F410035
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 330 | 199 | 325 | 272 |
Family's Representative Sequence
| Representative Sequence | 3300006195|Ga0075366_10098313|Ga0075366_100983133 |
| Length | 319 |
| Sequence | MQPPRDVHVAAWAQLKEPIMQIRVGYELVYDCPQPTPMMLMLNIHYTRAADIVVPDHLVTSPVIPVASYRDGFGNWCSRLVAPKGQVRISTSAVLNDSGAPETIARSAEQHAVQDLPDECLQFLLGSRYCETDRLSETAWALFGKTPTGAARVQAICDYVHRRIAFGYENARSTKTAWEAFNEKKGVCRDYAHLAIAFCRCMNIPARYCTGYLGDIGVPPPYGPMDFAAWFEAYVGGAWHVFDPRNNVPRIGRVLIARGRDATDVAISNTFGPNTLLGFKVVTDEVDVPAPVFGPPTIGSGDLAGHAGAGQHGTAVPPV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 2 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 3 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 4 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 5 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 6 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 7 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 8 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 34 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 35 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 36 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 37 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 38 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 39 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 40 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 41 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 42 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 43 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 44 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 45 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 47 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 48 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 49 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 51 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 52 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 53 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 59 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 68 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 102 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 106 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 107 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 108 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 109 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 110 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 111 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 112 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 113 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 114 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 115 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 116 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 117 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 118 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 119 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 120 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 121 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 122 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 123 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 124 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 125 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 126 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 127 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 128 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 129 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 130 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 131 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 132 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 133 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 134 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 135 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 136 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 137 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 138 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 139 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 140 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 141 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 142 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 143 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 144 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 145 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 146 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 147 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 148 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 166 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 167 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 168 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 169 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 170 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 171 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 172 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 173 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 174 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 175 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 182 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 183 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 184 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 192 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 193 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 194 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 195 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 196 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 197 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 198 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 199 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.67 |
| Metatranscriptomes | 1.82 |
| Isolates | 1.52 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.24 |
| Nodule | 0 |
| Rhizoplane | 2.42 |
| Rhizosphere | 89.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1000775 | 3300001976 | Bacteria | 4296 |
| 2 | JGI24751J29686_10017713 | 3300002459 | Bacteria | 1471 |
| 3 | Ga0055530_10001918 | 3300003791 | Bacteria | 14199 |
| 4 | Ga0065707_10089203 | 3300005295 | Bacteria | 4439 |
| 5 | Ga0070683_100008146 | 3300005329 | Bacteria | 8903 |
