3300049742 Ga0501080_0131704 Ga0501080_0131704_1079_1888 267
311 3300050491 nmdc:mga00v17_158914_c1 nmdc:mga00v17_158914_c1_80_970 267
312 3300050493 nmdc:mga0k408_30187_c1 nmdc:mga0k408_30187_c1_226_1056 267
313 3300050494 nmdc:mga06z11_63802_c1 nmdc:mga06z11_63802_c1_558_1448 267
314 3300050512 nmdc:mga0n895_118119_c1 nmdc:mga0n895_118119_c1_609_1430 267
315 3300050512 nmdc:mga0n895_770080_c1 nmdc:mga0n895_770080_c1_48_869 267
316 3300050513 nmdc:mga0rr50_105919_c1 nmdc:mga0rr50_105919_c1_491_1312 267
317 3300050514 nmdc:mga08x19_14716_c1 nmdc:mga08x19_14716_c1_744_1565 267
318 3300050515 nmdc:mga0a205_177786_c1 nmdc:mga0a205_177786_c1_736_1557 267
319 3300053077 Ga0495601_0015605 Ga0495601_0015605_1174_1977 267
320 3300053077 Ga0495601_0044383 Ga0495601_0044383_1250_2065 267
321 3300053084 Ga0495595_0045554 Ga0495595_0045554_345_1175 267
322 3300053085 Ga0495619_0266306 Ga0495619_0266306_285_1100 267
323 3300053086 Ga0500578_0091936 Ga0500578_0091936_508_1317 267
324 3300053087 Ga0500643_054555 Ga0500643_054555_202_1032 267
325 3300053096 Ga0500641_0007131 Ga0500641_0007131_2737_3546 267
326 3300053108 Ga0500562_020571 Ga0500562_020571_375_1181 267
327 3300053131 Ga0500652_022177 Ga0500652_022177_992_1819 267
328 3300053153 Ga0500616_0009618 Ga0500616_0009618_2728_3537 267
329 3300053156 Ga0500622_0040146 Ga0500622_0040146_863_1705 267
330 3300053730 Ga0500645_000559 Ga0500645_000559_2566_3393 267

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01841

Transglut_core

Transglutaminase-like superfamily

137

244

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3isr-assembly1.cif.gz_B the crystal structure of a putative cysteine protease from cytophaga hutchinsonii to 1.9a 0.868 1 265
3isr-assembly1.cif.gz_B the crystal structure of a putative cysteine protease from cytophaga hutchinsonii to 1.9a 0.8428 1 265
5mho-assembly2.cif.gz_B fxiiia in complex with the inhibitor zed2369 0.7401 133 225
7ob6-assembly1.cif.gz_B cpr-c4 - a conserved novel protease from the candidate phyla radiation 0.7067 100 222
7ob7-assembly1.cif.gz_A-2 cpr-c4 - novel protease from the candidate phyla radiation (cpr) 0.6814 100 222
ID Description Score Start End Superfamily
3isrC01 Alpha Beta;Roll;C8orf32 fold; 0.8998 91 254 3.10.620.30
af_P9WL93_122_301_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.8231 101 247 3.10.620.30
af_P71734_77_269_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.7997 76 247 3.10.620.30
af_O53920_94_280_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.7828 86 242 3.10.620.30
af_I6XWA9_2_176_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.7815 93 225 3.10.620.30
ID Description Score Start End GO Terms
AF-A0A0U5BX12-F1-model_v4 Transglutaminase-like 0.9974 1 267
AF-A0A2A6NS23-F1-model_v4 Transglutaminase 0.9974 1 267
AF-A0A435YKB4-F1-model_v4 Transglutaminase family protein 0.997 1 267
AF-A0A2D8K562-F1-model_v4 Transglutaminase 0.9968 1 267
AF-A0A7W6KSX3-F1-model_v4 deleted 0.9962 1 267

Feature Viewer

pLDDT pTM Quality
95.26 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map