F410112

General Info

Members Datasets Scaffolds Average Seq Length
330 134 330 327

Family's Representative Sequence

Representative Sequence 3300025911|Ga0207654_10037560|Ga0207654_100375602
Length 358
Sequence MARLMGVPDLWNHYAASVYRARLPRTLVPLPRGRRLAGESKMNFVSLLIHGLSAMSVFSDQVSARLLTAAVSFAVIAIALMGVTAGIRWFTDLAVPGWATFTVGLLLVLVVQLLSFATQKVGEELAYLDRPLSRGFERPYGWGWLLYLHLEATRHDEGWSKELEPLARAFAHRLSDYLPLLTYPIRVGTHFNTAFAMVLSLEWAERFDPSLAELIRSRSLHWFAADRDCQAWEPGGDEFLSPSLIEALCMARNHPAEFPAWFGYFLPGVVQRQPATIFEPAIVSDRSDGKIAHLDGLNLSRAWCWRGLAPLLPSDVAEVARCSADEHLAAALPHIAGDYMGEHWLASFALLALLSPEE

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
107 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
118 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
124 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
125 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.45
Rhizosphere 94.55
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000359 3300001915 Bacteria 13645
2 JGI24740J21852_10023937 3300001979 Bacteria 2077
3 JGI24739J22299_10002532 3300001989 Bacteria 7043
4 JGI24739J22299_10009824 3300001989 Bacteria 3557
5 JGI24737J22298_10001578 3300001990 Bacteria 8107
6 JGI24737J22298_10008391 3300001990 Bacteria 3460
7 JGI24735J21928_10001819 3300002067 Bacteria 7488
8 JGI24735J21928_10045702 3300002067 Bacteria 1271
9 JGI24738J21930_10000740 3300002075 Bacteria 9386
10 Ga0070658_10000477 3300005327 Bacteria 34731
11 Ga0070658_10008982 3300005327 Bacteria 8033
12 Ga0070658_10015309 3300005327 Bacteria 6138
13 Ga0070658_10032042 3300005327 Bacteria 4226
14 Ga0070658_10103194 3300005327 Bacteria 2358
15 Ga0070658_10208358 3300005327 Bacteria 1651
16 Ga0070658_10372390 3300005327 Bacteria 1224
17 Ga0070683_100000747 3300005329 Bacteria 23810
18 Ga0070683_100062540 3300005329 Bacteria 3462
19 Ga0070670_100083704 3300005331 Bacteria 2741
20 Ga0070666_10002691 3300005335 Bacteria 10721
21 Ga0070680_100004079 3300005336 Bacteria 10941
22 Ga0070680_100005928 3300005336 Bacteria 9272
23 Ga0070682_100025238 3300005337 Bacteria 3545
24 Ga0070682_100059994 3300005337 Bacteria 2405
25 Ga0070660_100000425 3300005339 Bacteria 27941
26 Ga0070660_100102856 3300005339 Bacteria 2265
27 Ga0070660_100104177 3300005339 Bacteria 2250
28 Ga0070661_100000552 3300005344 Bacteria 28745
29 Ga0070661_100001960 3300005344 Bacteria 14220
30 Ga0070661_100011526 3300005344 Bacteria 6158
31 Ga0070661_100036733 3300005344 Bacteria 3560
32 Ga0070661_100074026 3300005344 Bacteria 2508
33 Ga0070692_10019687 3300005345 Bacteria 3261
34 Ga0070675_100013308 3300005354 Bacteria 6464
35 Ga0070671_100012922 3300005355 Bacteria 6728
36 Ga0070671_100029009 3300005355 Bacteria 4561
37 Ga0070673_100004722 3300005364 Bacteria 8652
38 Ga0070673_100012282 3300005364 Bacteria 5876
39 Ga0070673_100358326 3300005364 Bacteria 1296
40 Ga0070659_100000065 3300005366 Bacteria 82919
41 Ga0070659_100067425 3300005366 Bacteria 2838
42 Ga0070659_100198676 3300005366 Bacteria 1650
43 Ga0070659_100251961 3300005366 Bacteria 1463
44 Ga0070667_100006194 3300005367 Bacteria 9950
45 Ga0070663_100049555 3300005455 Bacteria 2983
46 Ga0070678_100098454 3300005456 Bacteria 2261
47 Ga0070662_100000010 3300005457 Bacteria 142717
48 Ga0070662_100006303 3300005457 Bacteria 7644
49 Ga0070662_100067885 3300005457 Bacteria 2619
50 Ga0070662_100188870 3300005457 Bacteria 1628
51 Ga0070681_10107126 3300005458 Bacteria 2736
52 Ga0070685_10144334 3300005466 Bacteria 1502
53 Ga0070679_100031598 3300005530 Bacteria 5232
54 Ga0070679_100381229 3300005530 Bacteria 1357
55 Ga0068853_100000067 3300005539 Bacteria 73891
56 Ga0068853_100020004 3300005539 Bacteria 5562
57 Ga0068853_100030077 3300005539 Bacteria 4585
58 Ga0068853_100091087 3300005539 Bacteria 2681
59 Ga0068853_100316602 3300005539 Bacteria 1446
60 Ga0070672_100062213 3300005543 Bacteria 2945
61 Ga0070696_100113516 3300005546 Bacteria 1953
62 Ga0070693_100061775 3300005547 Bacteria 2179
63 Ga0070665_100036042 3300005548 Bacteria 4977
64 Ga0070665_100147048 3300005548 Bacteria 2359
65 Ga0070704_100147804 3300005549 Bacteria 1843
66 Ga0068855_100014637 3300005563 Bacteria 9447
67 Ga0068855_100063186 3300005563 Bacteria 4321
68 Ga0070664_100000228 3300005564 Bacteria 40132
69 Ga0070664_100003480 3300005564 Bacteria 12710
70 Ga0070664_100029951 3300005564 Bacteria 4538
71 Ga0070664_100061124 3300005564 Bacteria 3210
72 Ga0070664_100280778 3300005564 Bacteria 1502
73 Ga0070664_100324896 3300005564 Bacteria 1395
74 Ga0068857_100019111 3300005577 Bacteria 6014
75 Ga0068857_100039511 3300005577 Bacteria 4180
76 Ga0068857_100065260 3300005577 Bacteria 3236
77 Ga0068857_100117471 3300005577 Bacteria 2393