| 6 | Ga0070690_100046208 | 3300005330 | Bacteria | 2768 |
| 7 | Ga0070690_100600829 | 3300005330 | Bacteria | 835 |
| 8 | Ga0070670_100009872 | 3300005331 | Bacteria | 8152 |
| 9 | Ga0070666_10000500 | 3300005335 | Bacteria | 23605 |
| 10 | Ga0070668_100001821 | 3300005347 | Bacteria | 15511 |
| 11 | Ga0070668_100008138 | 3300005347 | Bacteria | 7790 |
| 12 | Ga0070668_100082271 | 3300005347 | Bacteria | 2525 |
| 13 | Ga0070669_100000018 | 3300005353 | Bacteria | 195789 |
| 14 | Ga0070675_100064051 | 3300005354 | Bacteria | 3039 |
| 15 | Ga0070675_100166542 | 3300005354 | Bacteria | 1898 |
| 16 | Ga0070671_100000011 | 3300005355 | Bacteria | 202057 |
| 17 | Ga0070673_100007947 | 3300005364 | Bacteria | 7029 |
| 18 | Ga0070667_100051359 | 3300005367 | Bacteria | 3476 |
| 19 | Ga0070709_10035194 | 3300005434 | Bacteria | 3042 |
| 20 | Ga0070713_100418440 | 3300005436 | Bacteria | 1254 |
| 21 | Ga0070705_100111605 | 3300005440 | Bacteria | 1748 |
| 22 | Ga0070700_100177013 | 3300005441 | Bacteria | 1481 |
| 23 | Ga0070708_100064078 | 3300005445 | Bacteria | 3292 |
| 24 | Ga0070708_100492589 | 3300005445 | Bacteria | 1156 |
| 25 | Ga0070708_100802187 | 3300005445 | Bacteria | 885 |
| 26 | Ga0068867_100040533 | 3300005459 | Bacteria | 3400 |
| 27 | Ga0068867_100165214 | 3300005459 | Bacteria | 1748 |
| 28 | Ga0070707_100353376 | 3300005468 | Bacteria | 1427 |
| 29 | Ga0070684_100004562 | 3300005535 | Bacteria | 10553 |
| 30 | Ga0070672_100159505 | 3300005543 | Bacteria | 1870 |
| 31 | Ga0070672_100270448 | 3300005543 | Bacteria | 1435 |
| 32 | Ga0070686_100229150 | 3300005544 | Bacteria | 1347 |
| 33 | Ga0070665_100063229 | 3300005548 | Bacteria | 3711 |
| 34 | Ga0070665_100181153 | 3300005548 | Bacteria | 2108 |
| 35 | Ga0070664_100035979 | 3300005564 | Bacteria | 4158 |
| 36 | Ga0068856_100200264 | 3300005614 | Bacteria | 2011 |
| 37 | Ga0068859_100001999 | 3300005617 | Bacteria | 20813 |
| 38 | Ga0068859_100138176 | 3300005617 | Bacteria | 2510 |
| 39 | Ga0068864_100000173 | 3300005618 | Bacteria | 59516 |
| 40 | Ga0068864_100124009 | 3300005618 | Bacteria | 2313 |
| 41 | Ga0068864_100146093 | 3300005618 | Bacteria | 2138 |
| 42 | Ga0068864_100317469 | 3300005618 | Bacteria | 1462 |
| 43 | Ga0068866_10008787 | 3300005718 | Bacteria | 4267 |
| 44 | Ga0068861_100058670 | 3300005719 | Bacteria | 2944 |
| 45 | Ga0068861_100094886 | 3300005719 | Bacteria | 2361 |
| 46 | Ga0068861_100311098 | 3300005719 | Bacteria | 1368 |
| 47 | Ga0068870_10236908 | 3300005840 | Bacteria | 1125 |
| 48 | Ga0068863_100013167 | 3300005841 | Bacteria | 7980 |
| 49 | Ga0068858_100000913 | 3300005842 | Bacteria | 30617 |
| 50 | Ga0068858_100189797 | 3300005842 | Bacteria | 1942 |
| 51 | Ga0068860_100003011 | 3300005843 | Bacteria | 17409 |
| 52 | Ga0068860_100008683 | 3300005843 | Bacteria | 10122 |
| 53 | Ga0068862_100001414 | 3300005844 | Bacteria | 22242 |
| 54 | Ga0068862_100027190 | 3300005844 | Bacteria | 4814 |
| 55 | Ga0068862_100231405 | 3300005844 | Bacteria | 1677 |
| 56 | Ga0068862_100287533 | 3300005844 | Bacteria | 1509 |
| 57 | Ga0081455_10000940 | 3300005937 | Bacteria | 37224 |
| 58 | Ga0075367_10121015 | 3300006178 | Bacteria | 1613 |
| 59 | Ga0075366_10098313 | 3300006195 | Bacteria | 1756 |
| 60 | Ga0097621_100466081 | 3300006237 | Bacteria | 1140 |
| 61 | Ga0075430_100130676 | 3300006846 | Bacteria | 2093 |
| 62 | Ga0075434_100033203 | 3300006871 | Bacteria | 5092 |
| 63 | Ga0068865_100042428 | 3300006881 | Bacteria | 3102 |
| 64 | Ga0068865_100397192 | 3300006881 | Bacteria | 1128 |
| 65 | Ga0097620_100001999 | 3300006931 | Bacteria | 20813 |
| 66 | Ga0097620_100138170 | 3300006931 | Bacteria | 2510 |
| 67 | Ga0075435_100119474 | 3300007076 | Bacteria | 2198 |
| 68 | Ga0099794_10016126 | 3300007265 | Bacteria | 3309 |
| 69 | Ga0099794_10023505 | 3300007265 | Bacteria | 2820 |
| 70 | Ga0099794_10083691 | 3300007265 | Bacteria | 1577 |
| 71 | Ga0099795_10000171 | 3300007788 | Bacteria | 10747 |
| 72 | Ga0111539_10345603 | 3300009094 | Bacteria | 1731 |
| 73 | Ga0111539_10511404 | 3300009094 | Bacteria | 1399 |
| 74 | Ga0105247_10004029 | 3300009101 | Bacteria | 9453 |
| 75 | Ga0105247_10005562 | 3300009101 | Bacteria | 7918 |
| 76 | Ga0105243_10008625 | 3300009148 | Bacteria | 7820 |
| 77 | Ga0105248_10015082 | 3300009177 | Bacteria | 8510 |
| 78 | Ga0105248_10053381 | 3300009177 | Bacteria | 4536 |
| 79 | Ga0105248_10078688 | 3300009177 | Bacteria | 3706 |
| 80 | Ga0105248_10830021 | 3300009177 | Bacteria | 1043 |
| 81 | Ga0105249_10004797 | 3300009553 | Bacteria | 11672 |
| 82 | Ga0099796_10000093 | 3300010159 | Bacteria | 14500 |
| 83 | Ga0105239_10075015 | 3300010375 | Bacteria | 3718 |
| 84 | Ga0157374_10545804 | 3300013296 | Bacteria | 1167 |
| 85 | Ga0163162_10003541 | 3300013306 | Bacteria | 14939 |
| 86 | Ga0157375_10037064 | 3300013308 | Bacteria | 4669 |
| 87 | Ga0163163_10013544 | 3300014325 | Bacteria | 7472 |
| 88 | Ga0163163_10277315 | 3300014325 | Bacteria | 1728 |
| 89 | Ga0157380_10029344 | 3300014326 | Bacteria | 4204 |
| 90 | Ga0157379_10002210 | 3300014968 | Bacteria | 16189 |
| 91 | Ga0157376_10020438 | 3300014969 | Bacteria | 5122 |
| 92 | Ga0157376_10175259 | 3300014969 | Bacteria | 1956 |
| 93 | Ga0157376_10728883 | 3300014969 | Bacteria | 999 |
| 94 | Ga0209026_1002042 | 3300025250 | Bacteria | 7979 |
| 95 | Ga0207697_10000382 | 3300025315 | Bacteria | 24836 |
| 96 | Ga0207653_10004410 | 3300025885 | Bacteria | 4410 |
| 97 | Ga0207692_10064218 | 3300025898 | Bacteria | 1911 |
| 98 | Ga0207642_10024497 | 3300025899 | Bacteria | 2426 |
| 99 | Ga0207710_10004201 | 3300025900 | Bacteria | 6312 |
| 100 | Ga0207710_10016256 | 3300025900 | Bacteria | 3147 |
| 101 | Ga0207680_10002061 | 3300025903 | Bacteria | 9413 |
| 102 | Ga0207645_10001196 | 3300025907 | Bacteria | 21420 |
| 103 | Ga0207645_10019249 | 3300025907 | Bacteria | 4477 |
| 104 | Ga0207643_10046783 | 3300025908 | Bacteria | 2446 |
| 105 | Ga0207684_10090073 | 3300025910 | Bacteria | 2614 |
| 106 | Ga0207663_10488972 | 3300025916 | Bacteria | 954 |
| 107 | Ga0207646_10085786 | 3300025922 | Bacteria | 2816 |
| 108 | Ga0207681_10000008 | 3300025923 | Bacteria | 414329 |
| 109 | Ga0207650_10057901 | 3300025925 | Bacteria | 2883 |
| 110 | Ga0207650_10068871 | 3300025925 | Unclassified | 2658 |
| 111 | Ga0207659_10021339 | 3300025926 | Bacteria | 4297 |
| 112 | Ga0207644_10000006 | 3300025931 | Bacteria | 408793 |
| 113 | Ga0207706_10284068 | 3300025933 | Bacteria | 1443 |
| 114 | Ga0207704_10026753 | 3300025938 | Bacteria | 3170 |
| 115 | Ga0207704_10132270 | 3300025938 | Bacteria | 1730 |
| 116 | Ga0207665_10177652 | 3300025939 | Bacteria | 1540 |
| 117 | Ga0207691_10042895 | 3300025940 | Bacteria | 4170 |
| 118 | Ga0207711_10035713 | 3300025941 | Bacteria | 4215 |
| 119 | Ga0207711_10050780 | 3300025941 | Bacteria | 3551 |
| 120 | Ga0207711_10082075 | 3300025941 | Bacteria | 2817 |
| 121 | Ga0207689_10002060 | 3300025942 | Bacteria | 18979 |
| 122 | Ga0207712_10002115 | 3300025961 | Bacteria | 12984 |
| 123 | Ga0207668_10000484 | 3300025972 | Bacteria | 24948 |
| 124 | Ga0207668_10012776 | 3300025972 | Bacteria | 5150 |
| 125 | Ga0207668_10013884 | 3300025972 | Bacteria | 4973 |
| 126 | Ga0207668_10401468 | 3300025972 | Bacteria | 1159 |
| 127 | Ga0207658_10011170 | 3300025986 | Bacteria | 6116 |
| 128 | Ga0207703_10000690 | 3300026035 | Bacteria | 33405 |
| 129 | Ga0207702_10434221 | 3300026078 | Bacteria | 1271 |
| 130 | Ga0207641_10003636 | 3300026088 | Bacteria | 13595 |
| 131 | Ga0207641_10142516 | 3300026088 | Bacteria | 2164 |
| 132 | Ga0207648_10001404 | 3300026089 | Bacteria | 26508 |
| 133 | Ga0207648_10086482 | 3300026089 | Bacteria | 2735 |
| 134 | Ga0207676_10004358 | 3300026095 | Bacteria | 10008 |
| 135 | Ga0207676_10287405 | 3300026095 | Bacteria | 1496 |
| 136 | Ga0207674_10161233 | 3300026116 | Bacteria | 2197 |
| 137 | Ga0207675_100002076 | 3300026118 | Bacteria | 19921 |
| 138 | Ga0207675_100008737 | 3300026118 | Bacteria | 9516 |
| 139 | Ga0207683_10279636 | 3300026121 | Bacteria | 1525 |
| 140 | Ga0209179_1014489 | 3300027512 | Bacteria | 1449 |
| 141 | Ga0265356_1002799 | 3300028017 | Bacteria | 2258 |
| 142 | Ga0268266_10021358 | 3300028379 | Bacteria | 5515 |
| 143 | Ga0268265_10000064 | 3300028380 | Bacteria | 144164 |
| 144 | Ga0268265_10002438 | 3300028380 | Bacteria | 14024 |
| 145 | Ga0268265_10418357 | 3300028380 | Bacteria | 1244 |
| 146 | Ga0268264_10000010 | 3300028381 | Bacteria | 596543 |
| 147 | Ga0268264_10000055 | 3300028381 | Bacteria | 314947 |
| 148 | Ga0265318_10000167 | 3300028577 | Bacteria | 58161 |
| 149 | Ga0265318_10000177 | 3300028577 | Bacteria | 56517 |
| 150 | Ga0265318_10002111 | 3300028577 | Bacteria | 10854 |
| 151 | Ga0265318_10057439 | 3300028577 | Bacteria | 1454 |
| 152 | Ga0307517_10122176 | 3300028786 | Bacteria | 1920 |
| 153 | Ga0265338_10133305 | 3300028800 | Bacteria | 1957 |
| 154 | Ga0265330_10000083 | 3300031235 | Bacteria | 79358 |
| 155 | Ga0265330_10000868 | 3300031235 | Bacteria | 18881 |
| 156 | Ga0265330_10050600 | 3300031235 | Bacteria | 1822 |
| 157 | Ga0265330_10071508 | 3300031235 | Bacteria | 1501 |
| 158 | Ga0265330_10086802 | 3300031235 | Bacteria | 1345 |
| 159 | Ga0265332_10000290 | 3300031238 | Bacteria | 39493 |
| 160 | Ga0265332_10000400 | 3300031238 | Bacteria | 31440 |
| 161 | Ga0265332_10001878 | 3300031238 | Bacteria | 11164 |
| 162 | Ga0265332_10008961 | 3300031238 | Bacteria | 4474 |
| 163 | Ga0265328_10001065 | 3300031239 | Bacteria | 12645 |
| 164 | Ga0265328_10056405 | 3300031239 | Bacteria | 1442 |
| 165 | Ga0265320_10000083 | 3300031240 | Bacteria | 79436 |
| 166 | Ga0265320_10000867 | 3300031240 | Bacteria | 22866 |
| 167 | Ga0265325_10000212 | 3300031241 | Bacteria | 41485 |
| 168 | Ga0265325_10004884 | 3300031241 | Bacteria | 8376 |
| 169 | Ga0265325_10174842 | 3300031241 | Bacteria | 1003 |
| 170 | Ga0265329_10000042 | 3300031242 | Bacteria | 53592 |
| 171 | Ga0265329_10013223 | 3300031242 | Bacteria | 2949 |
| 172 | Ga0265340_10000569 | 3300031247 | Bacteria | 20525 |
| 173 | Ga0265340_10001921 | 3300031247 | Bacteria | 11875 |
| 174 | Ga0265340_10003109 | 3300031247 | Bacteria | 9414 |
| 175 | Ga0265340_10007479 | 3300031247 | Bacteria | 5930 |
| 176 | Ga0265339_10000152 | 3300031249 | Bacteria | 57034 |
| 177 | Ga0265339_10011579 | 3300031249 | Bacteria | 5420 |
| 178 | Ga0265331_10000173 | 3300031250 | Bacteria | 79421 |
| 179 | Ga0265331_10000539 | 3300031250 | Bacteria | 34679 |
| 180 | Ga0265327_10000382 | 3300031251 | Bacteria | 83557 |
| 181 | Ga0265316_10000739 | 3300031344 | Bacteria | 36142 |
| 182 | Ga0265316_10001754 | 3300031344 | Bacteria | 22947 |
| 183 | Ga0265316_10002128 | 3300031344 | Bacteria | 20811 |
| 184 | Ga0265316_10014938 | 3300031344 | Bacteria | 6810 |
| 185 | Ga0265316_10062218 | 3300031344 | Bacteria | 2897 |
| 186 | Ga0265316_10227880 | 3300031344 | Bacteria | 1373 |
| 187 | Ga0265313_10000422 | 3300031595 | Bacteria | 45310 |
| 188 | Ga0265313_10000530 | 3300031595 | Bacteria | 39902 |
| 189 | Ga0265313_10000731 | 3300031595 | Bacteria | 33776 |
| 190 | Ga0265313_10006377 | 3300031595 | Bacteria | 8383 |
| 191 | Ga0316579_10001517 | 3300031691 | Bacteria | 8446 |
| 192 | Ga0316579_10007811 | 3300031691 | Bacteria | 4432 |
| 193 | Ga0316579_10030540 | 3300031691 | Bacteria | 2463 |
| 194 | Ga0316579_10039829 | 3300031691 | Bacteria | 2178 |
| 195 | Ga0316579_10076743 | 3300031691 | Bacteria | 1588 |
| 196 | Ga0316579_10160520 | 3300031691 | Bacteria | 1086 |
| 197 | Ga0265314_10000217 | 3300031711 | Bacteria | 85291 |
| 198 | Ga0265314_10000254 | 3300031711 | Bacteria | 79030 |
| 199 | Ga0265314_10001482 | 3300031711 | Bacteria | 26124 |
| 200 | Ga0265314_10147482 | 3300031711 | Bacteria | 1447 |
| 201 | Ga0265342_10000199 | 3300031712 | Bacteria | 67101 |
| 202 | Ga0265342_10003613 | 3300031712 | Bacteria | 12602 |
| 203 | Ga0265342_10008980 | 3300031712 | Bacteria | 7099 |
| 204 | Ga0265342_10017898 | 3300031712 | Bacteria | 4600 |
| 205 | Ga0265342_10029659 | 3300031712 | Bacteria | 3395 |
| 206 | Ga0316576_10023129 | 3300031727 | Bacteria | 4325 |
| 207 | Ga0316576_10027923 | 3300031727 | Bacteria | 3971 |
| 208 | Ga0316576_10051034 | 3300031727 | Bacteria | 3009 |
| 209 | Ga0316576_10117110 | 3300031727 | Bacteria | 1999 |
| 210 | Ga0316576_10201977 | 3300031727 | Bacteria | 1497 |
| 211 | Ga0316578_10000061 | 3300031728 | Bacteria | 23517 |
| 212 | Ga0316578_10010953 | 3300031728 | Bacteria | 4725 |
| 213 | Ga0316578_10028132 | 3300031728 | Bacteria | 3182 |
| 214 | Ga0316578_10094925 | 3300031728 | Bacteria | 1784 |
| 215 | Ga0316578_10100669 | 3300031728 | Bacteria | 1732 |
| 216 | Ga0316578_10123284 | 3300031728 | Bacteria | 1558 |
| 217 | Ga0316578_10198808 | 3300031728 | Bacteria | 1207 |