78 Ga0068857_100177060 3300005577 Bacteria 1940
79 Ga0068857_100252548 3300005577 Bacteria 1617
80 Ga0068854_100004617 3300005578 Bacteria 8689
81 Ga0068854_100014802 3300005578 Bacteria 5150
82 Ga0068854_100061254 3300005578 Bacteria 2725
83 Ga0068854_100062704 3300005578 Bacteria 2696
84 Ga0068856_100000101 3300005614 Bacteria 82391
85 Ga0068856_100085606 3300005614 Bacteria 3131
86 Ga0068852_100002148 3300005616 Bacteria 13529
87 Ga0068852_100014908 3300005616 Bacteria 6007
88 Ga0068852_100019281 3300005616 Bacteria 5394
89 Ga0068852_100085386 3300005616 Bacteria 2812
90 Ga0068852_100145865 3300005616 Bacteria 2195
91 Ga0068859_100114580 3300005617 Bacteria 2760
92 Ga0068864_100002833 3300005618 Bacteria 14316
93 Ga0068864_100017032 3300005618 Bacteria 6057
94 Ga0068866_10072449 3300005718 Bacteria 1825
95 Ga0068851_10009336 3300005834 Bacteria 4556
96 Ga0068851_10073069 3300005834 Bacteria 1778
97 Ga0068863_100029536 3300005841 Bacteria 5232
98 Ga0068863_100228755 3300005841 Bacteria 1793
99 Ga0068858_100022535 3300005842 Bacteria 5877
100 Ga0068858_100035994 3300005842 Bacteria 4590
101 Ga0068858_100042791 3300005842 Bacteria 4199
102 Ga0068860_100054328 3300005843 Bacteria 3807
103 Ga0097621_100023999 3300006237 Bacteria 4756
104 Ga0097621_100063715 3300006237 Bacteria 3030
105 Ga0068871_100116223 3300006358 Bacteria 2255
106 Ga0068865_100070408 3300006881 Bacteria 2478
107 Ga0097620_100064476 3300006931 Bacteria 3696
108 Ga0097620_100114583 3300006931 Bacteria 2760
109 Ga0105241_10050106 3300009174 Bacteria 3182
110 Ga0105242_10183804 3300009176 Bacteria 1846
111 Ga0105248_10000334 3300009177 Bacteria 55634
112 Ga0105248_10020592 3300009177 Bacteria 7310
113 Ga0105248_10047354 3300009177 Bacteria 4821
114 Ga0105248_10265345 3300009177 Bacteria 1933
115 Ga0105237_10016112 3300009545 Bacteria 7773
116 Ga0105237_10221130 3300009545 Bacteria 1894
117 Ga0105238_10031614 3300009551 Bacteria 5389
118 Ga0105238_10096526 3300009551 Bacteria 2942
119 Ga0157373_10016990 3300013100 Bacteria 5300
120 Ga0157373_10053542 3300013100 Bacteria 2869
121 Ga0157373_10140985 3300013100 Bacteria 1695
122 Ga0157371_10000972 3300013102 Bacteria 31828
123 Ga0157370_10038039 3300013104 Bacteria 4658
124 Ga0157370_10422166 3300013104 Bacteria 1227
125 Ga0157369_10003181 3300013105 Bacteria 19593
126 Ga0157374_10009442 3300013296 Bacteria 8374
127 Ga0157378_10128612 3300013297 Bacteria 2342
128 Ga0163162_10016029 3300013306 Bacteria 7325
129 Ga0163162_10137627 3300013306 Bacteria 2553
130 Ga0157372_10081461 3300013307 Bacteria 3664
131 Ga0157375_10185097 3300013308 Bacteria 2235
132 Ga0157375_10504331 3300013308 Bacteria 1374
133 Ga0163163_10000313 3300014325 Bacteria 47673
134 Ga0163163_10003326 3300014325 Bacteria 13638
135 Ga0157379_10046075 3300014968 Bacteria 3892
136 Ga0207656_10005048 3300025321 Bacteria 4639
137 Ga0207680_10003325 3300025903 Bacteria 7574
138 Ga0207647_10000832 3300025904 Bacteria 23993
139 Ga0207647_10027591 3300025904 Bacteria 3700
140 Ga0207705_10000113 3300025909 Bacteria 90567
141 Ga0207705_10011733 3300025909 Bacteria 6329
142 Ga0207705_10012021 3300025909 Bacteria 6254
143 Ga0207705_10026614 3300025909 Bacteria 4123
144 Ga0207705_10097949 3300025909 Bacteria 2154
145 Ga0207705_10107329 3300025909 Bacteria 2060
146 Ga0207705_10172873 3300025909 Bacteria 1627
147 Ga0207705_10236057 3300025909 Bacteria 1392
148 Ga0207654_10037560 3300025911 Bacteria 2712
149 Ga0207707_10117585 3300025912 Bacteria 2324
150 Ga0207707_10131358 3300025912 Bacteria 2190
151 Ga0207660_10004863 3300025917 Bacteria 8746
152 Ga0207660_10005394 3300025917 Bacteria 8299
153 Ga0207660_10025666 3300025917 Bacteria 4003
154 Ga0207660_10146613 3300025917 Bacteria 1809
155 Ga0207657_10000026 3300025919 Bacteria 143118
156 Ga0207657_10002994 3300025919 Bacteria 18110
157 Ga0207657_10003765 3300025919 Bacteria 16118
158 Ga0207657_10014502 3300025919 Bacteria 7687
159 Ga0207657_10018041 3300025919 Bacteria 6752
160 Ga0207657_10048326 3300025919 Bacteria 3715
161 Ga0207657_10267745 3300025919 Bacteria 1359
162 Ga0207657_10304195 3300025919 Bacteria 1263
163 Ga0207649_10009730 3300025920 Bacteria 5265
164 Ga0207649_10025867 3300025920 Bacteria 3427
165 Ga0207649_10034331 3300025920 Bacteria 3038
166 Ga0207694_10000776 3300025924 Bacteria 28653
167 Ga0207694_10026504 3300025924 Bacteria 4410
168 Ga0207694_10069273 3300025924 Bacteria 2756
169 Ga0207650_10064418 3300025925 Bacteria 2744
170 Ga0207644_10018177 3300025931 Bacteria 4754
171 Ga0207644_10020170 3300025931 Bacteria 4529
172 Ga0207644_10020361 3300025931 Bacteria 4510