| 218 | Ga0307516_10000706 | 3300031730 | Bacteria | 45397 |
| 219 | Ga0307516_10008009 | 3300031730 | Bacteria | 12025 |
| 220 | Ga0307516_10305358 | 3300031730 | Bacteria | 1266 |
| 221 | Ga0316577_10000796 | 3300031733 | Bacteria | 13637 |
| 222 | Ga0316577_10018709 | 3300031733 | Bacteria | 3832 |
| 223 | Ga0316577_10200963 | 3300031733 | Bacteria | 1126 |
| 224 | Ga0316583_10005744 | 3300032133 | Bacteria | 4459 |
| 225 | Ga0316583_10026012 | 3300032133 | Bacteria | 2088 |
| 226 | Ga0316580_10032780 | 3300032139 | Bacteria | 1608 |
| 227 | Ga0316580_10078323 | 3300032139 | Bacteria | 1011 |
| 228 | Ga0316593_10028468 | 3300032168 | Bacteria | 1801 |
| 229 | Ga0316592_1007929 | 3300033524 | Bacteria | 2083 |
| 230 | Ga0316588_1001119 | 3300033528 | Bacteria | 4256 |
| 231 | Ga0316588_1013931 | 3300033528 | Bacteria | 1753 |
| 232 | Ga0316588_1023692 | 3300033528 | Bacteria | 1410 |
| 233 | Ga0316596_1023132 | 3300033541 | Bacteria | 1590 |
| 234 | Ga0373934_0038814 | 3300035086 | Bacteria | 1876 |
| 235 | Ga0373953_0022984 | 3300035117 | Bacteria | 2357 |
| 236 | Ga0373954_0084080 | 3300035118 | Bacteria | 1523 |
| 237 | Ga0373956_0017344 | 3300035119 | Bacteria | 3035 |
| 238 | Ga0373957_0008337 | 3300035120 | Bacteria | 3351 |
| 239 | Ga0373955_0010090 | 3300035172 | Bacteria | 4447 |
| 240 | Ga0373955_0168846 | 3300035172 | Bacteria | 1294 |
| 241 | Ga0316574_0001614 | 3300035398 | Bacteria | 10820 |
| 242 | Ga0316574_0004979 | 3300035398 | Bacteria | 7043 |
| 243 | Ga0316574_0011136 | 3300035398 | Bacteria | 5103 |
| 244 | Ga0316574_0056296 | 3300035398 | Bacteria | 2460 |
| 245 | Ga0316574_0256492 | 3300035398 | Bacteria | 1117 |
| 246 | Ga0373933_0020949 | 3300035724 | Bacteria | 3708 |
| 247 | Ga0373933_0130539 | 3300035724 | Bacteria | 1580 |
| 248 | Ga0373933_0166074 | 3300035724 | Bacteria | 1403 |
| 249 | Ga0373933_0166826 | 3300035724 | Bacteria | 1400 |
| 250 | Ga0373947_0063683 | 3300035725 | Bacteria | 2247 |
| 251 | Ga0373937_0002807 | 3300036401 | Bacteria | 14561 |
| 252 | Ga0373937_0078079 | 3300036401 | Bacteria | 3059 |
| 253 | Ga0373937_0101240 | 3300036401 | Bacteria | 2674 |
| 254 | Ga0373937_0601458 | 3300036401 | Bacteria | 1044 |
| 255 | Ga0316582_0025163 | 3300036647 | Bacteria | 3571 |
| 256 | Ga0316582_0036788 | 3300036647 | Bacteria | 3031 |
| 257 | Ga0316582_0148902 | 3300036647 | Bacteria | 1581 |
| 258 | Ga0316582_0241638 | 3300036647 | Bacteria | 1237 |
| 259 | Ga0316584_0004430 | 3300036712 | Bacteria | 9303 |
| 260 | Ga0316584_0008459 | 3300036712 | Bacteria | 7093 |
| 261 | Ga0316584_0009740 | 3300036712 | Bacteria | 6686 |
| 262 | Ga0316584_0038667 | 3300036712 | Bacteria | 3550 |
| 263 | Ga0316584_0050821 | 3300036712 | Bacteria | 3099 |
| 264 | Ga0373925_0083671 | 3300037068 | Bacteria | 2431 |
| 265 | Ga0373925_0170330 | 3300037068 | Bacteria | 1719 |
| 266 | Ga0316581_0017481 | 3300037588 | Bacteria | 2072 |
| 267 | Ga0436361_0340017 | 3300039447 | Bacteria | 3258 |
| 268 | Ga0495638_0007754 | 3300046460 | Bacteria | 7664 |
| 269 | Ga0495651_0005964 | 3300046462 | Bacteria | 9293 |
| 270 | Ga0495664_0133459 | 3300046477 | Bacteria | 1504 |
| 271 | Ga0495664_0225485 | 3300046477 | Bacteria | 1134 |
| 272 | Ga0495608_0092970 | 3300046511 | Bacteria | 1949 |
| 273 | Ga0495648_0024099 | 3300046524 | Bacteria | 4154 |
| 274 | Ga0495667_0112971 | 3300046559 | Bacteria | 1755 |
| 275 | Ga0495634_0000873 | 3300046642 | Bacteria | 29017 |
| 276 | Ga0495634_0120943 | 3300046642 | Bacteria | 1677 |
| 277 | Ga0495635_0017326 | 3300046663 | Bacteria | 5033 |
| 278 | Ga0495588_0110162 | 3300046674 | Bacteria | 1450 |
| 279 | Ga0495657_0263292 | 3300046675 | Bacteria | 1035 |
| 280 | Ga0495658_0249018 | 3300046683 | Bacteria | 1117 |
| 281 | Ga0495674_0000487 | 3300047319 | Bacteria | 36181 |
| 282 | Ga0495680_0024492 | 3300047322 | Bacteria | 5007 |
| 283 | Ga0495684_0041073 | 3300047471 | Bacteria | 3545 |
| 284 | Ga0495686_0027364 | 3300047472 | Bacteria | 3724 |
| 285 | Ga0495602_0281723 | 3300048088 | Bacteria | 1224 |
| 286 | Ga0496101_0088294 | 3300048904 | Bacteria | 2303 |
| 287 | Ga0496102_0427347 | 3300048905 | Bacteria | 1244 |
| 288 | Ga0496104_0083316 | 3300048907 | Bacteria | 3050 |
| 289 | Ga0496104_0117378 | 3300048907 | Bacteria | 2554 |
| 290 | Ga0496106_0160791 | 3300048909 | Bacteria | 1776 |
| 291 | Ga0496110_0093144 | 3300048913 | Bacteria | 2697 |
| 292 | Ga0496112_0133307 | 3300048915 | Bacteria | 2455 |
| 293 | Ga0496114_0565081 | 3300048917 | Bacteria | 1004 |
| 294 | Ga0496119_0010555 | 3300048922 | Bacteria | 7755 |
| 295 | Ga0496120_0104422 | 3300048923 | Bacteria | 1491 |
| 296 | Ga0496121_0009911 | 3300048924 | Bacteria | 10843 |
| 297 | Ga0496124_0415706 | 3300048927 | Bacteria | 929 |
| 298 | Ga0501037_0071043 | 3300049573 | Bacteria | 2533 |
| 299 | Ga0501038_0177044 | 3300049574 | Bacteria | 1723 |
| 300 | Ga0501047_0021412 | 3300049581 | Bacteria | 6206 |
| 301 | Ga0501073_0240439 | 3300049589 | Bacteria | 1250 |
| 302 | Ga0501080_0079066 | 3300049742 | Bacteria | 3058 |
| 303 | Ga0501080_0131704 | 3300049742 | Bacteria | 2315 |
| 304 | Ga0501083_0000802 | 3300049744 | Bacteria | 20586 |
| 305 | nmdc:mga00v17_158914_c1 | 3300050491 | Bacteria | 1454 |
| 306 | nmdc:mga0k408_30187_c1 | 3300050493 | Bacteria | 3089 |
| 307 | nmdc:mga06z11_63802_c1 | 3300050494 | Bacteria | 1928 |
| 308 | nmdc:mga0n895_118119_c1 | 3300050512 | Bacteria | 2672 |
| 309 | nmdc:mga0n895_770080_c1 | 3300050512 | Bacteria | 954 |
| 310 | nmdc:mga0rr50_105919_c1 | 3300050513 | Bacteria | 2218 |
| 311 | nmdc:mga08x19_14716_c1 | 3300050514 | Bacteria | 4751 |
| 312 | nmdc:mga0a205_177786_c1 | 3300050515 | Bacteria | 2023 |
| 313 | Ga0495601_0015605 | 3300053077 | Bacteria | 4592 |
| 314 | Ga0495601_0044383 | 3300053077 | Bacteria | 2794 |
| 315 | Ga0495595_0045554 | 3300053084 | Bacteria | 2018 |
| 316 | Ga0495619_0266306 | 3300053085 | Bacteria | 1187 |
| 317 | Ga0500578_0091936 | 3300053086 | Bacteria | 1925 |
| 318 | Ga0500643_054555 | 3300053087 | Bacteria | 1134 |
| 319 | Ga0500641_0007131 | 3300053096 | Bacteria | 3979 |
| 320 | Ga0500562_020571 | 3300053108 | Bacteria | 1713 |
| 321 | Ga0500652_022177 | 3300053131 | Bacteria | 2401 |
| 322 | Ga0500616_0009618 | 3300053153 | Bacteria | 5863 |
| 323 | Ga0500622_0040146 | 3300053156 | Bacteria | 2437 |
| 324 | Ga0500645_000559 | 3300053730 | Bacteria | 24493 |
| 325 | Ga0501082_0081944 | 3300060353 | Bacteria | 2784 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031235 | Ga0265330_10086802 | Ga0265330_100868021 | 241 |
| 2 | 3300009148 | Ga0105243_10008625 | Ga0105243_100086255 | 247 |
| 3 | 3300005543 | Ga0070672_100159505 | Ga0070672_1001595052 | 249 |
| 4 | 3300005544 | Ga0070686_100229150 | Ga0070686_1002291502 | 249 |
| 5 | 3300005617 | Ga0068859_100138176 | Ga0068859_1001381763 | 249 |
| 6 | 3300005618 | Ga0068864_100124009 | Ga0068864_1001240093 | 249 |
| 7 | 3300005842 | Ga0068858_100189797 | Ga0068858_1001897972 | 249 |
| 8 | 3300006881 | Ga0068865_100397192 | Ga0068865_1003971922 | 249 |
| 9 | 3300006931 | Ga0097620_100138170 | Ga0097620_1001381703 | 249 |
| 10 | 3300014325 | Ga0163163_10277315 | Ga0163163_102773152 | 249 |
| 11 | 3300014326 | Ga0157380_10029344 | Ga0157380_100293443 | 249 |
| 12 | 3300035398 | Ga0316574_0256492 | Ga0316574_0256492_310_1080 | 249 |
| 13 | 3300036647 | Ga0316582_0025163 | Ga0316582_0025163_2182_2958 | 249 |
| 14 | 3300037588 | Ga0316581_0017481 | Ga0316581_0017481_755_1531 | 249 |
| 15 | 3300049742 | Ga0501080_0079066 | Ga0501080_0079066_1024_1830 | 255 |
| 16 | iso_pu_bacteria | 2885366525 | 2885371700 | 255 |
| 17 | 3300005330 | Ga0070690_100046208 | Ga0070690_1000462082 | 257 |
| 18 | 3300005354 | Ga0070675_100166542 | Ga0070675_1001665422 | 257 |
| 19 | 3300005459 | Ga0068867_100165214 | Ga0068867_1001652142 | 257 |
| 20 | 3300005718 | Ga0068866_10008787 | Ga0068866_100087874 | 257 |
| 21 | 3300005719 | Ga0068861_100094886 | Ga0068861_1000948862 | 257 |
| 22 | 3300025899 | Ga0207642_10024497 | Ga0207642_100244973 | 257 |
| 23 | 3300025907 | Ga0207645_10019249 | Ga0207645_100192495 | 257 |
| 24 | 3300025938 | Ga0207704_10132270 | Ga0207704_101322702 | 257 |
| 25 | 3300025942 | Ga0207689_10002060 | Ga0207689_100020602 | 257 |
| 26 | 3300026089 | Ga0207648_10001404 | Ga0207648_100014042 | 257 |
| 27 | 3300026118 | Ga0207675_100008737 | Ga0207675_10000873710 | 257 |
| 28 | 3300031691 | Ga0316579_10030540 | Ga0316579_100305401 | 258 |
| 29 | 3300049744 | Ga0501083_0000802 | Ga0501083_0000802_12253_13059 | 261 |
| 30 | 3300060353 | Ga0501082_0081944 | Ga0501082_0081944_1865_2671 | 261 |
| 31 | 3300007265 | Ga0099794_10016126 | Ga0099794_100161261 | 263 |
| 32 | 3300037068 | Ga0373925_0083671 | Ga0373925_0083671_1107_1910 | 263 |
| 33 | 3300046683 | Ga0495658_0249018 | Ga0495658_0249018_166_969 | 263 |
| 34 | 3300048904 | Ga0496101_0088294 | Ga0496101_0088294_1071_1868 | 263 |
| 35 | 3300048909 | Ga0496106_0160791 | Ga0496106_0160791_45_842 | 263 |
| 36 | 3300048917 | Ga0496114_0565081 | Ga0496114_0565081_173_994 | 263 |
| 37 | iso_pu_bacteria | 2511231003 | 2511250384 | 263 |
| 38 | iso_pu_bacteria | 2738541281 | 2738746499 | 263 |
| 39 | iso_pu_bacteria | 2738543032 | 2739355729 | 263 |
| 40 | iso_pu_bacteria | 2842698319 | 2842701603 | 263 |
| 41 | 3300005844 | Ga0068862_100231405 | Ga0068862_1002314051 | 264 |
| 42 | 3300046674 | Ga0495588_0110162 | Ga0495588_0110162_75_899 | 265 |
| 43 | 3300003791 | Ga0055530_10001918 | Ga0055530_1000191812 | 266 |
| 44 | 3300005347 | Ga0070668_100001821 | Ga0070668_1000018212 | 266 |
| 45 | 3300005843 | Ga0068860_100008683 | Ga0068860_1000086835 | 266 |
| 46 | 3300005844 | Ga0068862_100027190 | Ga0068862_1000271904 | 266 |
| 47 | 3300009177 | Ga0105248_10015082 | Ga0105248_100150829 | 266 |
| 48 | 3300025250 | Ga0209026_1002042 | Ga0209026_10020425 | 266 |
| 49 | 3300025972 | Ga0207668_10013884 | Ga0207668_100138842 | 266 |
| 50 | 3300028380 | Ga0268265_10002438 | Ga0268265_100024384 | 266 |
| 51 | 3300028381 | Ga0268264_10000055 | Ga0268264_100000558 | 266 |
| 52 | 3300028786 | Ga0307517_10122176 | Ga0307517_101221762 | 266 |
| 53 | 3300031727 | Ga0316576_10117110 | Ga0316576_101171102 | 266 |
| 54 | 3300001976 | JGI24752J21851_1000775 | JGI24752J21851_10007754 | 267 |
| 55 | 3300002459 | JGI24751J29686_10017713 | JGI24751J29686_100177131 | 267 |
| 56 | 3300005295 | Ga0065707_10089203 | Ga0065707_100892034 | 267 |
| 57 | 3300005329 | Ga0070683_100008146 | Ga0070683_1000081464 | 267 |
| 58 | 3300005330 | Ga0070690_100600829 | Ga0070690_1006008291 | 267 |
| 59 | 3300005331 | Ga0070670_100009872 | Ga0070670_1000098723 | 267 |
| 60 | 3300005335 | Ga0070666_10000500 | Ga0070666_1000050011 | 267 |
| 61 | 3300005347 | Ga0070668_100008138 | Ga0070668_1000081382 | 267 |
| 62 | 3300005347 | Ga0070668_100082271 | Ga0070668_1000822714 | 267 |
| 63 | 3300005353 | Ga0070669_100000018 | Ga0070669_100000018173 | 267 |
| 64 | 3300005354 | Ga0070675_100064051 | Ga0070675_1000640512 | 267 |
| 65 | 3300005355 | Ga0070671_100000011 | Ga0070671_10000001125 | 267 |
| 66 | 3300005364 | Ga0070673_100007947 | Ga0070673_1000079474 | 267 |
| 67 | 3300005367 | Ga0070667_100051359 | Ga0070667_1000513594 | 267 |
| 68 | 3300005434 | Ga0070709_10035194 | Ga0070709_100351942 | 267 |
| 69 | 3300005436 | Ga0070713_100418440 | Ga0070713_1004184401 | 267 |
| 70 | 3300005440 | Ga0070705_100111605 | Ga0070705_1001116052 | 267 |
| 71 | 3300005441 | Ga0070700_100177013 | Ga0070700_1001770132 | 267 |
| 72 | 3300005445 | Ga0070708_100064078 | Ga0070708_1000640782 | 267 |
| 73 | 3300005445 | Ga0070708_100492589 | Ga0070708_1004925892 | 267 |
| 74 | 3300005445 | Ga0070708_100802187 | Ga0070708_1008021871 | 267 |
| 75 | 3300005459 | Ga0068867_100040533 | Ga0068867_1000405334 | 267 |
| 76 | 3300005468 | Ga0070707_100353376 | Ga0070707_1003533762 | 267 |
| 77 | 3300005535 | Ga0070684_100004562 | Ga0070684_1000045626 | 267 |
| 78 | 3300005543 | Ga0070672_100270448 | Ga0070672_1002704482 | 267 |
| 79 | 3300005548 | Ga0070665_100063229 | Ga0070665_1000632292 | 267 |
| 80 | 3300005548 | Ga0070665_100181153 | Ga0070665_1001811532 | 267 |
| 81 | 3300005564 | Ga0070664_100035979 | Ga0070664_1000359794 | 267 |
| 82 | 3300005614 | Ga0068856_100200264 | Ga0068856_1002002641 | 267 |
| 83 | 3300005617 | Ga0068859_100001999 | Ga0068859_10000199913 | 267 |
| 84 | 3300005618 | Ga0068864_100000173 | Ga0068864_10000017326 | 267 |
| 85 | 3300005618 | Ga0068864_100146093 | Ga0068864_1001460932 | 267 |
| 86 | 3300005618 | Ga0068864_100317469 | Ga0068864_1003174692 | 267 |
| 87 | 3300005719 | Ga0068861_100058670 | Ga0068861_1000586702 | 267 |
| 88 | 3300005719 | Ga0068861_100311098 | Ga0068861_1003110982 | 267 |
| 89 | 3300005840 | Ga0068870_10236908 | Ga0068870_102369082 | 267 |