173 Ga0207690_10000483 3300025932 Bacteria 25703
174 Ga0207690_10003086 3300025932 Bacteria 10035
175 Ga0207690_10093121 3300025932 Bacteria 2134
176 Ga0207690_10136868 3300025932 Bacteria 1799
177 Ga0207690_10327622 3300025932 Bacteria 1205
178 Ga0207706_10000031 3300025933 Bacteria 143109
179 Ga0207706_10003216 3300025933 Bacteria 15682
180 Ga0207706_10003927 3300025933 Bacteria 14105
181 Ga0207706_10069058 3300025933 Bacteria 3108
182 Ga0207669_10073337 3300025937 Bacteria 2159
183 Ga0207691_10006678 3300025940 Bacteria 11132
184 Ga0207711_10005313 3300025941 Bacteria 10922
185 Ga0207711_10009449 3300025941 Bacteria 8135
186 Ga0207711_10011971 3300025941 Bacteria 7211
187 Ga0207711_10030792 3300025941 Bacteria 4526
188 Ga0207661_10000753 3300025944 Bacteria 21046
189 Ga0207661_10000778 3300025944 Bacteria 20743
190 Ga0207679_10000236 3300025945 Bacteria 42583
191 Ga0207679_10010013 3300025945 Bacteria 6092
192 Ga0207679_10035373 3300025945 Bacteria 3533
193 Ga0207679_10058226 3300025945 Bacteria 2862
194 Ga0207679_10190480 3300025945 Bacteria 1705
195 Ga0207679_10427050 3300025945 Bacteria 1171
196 Ga0207667_10026672 3300025949 Bacteria 6306
197 Ga0207667_10038405 3300025949 Bacteria 5114
198 Ga0207667_10065968 3300025949 Bacteria 3774
199 Ga0207640_10005666 3300025981 Bacteria 6805
200 Ga0207640_10021362 3300025981 Bacteria 3858
201 Ga0207640_10048857 3300025981 Bacteria 2737
202 Ga0207658_10037581 3300025986 Bacteria 3480
203 Ga0207658_10052521 3300025986 Bacteria 3008
204 Ga0207677_10245697 3300026023 Bacteria 1450
205 Ga0207703_10027227 3300026035 Bacteria 4501
206 Ga0207703_10135121 3300026035 Bacteria 2134
207 Ga0207639_10000554 3300026041 Bacteria 25675
208 Ga0207639_10001274 3300026041 Bacteria 17018
209 Ga0207639_10006966 3300026041 Bacteria 7704
210 Ga0207639_10071196 3300026041 Bacteria 2719
211 Ga0207678_10002983 3300026067 Bacteria 15314
212 Ga0207678_10003132 3300026067 Bacteria 14968
213 Ga0207678_10009334 3300026067 Bacteria 8636
214 Ga0207702_10002108 3300026078 Bacteria 19155
215 Ga0207702_10152183 3300026078 Bacteria 2105
216 Ga0207702_10252927 3300026078 Bacteria 1655
217 Ga0207641_10161984 3300026088 Bacteria 2034
218 Ga0207641_10199025 3300026088 Bacteria 1846
219 Ga0207648_10155268 3300026089 Bacteria 2020
220 Ga0207676_10020153 3300026095 Bacteria 4874
221 Ga0207676_10021708 3300026095 Bacteria 4712
222 Ga0207676_10122383 3300026095 Bacteria 2196
223 Ga0207676_10134189 3300026095 Bacteria 2109
224 Ga0207674_10002544 3300026116 Bacteria 22969
225 Ga0207674_10023448 3300026116 Bacteria 6610
226 Ga0207674_10025126 3300026116 Bacteria 6356
227 Ga0207674_10026445 3300026116 Bacteria 6162
228 Ga0207674_10165741 3300026116 Bacteria 2164
229 Ga0207683_10001328 3300026121 Bacteria 22311
230 Ga0207683_10121160 3300026121 Bacteria 2348
231 Ga0207698_10001461 3300026142 Bacteria 13744
232 Ga0207698_10006901 3300026142 Bacteria 7105
233 Ga0207698_10030464 3300026142 Bacteria 3880
234 Ga0207698_10051738 3300026142 Bacteria 3142
235 Ga0207698_10134720 3300026142 Bacteria 2117
236 Ga0207698_10154243 3300026142 Bacteria 1998
237 Ga0207698_10214203 3300026142 Bacteria 1735
238 Ga0268266_10008512 3300028379 Bacteria 9115
239 Ga0268264_10004881 3300028381 Bacteria 11363
240 Ga0268264_10086115 3300028381 Bacteria 2699
241 Ga0307408_100117120 3300031548 Bacteria 2057
242 Ga0307416_100005432 3300032002 Bacteria 7826
243 Ga0307414_10026782 3300032004 Bacteria 3715
244 Ga0307415_100008047 3300032126 Bacteria 5818
245 Ga0307415_100066590 3300032126 Bacteria 2514
246 Ga0373923_0000897 3300035111 Bacteria 7945
247 Ga0373946_0069531 3300035171 Bacteria 1517
248 Ga0373931_0000955 3300035691 Bacteria 12172
249 Ga0373931_0248022 3300035691 Bacteria 1082
250 Ga0373935_0048000 3300035692 Bacteria 2702
251 Ga0373933_0181441 3300035724 Bacteria 1342
252 Ga0373947_0011983 3300035725 Bacteria 4967
253 Ga0373937_0000641 3300036401 Bacteria 30684
254 Ga0395899_0002657 3300037312 Bacteria 14408
255 Ga0395899_0008635 3300037312 Bacteria 7838
256 Ga0395899_0051952 3300037312 Bacteria 3040
257 Ga0395899_0225223 3300037312 Bacteria 1297
258 Ga0395900_0004573 3300037418 Bacteria 14609
259 Ga0395900_0005248 3300037418 Bacteria 13591
260 Ga0395900_0005937 3300037418 Bacteria 12745
261 Ga0395900_0010879 3300037418 Bacteria 9305
262 Ga0395900_0042652 3300037418 Bacteria 4675
263 Ga0395900_0043203 3300037418 Bacteria 4645
264 Ga0395900_0273410 3300037418 Bacteria 1684
265 Ga0395900_0367709 3300037418 Bacteria 1408
266 Ga0395900_0406558 3300037418 Bacteria 1324
267 Ga0395898_0005638 3300037466 Bacteria 13494
268 Ga0395898_0016577 3300037466 Bacteria 7532
269 Ga0395898_0054039 3300037466 Bacteria 3920