| 90 | 3300005841 | Ga0068863_100013167 | Ga0068863_1000131672 | 267 |
| 91 | 3300005842 | Ga0068858_100000913 | Ga0068858_10000091316 | 267 |
| 92 | 3300005843 | Ga0068860_100003011 | Ga0068860_1000030113 | 267 |
| 93 | 3300005844 | Ga0068862_100001414 | Ga0068862_10000141415 | 267 |
| 94 | 3300005844 | Ga0068862_100287533 | Ga0068862_1002875332 | 267 |
| 95 | 3300005937 | Ga0081455_10000940 | Ga0081455_1000094028 | 267 |
| 96 | 3300006178 | Ga0075367_10121015 | Ga0075367_101210152 | 267 |
| 97 | 3300006195 | Ga0075366_10098313 | Ga0075366_100983133 | 267 |
| 98 | 3300006237 | Ga0097621_100466081 | Ga0097621_1004660812 | 267 |
| 99 | 3300006846 | Ga0075430_100130676 | Ga0075430_1001306763 | 267 |
| 100 | 3300006871 | Ga0075434_100033203 | Ga0075434_1000332033 | 267 |
| 101 | 3300006881 | Ga0068865_100042428 | Ga0068865_1000424283 | 267 |
| 102 | 3300006931 | Ga0097620_100001999 | Ga0097620_10000199913 | 267 |
| 103 | 3300007076 | Ga0075435_100119474 | Ga0075435_1001194742 | 267 |
| 104 | 3300007265 | Ga0099794_10023505 | Ga0099794_100235052 | 267 |
| 105 | 3300007265 | Ga0099794_10083691 | Ga0099794_100836912 | 267 |
| 106 | 3300007788 | Ga0099795_10000171 | Ga0099795_100001719 | 267 |
| 107 | 3300009094 | Ga0111539_10345603 | Ga0111539_103456032 | 267 |
| 108 | 3300009094 | Ga0111539_10511404 | Ga0111539_105114042 | 267 |
| 109 | 3300009101 | Ga0105247_10004029 | Ga0105247_100040297 | 267 |
| 110 | 3300009101 | Ga0105247_10005562 | Ga0105247_100055622 | 267 |
| 111 | 3300009177 | Ga0105248_10053381 | Ga0105248_100533816 | 267 |
| 112 | 3300009177 | Ga0105248_10078688 | Ga0105248_100786885 | 267 |
| 113 | 3300009177 | Ga0105248_10830021 | Ga0105248_108300211 | 267 |
| 114 | 3300009553 | Ga0105249_10004797 | Ga0105249_1000479711 | 267 |
| 115 | 3300010159 | Ga0099796_10000093 | Ga0099796_1000009313 | 267 |
| 116 | 3300010375 | Ga0105239_10075015 | Ga0105239_100750152 | 267 |
| 117 | 3300013296 | Ga0157374_10545804 | Ga0157374_105458042 | 267 |
| 118 | 3300013306 | Ga0163162_10003541 | Ga0163162_1000354114 | 267 |
| 119 | 3300013308 | Ga0157375_10037064 | Ga0157375_100370645 | 267 |
| 120 | 3300014325 | Ga0163163_10013544 | Ga0163163_100135449 | 267 |
| 121 | 3300014968 | Ga0157379_10002210 | Ga0157379_100022105 | 267 |
| 122 | 3300014969 | Ga0157376_10020438 | Ga0157376_100204384 | 267 |
| 123 | 3300014969 | Ga0157376_10175259 | Ga0157376_101752592 | 267 |
| 124 | 3300014969 | Ga0157376_10728883 | Ga0157376_107288832 | 267 |
| 125 | 3300025315 | Ga0207697_10000382 | Ga0207697_1000038219 | 267 |
| 126 | 3300025885 | Ga0207653_10004410 | Ga0207653_100044102 | 267 |
| 127 | 3300025898 | Ga0207692_10064218 | Ga0207692_100642181 | 267 |
| 128 | 3300025900 | Ga0207710_10004201 | Ga0207710_100042015 | 267 |
| 129 | 3300025900 | Ga0207710_10016256 | Ga0207710_100162562 | 267 |
| 130 | 3300025903 | Ga0207680_10002061 | Ga0207680_1000206111 | 267 |
| 131 | 3300025907 | Ga0207645_10001196 | Ga0207645_1000119614 | 267 |
| 132 | 3300025908 | Ga0207643_10046783 | Ga0207643_100467831 | 267 |
| 133 | 3300025910 | Ga0207684_10090073 | Ga0207684_100900732 | 267 |
| 134 | 3300025916 | Ga0207663_10488972 | Ga0207663_104889721 | 267 |
| 135 | 3300025922 | Ga0207646_10085786 | Ga0207646_100857862 | 267 |
| 136 | 3300025923 | Ga0207681_10000008 | Ga0207681_10000008395 | 267 |
| 137 | 3300025925 | Ga0207650_10057901 | Ga0207650_100579014 | 267 |
| 138 | 3300025925 | Ga0207650_10068871 | Ga0207650_100688714 | 267 |
| 139 | 3300025926 | Ga0207659_10021339 | Ga0207659_100213392 | 267 |
| 140 | 3300025931 | Ga0207644_10000006 | Ga0207644_10000006387 | 267 |
| 141 | 3300025933 | Ga0207706_10284068 | Ga0207706_102840682 | 267 |
| 142 | 3300025938 | Ga0207704_10026753 | Ga0207704_100267533 | 267 |
| 143 | 3300025939 | Ga0207665_10177652 | Ga0207665_101776522 | 267 |
| 144 | 3300025940 | Ga0207691_10042895 | Ga0207691_100428954 | 267 |
| 145 | 3300025941 | Ga0207711_10035713 | Ga0207711_100357132 | 267 |
| 146 | 3300025941 | Ga0207711_10050780 | Ga0207711_100507802 | 267 |
| 147 | 3300025941 | Ga0207711_10082075 | Ga0207711_100820752 | 267 |
| 148 | 3300025961 | Ga0207712_10002115 | Ga0207712_1000211512 | 267 |
| 149 | 3300025972 | Ga0207668_10000484 | Ga0207668_1000048416 | 267 |
| 150 | 3300025972 | Ga0207668_10012776 | Ga0207668_100127762 | 267 |
| 151 | 3300025972 | Ga0207668_10401468 | Ga0207668_104014682 | 267 |
| 152 | 3300025986 | Ga0207658_10011170 | Ga0207658_100111706 | 267 |
| 153 | 3300026035 | Ga0207703_10000690 | Ga0207703_1000069029 | 267 |
| 154 | 3300026078 | Ga0207702_10434221 | Ga0207702_104342211 | 267 |
| 155 | 3300026088 | Ga0207641_10003636 | Ga0207641_1000363617 | 267 |
| 156 | 3300026088 | Ga0207641_10142516 | Ga0207641_101425163 | 267 |
| 157 | 3300026089 | Ga0207648_10086482 | Ga0207648_100864822 | 267 |
| 158 | 3300026095 | Ga0207676_10004358 | Ga0207676_100043587 | 267 |
| 159 | 3300026095 | Ga0207676_10287405 | Ga0207676_102874051 | 267 |
| 160 | 3300026116 | Ga0207674_10161233 | Ga0207674_101612333 | 267 |
| 161 | 3300026118 | Ga0207675_100002076 | Ga0207675_10000207612 | 267 |
| 162 | 3300026121 | Ga0207683_10279636 | Ga0207683_102796362 | 267 |
| 163 | 3300027512 | Ga0209179_1014489 | Ga0209179_10144891 | 267 |
| 164 | 3300028017 | Ga0265356_1002799 | Ga0265356_10027992 | 267 |
| 165 | 3300028379 | Ga0268266_10021358 | Ga0268266_100213584 | 267 |
| 166 | 3300028380 | Ga0268265_10000064 | Ga0268265_1000006423 | 267 |
| 167 | 3300028380 | Ga0268265_10418357 | Ga0268265_104183572 | 267 |
| 168 | 3300028381 | Ga0268264_10000010 | Ga0268264_10000010180 | 267 |
| 169 | 3300028577 | Ga0265318_10000167 | Ga0265318_1000016725 | 267 |
| 170 | 3300028577 | Ga0265318_10000177 | Ga0265318_1000017742 | 267 |
| 171 | 3300028577 | Ga0265318_10002111 | Ga0265318_100021113 | 267 |
| 172 | 3300028577 | Ga0265318_10057439 | Ga0265318_100574391 | 267 |
| 173 | 3300028800 | Ga0265338_10133305 | Ga0265338_101333052 | 267 |
| 174 | 3300031235 | Ga0265330_10000083 | Ga0265330_1000008331 | 267 |
| 175 | 3300031235 | Ga0265330_10000868 | Ga0265330_100008687 | 267 |
| 176 | 3300031235 | Ga0265330_10050600 | Ga0265330_100506002 | 267 |
| 177 | 3300031235 | Ga0265330_10071508 | Ga0265330_100715083 | 267 |
| 178 | 3300031238 | Ga0265332_10000290 | Ga0265332_100002902 | 267 |
| 179 | 3300031238 | Ga0265332_10000400 | Ga0265332_1000040017 | 267 |
| 180 | 3300031238 | Ga0265332_10001878 | Ga0265332_100018786 | 267 |
| 181 | 3300031238 | Ga0265332_10008961 | Ga0265332_100089612 | 267 |
| 182 | 3300031239 | Ga0265328_10001065 | Ga0265328_100010659 | 267 |
| 183 | 3300031239 | Ga0265328_10056405 | Ga0265328_100564052 | 267 |
| 184 | 3300031240 | Ga0265320_10000083 | Ga0265320_1000008325 | 267 |
| 185 | 3300031240 | Ga0265320_10000867 | Ga0265320_100008676 | 267 |
| 186 | 3300031241 | Ga0265325_10000212 | Ga0265325_100002122 | 267 |
| 187 | 3300031241 | Ga0265325_10004884 | Ga0265325_100048847 | 267 |
| 188 | 3300031241 | Ga0265325_10174842 | Ga0265325_101748421 | 267 |
| 189 | 3300031242 | Ga0265329_10000042 | Ga0265329_1000004246 | 267 |
| 190 | 3300031242 | Ga0265329_10013223 | Ga0265329_100132232 | 267 |
| 191 | 3300031247 | Ga0265340_10000569 | Ga0265340_1000056914 | 267 |
| 192 | 3300031247 | Ga0265340_10001921 | Ga0265340_1000192110 | 267 |
| 193 | 3300031247 | Ga0265340_10003109 | Ga0265340_100031096 | 267 |
| 194 | 3300031247 | Ga0265340_10007479 | Ga0265340_100074797 | 267 |
| 195 | 3300031249 | Ga0265339_10000152 | Ga0265339_1000015218 | 267 |
| 196 | 3300031249 | Ga0265339_10011579 | Ga0265339_100115794 | 267 |
| 197 | 3300031250 | Ga0265331_10000173 | Ga0265331_1000017331 | 267 |
| 198 | 3300031250 | Ga0265331_10000539 | Ga0265331_100005396 | 267 |
| 199 | 3300031251 | Ga0265327_10000382 | Ga0265327_1000038248 | 267 |
| 200 | 3300031344 | Ga0265316_10000739 | Ga0265316_1000073927 | 267 |
| 201 | 3300031344 | Ga0265316_10001754 | Ga0265316_100017549 | 267 |
| 202 | 3300031344 | Ga0265316_10002128 | Ga0265316_1000212811 | 267 |
| 203 | 3300031344 | Ga0265316_10014938 | Ga0265316_100149382 | 267 |
| 204 | 3300031344 | Ga0265316_10062218 | Ga0265316_100622182 | 267 |
| 205 | 3300031344 | Ga0265316_10227880 | Ga0265316_102278802 | 267 |
| 206 | 3300031595 | Ga0265313_10000422 | Ga0265313_1000042224 | 267 |
| 207 | 3300031595 | Ga0265313_10000530 | Ga0265313_1000053011 | 267 |
| 208 | 3300031595 | Ga0265313_10000731 | Ga0265313_1000073114 | 267 |
| 209 | 3300031595 | Ga0265313_10006377 | Ga0265313_100063778 | 267 |
| 210 | 3300031691 | Ga0316579_10001517 | Ga0316579_1000151711 | 267 |
| 211 | 3300031691 | Ga0316579_10007811 | Ga0316579_100078111 | 267 |
| 212 | 3300031691 | Ga0316579_10039829 | Ga0316579_100398291 | 267 |
| 213 | 3300031691 | Ga0316579_10076743 | Ga0316579_100767432 | 267 |
| 214 | 3300031691 | Ga0316579_10160520 | Ga0316579_101605201 | 267 |
| 215 | 3300031711 | Ga0265314_10000217 | Ga0265314_1000021725 | 267 |
| 216 | 3300031711 | Ga0265314_10000254 | Ga0265314_100002544 | 267 |
| 217 | 3300031711 | Ga0265314_10001482 | Ga0265314_100014828 | 267 |
| 218 | 3300031711 | Ga0265314_10147482 | Ga0265314_101474822 | 267 |
| 219 | 3300031712 | Ga0265342_10000199 | Ga0265342_1000019946 | 267 |
| 220 | 3300031712 | Ga0265342_10003613 | Ga0265342_100036137 | 267 |
| 221 | 3300031712 | Ga0265342_10008980 | Ga0265342_100089804 | 267 |
| 222 | 3300031712 | Ga0265342_10017898 | Ga0265342_100178983 | 267 |
| 223 | 3300031712 | Ga0265342_10029659 | Ga0265342_100296592 | 267 |
| 224 | 3300031727 | Ga0316576_10023129 | Ga0316576_100231294 | 267 |
| 225 | 3300031727 | Ga0316576_10027923 | Ga0316576_100279233 | 267 |
| 226 | 3300031727 | Ga0316576_10051034 | Ga0316576_100510342 | 267 |
| 227 | 3300031727 | Ga0316576_10201977 | Ga0316576_102019772 | 267 |
| 228 | 3300031728 | Ga0316578_10000061 | Ga0316578_1000006111 | 267 |
| 229 | 3300031728 | Ga0316578_10010953 | Ga0316578_100109532 | 267 |
| 230 | 3300031728 | Ga0316578_10028132 | Ga0316578_100281322 | 267 |
| 231 | 3300031728 | Ga0316578_10094925 | Ga0316578_100949251 | 267 |
| 232 | 3300031728 | Ga0316578_10100669 | Ga0316578_101006691 | 267 |
| 233 | 3300031728 | Ga0316578_10123284 | Ga0316578_101232842 | 267 |
| 234 | 3300031728 | Ga0316578_10198808 | Ga0316578_101988081 | 267 |
| 235 | 3300031730 | Ga0307516_10000706 | Ga0307516_1000070628 | 267 |
| 236 | 3300031730 | Ga0307516_10008009 | Ga0307516_100080092 | 267 |
| 237 | 3300031730 | Ga0307516_10305358 | Ga0307516_103053581 | 267 |
| 238 | 3300031733 | Ga0316577_10000796 | Ga0316577_100007964 | 267 |
| 239 | 3300031733 | Ga0316577_10018709 | Ga0316577_100187094 | 267 |
| 240 | 3300031733 | Ga0316577_10200963 | Ga0316577_102009631 | 267 |
| 241 | 3300032133 | Ga0316583_10005744 | Ga0316583_100057444 | 267 |
| 242 | 3300032133 | Ga0316583_10026012 | Ga0316583_100260121 | 267 |
| 243 | 3300032139 | Ga0316580_10032780 | Ga0316580_100327801 | 267 |
| 244 | 3300032139 | Ga0316580_10078323 | Ga0316580_100783231 | 267 |
| 245 | 3300032168 | Ga0316593_10028468 | Ga0316593_100284682 | 267 |
| 246 | 3300033524 | Ga0316592_1007929 | Ga0316592_10079292 | 267 |
| 247 | 3300033528 | Ga0316588_1001119 | Ga0316588_10011191 | 267 |
| 248 | 3300033528 | Ga0316588_1013931 | Ga0316588_10139312 | 267 |
| 249 | 3300033528 | Ga0316588_1023692 | Ga0316588_10236922 | 267 |
| 250 | 3300033541 | Ga0316596_1023132 | Ga0316596_10231322 | 267 |
| 251 | 3300035086 | Ga0373934_0038814 | Ga0373934_0038814_1001_1831 | 267 |
| 252 | 3300035117 | Ga0373953_0022984 | Ga0373953_0022984_1040_1906 | 267 |
| 253 | 3300035118 | Ga0373954_0084080 | Ga0373954_0084080_573_1439 | 267 |
| 254 | 3300035119 | Ga0373956_0017344 | Ga0373956_0017344_805_1671 | 267 |
| 255 | 3300035120 | Ga0373957_0008337 | Ga0373957_0008337_1029_1895 | 267 |
| 256 | 3300035172 | Ga0373955_0010090 | Ga0373955_0010090_1278_2108 | 267 |
| 257 | 3300035172 | Ga0373955_0168846 | Ga0373955_0168846_229_1032 | 267 |
| 258 | 3300035398 | Ga0316574_0001614 | Ga0316574_0001614_9637_10461 | 267 |
| 259 | 3300035398 | Ga0316574_0004979 | Ga0316574_0004979_1650_2471 | 267 |
| 260 | 3300035398 | Ga0316574_0011136 | Ga0316574_0011136_4065_4889 | 267 |
| 261 | 3300035398 | Ga0316574_0056296 | Ga0316574_0056296_437_1294 | 267 |
| 262 | 3300035724 | Ga0373933_0020949 | Ga0373933_0020949_2437_3303 | 267 |
| 263 | 3300035724 | Ga0373933_0130539 | Ga0373933_0130539_715_1533 | 267 |
| 264 | 3300035724 | Ga0373933_0166074 | Ga0373933_0166074_54_857 | 267 |
| 265 | 3300035724 | Ga0373933_0166826 | Ga0373933_0166826_479_1288 | 267 |
| 266 | 3300035725 | Ga0373947_0063683 | Ga0373947_0063683_988_1803 | 267 |
| 267 | 3300036401 | Ga0373937_0002807 | Ga0373937_0002807_17_883 | 267 |
| 268 | 3300036401 | Ga0373937_0078079 | Ga0373937_0078079_182_1012 | 267 |
| 269 | 3300036401 | Ga0373937_0101240 | Ga0373937_0101240_1810_2640 | 267 |