270 Ga0395898_0119331 3300037466 Bacteria 2526
271 Ga0395898_0121851 3300037466 Bacteria 2499
272 Ga0395905_0000335 3300037471 Bacteria 67466
273 Ga0395905_0000675 3300037471 Bacteria 45263
274 Ga0395905_0001652 3300037471 Bacteria 26372
275 Ga0395905_0006258 3300037471 Bacteria 12011
276 Ga0395905_0019273 3300037471 Bacteria 6468
277 Ga0395905_0025857 3300037471 Bacteria 5532
278 Ga0395905_0035724 3300037471 Bacteria 4667
279 Ga0395905_0044885 3300037471 Bacteria 4146
280 Ga0395905_0061512 3300037471 Bacteria 3513
281 Ga0395905_0062562 3300037471 Bacteria 3481
282 Ga0395905_0070891 3300037471 Bacteria 3266
283 Ga0395905_0137989 3300037471 Bacteria 2294
284 Ga0395905_0244021 3300037471 Bacteria 1678
285 Ga0395905_0273708 3300037471 Bacteria 1574
286 Ga0395905_0318243 3300037471 Bacteria 1445
287 Ga0395901_0009100 3300038443 Bacteria 10054
288 Ga0395901_0011445 3300038443 Bacteria 8990
289 Ga0395901_0016886 3300038443 Bacteria 7439
290 Ga0395901_0023235 3300038443 Bacteria 6355
291 Ga0395901_0027901 3300038443 Bacteria 5805
292 Ga0395901_0051368 3300038443 Bacteria 4286
293 Ga0395901_0070200 3300038443 Bacteria 3649
294 Ga0395901_0091458 3300038443 Bacteria 3185
295 Ga0395901_0101997 3300038443 Bacteria 3011
296 Ga0395901_0408467 3300038443 Bacteria 1394
297 Ga0395901_0483625 3300038443 Bacteria 1262
298 Ga0439464_0003653 3300042439 Bacteria 3901
299 Ga0466965_0042654 3300044683 Bacteria 2239
300 Ga0466963_0015659 3300044694 Bacteria 4703
301 Ga0466963_0017824 3300044694 Bacteria 4431
302 Ga0466963_0045967 3300044694 Bacteria 2877
303 Ga0466963_0204185 3300044694 Bacteria 1382
304 Ga0466957_0008249 3300044842 Bacteria 5919
305 Ga0466958_0008464 3300045836 Bacteria 5709
306 Ga0466958_0037143 3300045836 Bacteria 2918
307 Ga0466967_0009684 3300045976 Bacteria 7169
308 Ga0466967_0017252 3300045976 Bacteria 5724
309 Ga0466967_0145260 3300045976 Bacteria 2212
310 Ga0466967_0181936 3300045976 Bacteria 1983
311 Ga0495669_0001157 3300046684 Bacteria 10961
312 Ga0496100_0028750 3300048903 Bacteria 3432
313 Ga0496100_0088734 3300048903 Bacteria 2105
314 Ga0496101_0155325 3300048904 Bacteria 1752
315 Ga0496106_0417155 3300048909 Bacteria 1079
316 Ga0496107_0006559 3300048910 Bacteria 8007
317 Ga0496108_0026674 3300048911 Bacteria 4767
318 Ga0496109_0005203 3300048912 Bacteria 10866
319 Ga0496109_0022619 3300048912 Bacteria 5568
320 Ga0496109_0099402 3300048912 Bacteria 2698
321 Ga0496110_0018429 3300048913 Bacteria 5854
322 Ga0496110_0018731 3300048913 Bacteria 5808
323 Ga0496110_0101130 3300048913 Bacteria 2584
324 Ga0496111_0007457 3300048914 Bacteria 7173
325 Ga0496112_0002727 3300048915 Bacteria 14298
326 Ga0496112_0026570 3300048915 Bacteria 5573
327 Ga0496112_0076418 3300048915 Bacteria 3312
328 Ga0496112_0371353 3300048915 Bacteria 1372
329 Ga0496115_0000471 3300048918 Bacteria 32135
330 Ga0501071_0221001 3300049587 Bacteria 1426

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025911 Ga0207654_10037560 Ga0207654_100375602 289
2 3300001990 JGI24737J22298_10008391 JGI24737J22298_100083913 305
3 3300005344 Ga0070661_100074026 Ga0070661_1000740262 305
4 3300005345 Ga0070692_10019687 Ga0070692_100196873 305
5 3300005366 Ga0070659_100067425 Ga0070659_1000674252 305
6 3300005457 Ga0070662_100067885 Ga0070662_1000678852 305
7 3300005457 Ga0070662_100188870 Ga0070662_1001888701 305
8 3300005539 Ga0068853_100316602 Ga0068853_1003166022 305
9 3300005549 Ga0070704_100147804 Ga0070704_1001478042 305
10 3300005564 Ga0070664_100003480 Ga0070664_1000034805 305
11 3300009176 Ga0105242_10183804 Ga0105242_101838042 305
12 3300009545 Ga0105237_10221130 Ga0105237_102211302 305
13 3300013306 Ga0163162_10137627 Ga0163162_101376272 305
14 3300025920 Ga0207649_10025867 Ga0207649_100258673 305
15 3300025932 Ga0207690_10093121 Ga0207690_100931212 305
16 3300025933 Ga0207706_10069058 Ga0207706_100690582 305
17 3300025945 Ga0207679_10010013 Ga0207679_100100134 305
18 3300035171 Ga0373946_0069531 Ga0373946_0069531_301_1251 306
19 3300037312 Ga0395899_0051952 Ga0395899_0051952_1225_2175 306
20 3300037312 Ga0395899_0002657 Ga0395899_0002657_3419_4372 307
21 3300037418 Ga0395900_0005937 Ga0395900_0005937_3418_4371 307
22 3300037466 Ga0395898_0005638 Ga0395898_0005638_9196_10149 307
23 3300037471 Ga0395905_0006258 Ga0395905_0006258_7084_8037 307
24 3300037471 Ga0395905_0019273 Ga0395905_0019273_3601_4554 307
25 3300038443 Ga0395901_0070200 Ga0395901_0070200_2043_2996 307
26 3300035111 Ga0373923_0000897 Ga0373923_0000897_2837_3793 308
27 3300035724 Ga0373933_0181441 Ga0373933_0181441_289_1245 308
28 3300036401 Ga0373937_0000641 Ga0373937_0000641_22524_23480 308
29 3300046684 Ga0495669_0001157 Ga0495669_0001157_4722_5648 308
30 3300005327 Ga0070658_10372390 Ga0070658_103723902 309
31 3300005339 Ga0070660_100102856 Ga0070660_1001028562 309
32 3300005344 Ga0070661_100036733 Ga0070661_1000367331 309
33 3300005578 Ga0068854_100004617 Ga0068854_1000046175 309
34 3300009177 Ga0105248_10047354 Ga0105248_100473543 309
35 3300009545 Ga0105237_10016112 Ga0105237_100161125 309
36 3300013297 Ga0157378_10128612 Ga0157378_101286122 309
37 3300025904 Ga0207647_10000832 Ga0207647_100008328 309
38 3300025912 Ga0207707_10131358 Ga0207707_101313582 309
39 3300025924 Ga0207694_10000776 Ga0207694_1000077613 309
40 3300025949 Ga0207667_10065968 Ga0207667_100659683 309
41 3300026041 Ga0207639_10000554 Ga0207639_1000055411 309
42 3300035691 Ga0373931_0248022 Ga0373931_0248022_49_1011 309
43 3300035692 Ga0373935_0048000 Ga0373935_0048000_1277_2239 309
44 3300035725 Ga0373947_0011983 Ga0373947_0011983_857_1819 309
45 3300037466 Ga0395898_0121851 Ga0395898_0121851_759_1718 309
46 3300044683 Ga0466965_0042654 Ga0466965_0042654_27_989 309
47 3300044842 Ga0466957_0008249 Ga0466957_0008249_4816_5775 309
48 3300045836 Ga0466958_0008464 Ga0466958_0008464_198_1157 309
49 3300048903 Ga0496100_0088734 Ga0496100_0088734_681_1649 309
50 3300048909 Ga0496106_0417155 Ga0496106_0417155_60_1028 309
51 3300048912 Ga0496109_0022619 Ga0496109_0022619_4209_5177 309
52 3300048913 Ga0496110_0018731 Ga0496110_0018731_2854_3822 309
53 3300013100 Ga0157373_10053542 Ga0157373_100535424 315
54 3300005327 Ga0070658_10015309 Ga0070658_100153094 316
55 3300005336 Ga0070680_100005928 Ga0070680_1000059284 316
56 3300005355 Ga0070671_100012922 Ga0070671_1000129223 316
57 3300005364 Ga0070673_100012282 Ga0070673_1000122824 316
58 3300005364 Ga0070673_100358326 Ga0070673_1003583261 316
59 3300005530 Ga0070679_100031598 Ga0070679_1000315984 316
60 3300005563 Ga0068855_100063186 Ga0068855_1000631864 316
61 3300005577 Ga0068857_100117471 Ga0068857_1001174712 316
62 3300005614 Ga0068856_100085606 Ga0068856_1000856062 316
63 3300005842 Ga0068858_100035994 Ga0068858_1000359944 316
64 3300005843 Ga0068860_100054328 Ga0068860_1000543282 316
65 3300009177 Ga0105248_10020592 Ga0105248_100205923 316
66 3300013307 Ga0157372_10081461 Ga0157372_100814612 316
67 3300013308 Ga0157375_10185097 Ga0157375_101850972 316
68 3300025909 Ga0207705_10011733 Ga0207705_100117332 316
69 3300025917 Ga0207660_10005394 Ga0207660_100053942 316
70 3300025919 Ga0207657_10048326 Ga0207657_100483263 316
71 3300025919 Ga0207657_10304195 Ga0207657_103041951 316
72 3300025931 Ga0207644_10018177 Ga0207644_100181773 316
73 3300025931 Ga0207644_10020361 Ga0207644_100203612 316
74 3300025941 Ga0207711_10030792 Ga0207711_100307923 316
75 3300025945 Ga0207679_10058226 Ga0207679_100582262 316
76 3300026035 Ga0207703_10027227 Ga0207703_100272272 316
77 3300026035 Ga0207703_10135121 Ga0207703_101351212 316
78 3300026089 Ga0207648_10155268 Ga0207648_101552682 316
79 3300026095 Ga0207676_10021708 Ga0207676_100217084 316
80 3300026116 Ga0207674_10026445 Ga0207674_100264455 316
81 3300028381 Ga0268264_10004881 Ga0268264_100048818 316
82 3300028381 Ga0268264_10086115 Ga0268264_100861153 316
83 3300037418 Ga0395900_0004573 Ga0395900_0004573_7855_8835 316
84 3300037418 Ga0395900_0005248 Ga0395900_0005248_12391_13371 316
85 3300037418 Ga0395900_0042652 Ga0395900_0042652_2541_3521 316
86 3300037466 Ga0395898_0016577 Ga0395898_0016577_3388_4368 316
87 3300037466 Ga0395898_0054039 Ga0395898_0054039_110_1090 316
88 3300037466 Ga0395898_0119331 Ga0395898_0119331_110_1090 316
89 3300037471 Ga0395905_0000335 Ga0395905_0000335_50080_51060 316
90 3300037471 Ga0395905_0000675 Ga0395905_0000675_4725_5705 316
91 3300037471 Ga0395905_0025857 Ga0395905_0025857_258_1238 316
92 3300037471 Ga0395905_0061512 Ga0395905_0061512_1735_2715 316
93 3300037471 Ga0395905_0244021 Ga0395905_0244021_139_1119 316
94 3300038443 Ga0395901_0009100 Ga0395901_0009100_3592_4572 316
95 3300038443 Ga0395901_0016886 Ga0395901_0016886_59_1039 316
96 3300038443 Ga0395901_0101997 Ga0395901_0101997_1328_2308 316
97 3300038443 Ga0395901_0483625 Ga0395901_0483625_65_1045 316
98 3300045976 Ga0466967_0145260 Ga0466967_0145260_187_1167 316
99 3300048911 Ga0496108_0026674 Ga0496108_0026674_1565_2545 316
100 3300048912 Ga0496109_0099402 Ga0496109_0099402_377_1357 316
101 3300048913 Ga0496110_0018429 Ga0496110_0018429_2974_3954 316
102 3300048913 Ga0496110_0101130 Ga0496110_0101130_1470_2450 316
103 3300048914 Ga0496111_0007457 Ga0496111_0007457_3172_4152 316
104 3300048915 Ga0496112_0026570 Ga0496112_0026570_288_1268 316
105 3300048915 Ga0496112_0076418 Ga0496112_0076418_1514_2494 316
106 3300048918 Ga0496115_0000471 Ga0496115_0000471_13137_14117 316
107 3300005339 Ga0070660_100104177 Ga0070660_1001041773 317
108 3300005458 Ga0070681_10107126 Ga0070681_101071262 317
109 3300005530 Ga0070679_100381229 Ga0070679_1003812292 317
110 3300005547 Ga0070693_100061775 Ga0070693_1000617752 317
111 3300005564 Ga0070664_100324896 Ga0070664_1003248962 317
112 3300005577 Ga0068857_100177060 Ga0068857_1001770601 317
113 3300005577 Ga0068857_100252548 Ga0068857_1002525482 317
114 3300013104 Ga0157370_10422166 Ga0157370_104221662 317
115 3300025909 Ga0207705_10172873 Ga0207705_101728732 317
116 3300025912 Ga0207707_10117585 Ga0207707_101175852 317
117 3300026116 Ga0207674_10165741 Ga0207674_101657412 317
118 3300026142 Ga0207698_10154243 Ga0207698_101542432 317
119 3300037312 Ga0395899_0225223 Ga0395899_0225223_45_1028 317
120 3300037418 Ga0395900_0010879 Ga0395900_0010879_3604_4587 317
121 3300037471 Ga0395905_0001652 Ga0395905_0001652_24908_25861 317
122 3300037471 Ga0395905_0062562 Ga0395905_0062562_143_1126 317
123 3300037471 Ga0395905_0070891 Ga0395905_0070891_663_1646 317
124 3300037471 Ga0395905_0273708 Ga0395905_0273708_106_1089 317
125 3300038443 Ga0395901_0023235 Ga0395901_0023235_21_1004 317
126 3300038443 Ga0395901_0027901 Ga0395901_0027901_3557_4540 317
127 3300049587 Ga0501071_0221001 Ga0501071_0221001_172_1155 317
128 3300001979 JGI24740J21852_10023937 JGI24740J21852_100239372 318
129 3300001989 JGI24739J22299_10002532 JGI24739J22299_100025324 318
130 3300001990 JGI24737J22298_10001578 JGI24737J22298_100015784 318
131 3300002067 JGI24735J21928_10045702 JGI24735J21928_100457021 318
132 3300002075 JGI24738J21930_10000740 JGI24738J21930_100007405 318
133 3300005327 Ga0070658_10000477 Ga0070658_100004776 318
134 3300005329 Ga0070683_100000747 Ga0070683_1000007478 318
135 3300005331 Ga0070670_100083704 Ga0070670_1000837043 318
136 3300005335 Ga0070666_10002691 Ga0070666_100026916 318
137 3300005336 Ga0070680_100004079 Ga0070680_1000040795 318
138 3300005337 Ga0070682_100025238 Ga0070682_1000252384 318
139 3300005339 Ga0070660_100000425 Ga0070660_10000042529 318
140 3300005344 Ga0070661_100000552 Ga0070661_10000055226 318
141 3300005366 Ga0070659_100000065 Ga0070659_10000006513 318
142 3300005366 Ga0070659_100198676 Ga0070659_1001986762 318
143 3300005457 Ga0070662_100000010 Ga0070662_10000001056 318
144 3300005539 Ga0068853_100000067 Ga0068853_10000006725 318
145 3300005546 Ga0070696_100113516 Ga0070696_1001135162 318
146 3300005548 Ga0070665_100147048 Ga0070665_1001470482 318
147 3300005563 Ga0068855_100014637 Ga0068855_1000146375 318
148 3300005564 Ga0070664_100000228 Ga0070664_10000022824 318
149 3300005578 Ga0068854_100061254 Ga0068854_1000612543 318
150 3300005578 Ga0068854_100062704 Ga0068854_1000627042 318
151 3300005614 Ga0068856_100000101 Ga0068856_10000010181 318
152 3300005616 Ga0068852_100002148 Ga0068852_1000021482 318
153 3300005616 Ga0068852_100085386 Ga0068852_1000853861 318
154 3300005616 Ga0068852_100145865 Ga0068852_1001458652 318
155 3300005617 Ga0068859_100114580 Ga0068859_1001145803 318
156 3300005618 Ga0068864_100017032 Ga0068864_1000170324 318
157 3300005834 Ga0068851_10009336 Ga0068851_100093364 318
158 3300005842 Ga0068858_100022535 Ga0068858_1000225354 318
159 3300006237 Ga0097621_100063715 Ga0097621_1000637153 318
160 3300006358 Ga0068871_100116223 Ga0068871_1001162231 318
161 3300006931 Ga0097620_100114583 Ga0097620_1001145833 318
162 3300009174 Ga0105241_10050106 Ga0105241_100501062 318
163 3300009177 Ga0105248_10000334 Ga0105248_1000033436 318
164 3300009551 Ga0105238_10096526 Ga0105238_100965262 318
165 3300013100 Ga0157373_10016990 Ga0157373_100169903 318
166 3300013102 Ga0157371_10000972 Ga0157371_1000097226 318
167 3300013104 Ga0157370_10038039 Ga0157370_100380393 318
168 3300014325 Ga0163163_10000313 Ga0163163_100003135 318
169 3300014968 Ga0157379_10046075 Ga0157379_100460752 318
170 3300025321 Ga0207656_10005048 Ga0207656_100050483 318
171 3300025903 Ga0207680_10003325 Ga0207680_100033254 318
172 3300025904 Ga0207647_10027591 Ga0207647_100275914 318
173 3300025909 Ga0207705_10000113 Ga0207705_100001133 318
174 3300025917 Ga0207660_10004863 Ga0207660_100048635 318
175 3300025919 Ga0207657_10000026 Ga0207657_1000002681 318
176 3300025920 Ga0207649_10034331 Ga0207649_100343312 318
177 3300025924 Ga0207694_10069273 Ga0207694_100692733 318
178 3300025925 Ga0207650_10064418 Ga0207650_100644182 318
179 3300025932 Ga0207690_10000483 Ga0207690_100004832 318
180 3300025933 Ga0207706_10000031 Ga0207706_1000003154 318
181 3300025944 Ga0207661_10000753 Ga0207661_100007532 318
182 3300025945 Ga0207679_10000236 Ga0207679_1000023629 318
183 3300025949 Ga0207667_10026672 Ga0207667_100266724 318
184 3300025949 Ga0207667_10038405 Ga0207667_100384054 318
185 3300025981 Ga0207640_10005666 Ga0207640_100056662 318
186 3300025981 Ga0207640_10048857 Ga0207640_100488572 318
187 3300026023 Ga0207677_10245697 Ga0207677_102456972 318
188 3300026041 Ga0207639_10001274 Ga0207639_100012742 318
189 3300026067 Ga0207678_10009334 Ga0207678_100093343 318
190 3300026078 Ga0207702_10002108 Ga0207702_100021084 318
191 3300026078 Ga0207702_10252927 Ga0207702_102529271 318
192 3300026095 Ga0207676_10134189 Ga0207676_101341892 318
193 3300026142 Ga0207698_10001461 Ga0207698_100014619 318
194 3300026142 Ga0207698_10030464 Ga0207698_100304644 318
195 3300026142 Ga0207698_10051738 Ga0207698_100517384 318
196 3300028379 Ga0268266_10008512 Ga0268266_100085125 318
197 3300035691 Ga0373931_0000955 Ga0373931_0000955_7152_8138 318
198 3300037418 Ga0395900_0043203 Ga0395900_0043203_377_1333 318
199 3300045976 Ga0466967_0009684 Ga0466967_0009684_658_1644 318
200 3300048915 Ga0496112_0371353 Ga0496112_0371353_52_1038 318
201 3300005543 Ga0070672_100062213 Ga0070672_1000622133 319
202 3300025909 Ga0207705_10097949 Ga0207705_100979492 319
203 3300025919 Ga0207657_10018041 Ga0207657_100180414 319
204 3300025945 Ga0207679_10190480 Ga0207679_101904802 319
205 3300025986 Ga0207658_10052521 Ga0207658_100525212 319
206 3300026067 Ga0207678_10002983 Ga0207678_100029837 319
207 3300032126 Ga0307415_100008047 Ga0307415_1000080474 319
208 3300037471 Ga0395905_0044885 Ga0395905_0044885_2870_3862 319
209 3300038443 Ga0395901_0408467 Ga0395901_0408467_20_1012 319
210 3300042439 Ga0439464_0003653 Ga0439464_0003653_1887_2861 319
211 3300001915 JGI24741J21665_1000359 JGI24741J21665_10003592 320
212 3300001989 JGI24739J22299_10009824 JGI24739J22299_100098243 320
213 3300002067 JGI24735J21928_10001819 JGI24735J21928_100018195 320
214 3300005327 Ga0070658_10008982 Ga0070658_100089823 320
215 3300005327 Ga0070658_10032042 Ga0070658_100320424 320
216 3300005327 Ga0070658_10103194 Ga0070658_101031942 320
217 3300005327 Ga0070658_10208358 Ga0070658_102083582 320
218 3300005329 Ga0070683_100062540 Ga0070683_1000625403 320
219 3300005337 Ga0070682_100059994 Ga0070682_1000599943 320
220 3300005344 Ga0070661_100001960 Ga0070661_10000196015 320
221 3300005344 Ga0070661_100011526 Ga0070661_1000115263 320
222 3300005354 Ga0070675_100013308 Ga0070675_1000133084 320
223 3300005355 Ga0070671_100029009 Ga0070671_1000290094 320
224 3300005364 Ga0070673_100004722 Ga0070673_1000047224 320
225 3300005366 Ga0070659_100251961 Ga0070659_1002519612 320
226 3300005367 Ga0070667_100006194 Ga0070667_1000061948 320
227 3300005455 Ga0070663_100049555 Ga0070663_1000495552 320
228 3300005456 Ga0070678_100098454 Ga0070678_1000984542 320
229 3300005457 Ga0070662_100006303 Ga0070662_1000063033 320
230 3300005466 Ga0070685_10144334 Ga0070685_101443341 320
231 3300005539 Ga0068853_100020004 Ga0068853_1000200044 320
232 3300005539 Ga0068853_100030077 Ga0068853_1000300774 320
233 3300005539 Ga0068853_100091087 Ga0068853_1000910871 320
234 3300005548 Ga0070665_100036042 Ga0070665_1000360424 320
235 3300005564 Ga0070664_100029951 Ga0070664_1000299512 320
236 3300005564 Ga0070664_100061124 Ga0070664_1000611244 320
237 3300005564 Ga0070664_100280778 Ga0070664_1002807782 320
238 3300005577 Ga0068857_100019111 Ga0068857_1000191114 320
239 3300005577 Ga0068857_100039511 Ga0068857_1000395112 320
240 3300005577 Ga0068857_100065260 Ga0068857_1000652603 320
241 3300005578 Ga0068854_100014802 Ga0068854_1000148022 320
242 3300005616 Ga0068852_100014908 Ga0068852_1000149084 320
243 3300005616 Ga0068852_100019281 Ga0068852_1000192814 320
244 3300005618 Ga0068864_100002833 Ga0068864_10000283310 320
245 3300005718 Ga0068866_10072449 Ga0068866_100724492 320
246 3300005834 Ga0068851_10073069 Ga0068851_100730692 320
247 3300005841 Ga0068863_100029536 Ga0068863_1000295362 320
248 3300005841 Ga0068863_100228755 Ga0068863_1002287552 320
249 3300005842 Ga0068858_100042791 Ga0068858_1000427914 320
250 3300006237 Ga0097621_100023999 Ga0097621_1000239994 320
251 3300006881 Ga0068865_100070408 Ga0068865_1000704082 320
252 3300006931 Ga0097620_100064476 Ga0097620_1000644762 320
253 3300009177 Ga0105248_10265345 Ga0105248_102653452 320
254 3300009551 Ga0105238_10031614 Ga0105238_100316144 320
255 3300013100 Ga0157373_10140985 Ga0157373_101409851 320
256 3300013105 Ga0157369_10003181 Ga0157369_100031814 320
257 3300013296 Ga0157374_10009442 Ga0157374_100094423 320
258 3300013306 Ga0163162_10016029 Ga0163162_100160294 320
259 3300013308 Ga0157375_10504331 Ga0157375_105043312 320
260 3300014325 Ga0163163_10003326 Ga0163163_100033269 320
261 3300025909 Ga0207705_10012021 Ga0207705_100120214 320
262 3300025909 Ga0207705_10026614 Ga0207705_100266142 320
263 3300025909 Ga0207705_10107329 Ga0207705_101073292 320
264 3300025909 Ga0207705_10236057 Ga0207705_102360572 320
265 3300025917 Ga0207660_10025666 Ga0207660_100256663 320
266 3300025917 Ga0207660_10146613 Ga0207660_101466132 320
267 3300025919 Ga0207657_10002994 Ga0207657_100029942 320
268 3300025919 Ga0207657_10003765 Ga0207657_100037654 320
269 3300025919 Ga0207657_10014502 Ga0207657_100145023 320
270 3300025919 Ga0207657_10267745 Ga0207657_102677451 320
271 3300025920 Ga0207649_10009730 Ga0207649_100097304 320
272 3300025924 Ga0207694_10026504 Ga0207694_100265043 320
273 3300025931 Ga0207644_10020170 Ga0207644_100201704 320
274 3300025932 Ga0207690_10003086 Ga0207690_100030862 320
275 3300025932 Ga0207690_10136868 Ga0207690_101368682 320
276 3300025932 Ga0207690_10327622 Ga0207690_103276221 320
277 3300025933 Ga0207706_10003216 Ga0207706_100032168 320
278 3300025933 Ga0207706_10003927 Ga0207706_100039272 320
279 3300025937 Ga0207669_10073337 Ga0207669_100733371 320
280 3300025940 Ga0207691_10006678 Ga0207691_100066782 320
281 3300025941 Ga0207711_10005313 Ga0207711_100053138 320
282 3300025941 Ga0207711_10009449 Ga0207711_100094494 320
283 3300025941 Ga0207711_10011971 Ga0207711_100119713 320
284 3300025944 Ga0207661_10000778 Ga0207661_1000077815 320
285 3300025945 Ga0207679_10035373 Ga0207679_100353732 320
286 3300025945 Ga0207679_10427050 Ga0207679_104270502 320
287 3300025981 Ga0207640_10021362 Ga0207640_100213623 320
288 3300025986 Ga0207658_10037581 Ga0207658_100375811 320
289 3300026041 Ga0207639_10006966 Ga0207639_100069662 320
290 3300026041 Ga0207639_10071196 Ga0207639_100711962 320
291 3300026067 Ga0207678_10003132 Ga0207678_100031328 320
292 3300026078 Ga0207702_10152183 Ga0207702_101521832 320
293 3300026088 Ga0207641_10161984 Ga0207641_101619842 320
294 3300026088 Ga0207641_10199025 Ga0207641_101990252 320
295 3300026095 Ga0207676_10020153 Ga0207676_100201533 320
296 3300026095 Ga0207676_10122383 Ga0207676_101223832 320
297 3300026116 Ga0207674_10002544 Ga0207674_100025444 320
298 3300026116 Ga0207674_10023448 Ga0207674_100234484 320
299 3300026116 Ga0207674_10025126 Ga0207674_100251262 320
300 3300026121 Ga0207683_10001328 Ga0207683_1000132816 320
301 3300026121 Ga0207683_10121160 Ga0207683_101211603 320
302 3300026142 Ga0207698_10006901 Ga0207698_100069014 320
303 3300026142 Ga0207698_10134720 Ga0207698_101347202 320
304 3300026142 Ga0207698_10214203 Ga0207698_102142032 320
305 3300031548 Ga0307408_100117120 Ga0307408_1001171202 320
306 3300032002 Ga0307416_100005432 Ga0307416_1000054325 320
307 3300032004 Ga0307414_10026782 Ga0307414_100267822 320
308 3300032126 Ga0307415_100066590 Ga0307415_1000665902 320
309 3300037312 Ga0395899_0008635 Ga0395899_0008635_1796_2788 320
310 3300037418 Ga0395900_0273410 Ga0395900_0273410_80_1072 320
311 3300037418 Ga0395900_0367709 Ga0395900_0367709_156_1151 320
312 3300037418 Ga0395900_0406558 Ga0395900_0406558_158_1153 320
313 3300037471 Ga0395905_0035724 Ga0395905_0035724_435_1427 320
314 3300037471 Ga0395905_0137989 Ga0395905_0137989_313_1308 320
315 3300037471 Ga0395905_0318243 Ga0395905_0318243_46_1062 320
316 3300038443 Ga0395901_0011445 Ga0395901_0011445_5529_6545 320
317 3300038443 Ga0395901_0051368 Ga0395901_0051368_1219_2235 320
318 3300038443 Ga0395901_0091458 Ga0395901_0091458_1464_2456 320
319 3300044694 Ga0466963_0015659 Ga0466963_0015659_3277_4269 320
320 3300044694 Ga0466963_0017824 Ga0466963_0017824_3351_4343 320
321 3300044694 Ga0466963_0045967 Ga0466963_0045967_1636_2628 320
322 3300044694 Ga0466963_0204185 Ga0466963_0204185_313_1305 320
323 3300045836 Ga0466958_0037143 Ga0466958_0037143_535_1527 320
324 3300045976 Ga0466967_0017252 Ga0466967_0017252_3419_4411 320
325 3300045976 Ga0466967_0181936 Ga0466967_0181936_296_1288 320
326 3300048903 Ga0496100_0028750 Ga0496100_0028750_1557_2549 320
327 3300048904 Ga0496101_0155325 Ga0496101_0155325_462_1454 320
328 3300048910 Ga0496107_0006559 Ga0496107_0006559_927_1919 320
329 3300048912 Ga0496109_0005203 Ga0496109_0005203_2230_3222 320
330 3300048915 Ga0496112_0002727 Ga0496112_0002727_12627_13619 320

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11199

DUF2891

Protein of unknown function (DUF2891)

110

352

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ieu-assembly1.cif.gz_A crystal structure of the duf2891 family protein cj0554 from campylobacter jejuni in space group p41212 0