| 270 | 3300036401 | Ga0373937_0601458 | Ga0373937_0601458_99_914 | 267 |
| 271 | 3300036647 | Ga0316582_0036788 | Ga0316582_0036788_1651_2472 | 267 |
| 272 | 3300036647 | Ga0316582_0148902 | Ga0316582_0148902_502_1326 | 267 |
| 273 | 3300036647 | Ga0316582_0241638 | Ga0316582_0241638_123_935 | 267 |
| 274 | 3300036712 | Ga0316584_0004430 | Ga0316584_0004430_1350_2159 | 267 |
| 275 | 3300036712 | Ga0316584_0008459 | Ga0316584_0008459_1327_2142 | 267 |
| 276 | 3300036712 | Ga0316584_0009740 | Ga0316584_0009740_4686_5543 | 267 |
| 277 | 3300036712 | Ga0316584_0038667 | Ga0316584_0038667_319_1158 | 267 |
| 278 | 3300036712 | Ga0316584_0050821 | Ga0316584_0050821_2199_3017 | 267 |
| 279 | 3300037068 | Ga0373925_0170330 | Ga0373925_0170330_542_1372 | 267 |
| 280 | 3300039447 | Ga0436361_0340017 | Ga0436361_0340017_1872_2678 | 267 |
| 281 | 3300046460 | Ga0495638_0007754 | Ga0495638_0007754_5240_6046 | 267 |
| 282 | 3300046462 | Ga0495651_0005964 | Ga0495651_0005964_42_872 | 267 |
| 283 | 3300046477 | Ga0495664_0133459 | Ga0495664_0133459_115_951 | 267 |
| 284 | 3300046477 | Ga0495664_0225485 | Ga0495664_0225485_41_844 | 267 |
| 285 | 3300046511 | Ga0495608_0092970 | Ga0495608_0092970_643_1473 | 267 |
| 286 | 3300046524 | Ga0495648_0024099 | Ga0495648_0024099_1569_2399 | 267 |
| 287 | 3300046559 | Ga0495667_0112971 | Ga0495667_0112971_465_1280 | 267 |
| 288 | 3300046642 | Ga0495634_0000873 | Ga0495634_0000873_2744_3547 | 267 |
| 289 | 3300046642 | Ga0495634_0120943 | Ga0495634_0120943_374_1189 | 267 |
| 290 | 3300046663 | Ga0495635_0017326 | Ga0495635_0017326_3498_4313 | 267 |
| 291 | 3300046675 | Ga0495657_0263292 | Ga0495657_0263292_97_927 | 267 |
| 292 | 3300047319 | Ga0495674_0000487 | Ga0495674_0000487_8971_9774 | 267 |
| 293 | 3300047322 | Ga0495680_0024492 | Ga0495680_0024492_750_1580 | 267 |
| 294 | 3300047471 | Ga0495684_0041073 | Ga0495684_0041073_133_963 | 267 |
| 295 | 3300047472 | Ga0495686_0027364 | Ga0495686_0027364_612_1421 | 267 |
| 296 | 3300048088 | Ga0495602_0281723 | Ga0495602_0281723_90_926 | 267 |
| 297 | 3300048905 | Ga0496102_0427347 | Ga0496102_0427347_189_992 | 267 |
| 298 | 3300048907 | Ga0496104_0083316 | Ga0496104_0083316_1047_1856 | 267 |
| 299 | 3300048907 | Ga0496104_0117378 | Ga0496104_0117378_1509_2381 | 267 |
| 300 | 3300048913 | Ga0496110_0093144 | Ga0496110_0093144_1718_2527 | 267 |
| 301 | 3300048915 | Ga0496112_0133307 | Ga0496112_0133307_1518_2321 | 267 |
| 302 | 3300048922 | Ga0496119_0010555 | Ga0496119_0010555_6359_7174 | 267 |
| 303 | 3300048923 | Ga0496120_0104422 | Ga0496120_0104422_276_1091 | 267 |
| 304 | 3300048924 | Ga0496121_0009911 | Ga0496121_0009911_8799_9605 | 267 |
| 305 | 3300048927 | Ga0496124_0415706 | Ga0496124_0415706_21_851 | 267 |
| 306 | 3300049573 | Ga0501037_0071043 | Ga0501037_0071043_951_1760 | 267 |
| 307 | 3300049574 | Ga0501038_0177044 | Ga0501038_0177044_801_1610 | 267 |
| 308 | 3300049581 | Ga0501047_0021412 | Ga0501047_0021412_1110_1919 | 267 |
| 309 | 3300049589 | Ga0501073_0240439 | Ga0501073_0240439_224_1039 | 267 |
| 310 | 3300049742 | Ga0501080_0131704 | Ga0501080_0131704_1079_1888 | 267 |
| 311 | 3300050491 | nmdc:mga00v17_158914_c1 | nmdc:mga00v17_158914_c1_80_970 | 267 |
| 312 | 3300050493 | nmdc:mga0k408_30187_c1 | nmdc:mga0k408_30187_c1_226_1056 | 267 |
| 313 | 3300050494 | nmdc:mga06z11_63802_c1 | nmdc:mga06z11_63802_c1_558_1448 | 267 |
| 314 | 3300050512 | nmdc:mga0n895_118119_c1 | nmdc:mga0n895_118119_c1_609_1430 | 267 |
| 315 | 3300050512 | nmdc:mga0n895_770080_c1 | nmdc:mga0n895_770080_c1_48_869 | 267 |
| 316 | 3300050513 | nmdc:mga0rr50_105919_c1 | nmdc:mga0rr50_105919_c1_491_1312 | 267 |
| 317 | 3300050514 | nmdc:mga08x19_14716_c1 | nmdc:mga08x19_14716_c1_744_1565 | 267 |
| 318 | 3300050515 | nmdc:mga0a205_177786_c1 | nmdc:mga0a205_177786_c1_736_1557 | 267 |
| 319 | 3300053077 | Ga0495601_0015605 | Ga0495601_0015605_1174_1977 | 267 |
| 320 | 3300053077 | Ga0495601_0044383 | Ga0495601_0044383_1250_2065 | 267 |
| 321 | 3300053084 | Ga0495595_0045554 | Ga0495595_0045554_345_1175 | 267 |
| 322 | 3300053085 | Ga0495619_0266306 | Ga0495619_0266306_285_1100 | 267 |
| 323 | 3300053086 | Ga0500578_0091936 | Ga0500578_0091936_508_1317 | 267 |
| 324 | 3300053087 | Ga0500643_054555 | Ga0500643_054555_202_1032 | 267 |
| 325 | 3300053096 | Ga0500641_0007131 | Ga0500641_0007131_2737_3546 | 267 |
| 326 | 3300053108 | Ga0500562_020571 | Ga0500562_020571_375_1181 | 267 |
| 327 | 3300053131 | Ga0500652_022177 | Ga0500652_022177_992_1819 | 267 |
| 328 | 3300053153 | Ga0500616_0009618 | Ga0500616_0009618_2728_3537 | 267 |
| 329 | 3300053156 | Ga0500622_0040146 | Ga0500622_0040146_863_1705 | 267 |
| 330 | 3300053730 | Ga0500645_000559 | Ga0500645_000559_2566_3393 | 267 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3isr-assembly1.cif.gz_B | the crystal structure of a putative cysteine protease from cytophaga hutchinsonii to 1.9a | 0.868 | 1 | 265 |
| 3isr-assembly1.cif.gz_B | the crystal structure of a putative cysteine protease from cytophaga hutchinsonii to 1.9a | 0.8428 | 1 | 265 |
| 5mho-assembly2.cif.gz_B | fxiiia in complex with the inhibitor zed2369 | 0.7401 | 133 | 225 |
| 7ob6-assembly1.cif.gz_B | cpr-c4 - a conserved novel protease from the candidate phyla radiation | 0.7067 | 100 | 222 |
| 7ob7-assembly1.cif.gz_A-2 | cpr-c4 - novel protease from the candidate phyla radiation (cpr) | 0.6814 | 100 | 222 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3isrC01 | Alpha Beta;Roll;C8orf32 fold; | 0.8998 | 91 | 254 | 3.10.620.30 |
| af_P9WL93_122_301_3.10.620.30 | Alpha Beta;Roll;C8orf32 fold; | 0.8231 | 101 | 247 | 3.10.620.30 |
| af_P71734_77_269_3.10.620.30 | Alpha Beta;Roll;C8orf32 fold; | 0.7997 | 76 | 247 | 3.10.620.30 |
| af_O53920_94_280_3.10.620.30 | Alpha Beta;Roll;C8orf32 fold; | 0.7828 | 86 | 242 | 3.10.620.30 |
| af_I6XWA9_2_176_3.10.620.30 | Alpha Beta;Roll;C8orf32 fold; | 0.7815 | 93 | 225 | 3.10.620.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0U5BX12-F1-model_v4 | Transglutaminase-like | 0.9974 | 1 | 267 |
|
| AF-A0A2A6NS23-F1-model_v4 | Transglutaminase | 0.9974 | 1 | 267 |
|
| AF-A0A435YKB4-F1-model_v4 | Transglutaminase family protein | 0.997 | 1 | 267 |
|
| AF-A0A2D8K562-F1-model_v4 | Transglutaminase | 0.9968 | 1 | 267 |
|
| AF-A0A7W6KSX3-F1-model_v4 | deleted | 0.9962 | 1 | 267 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar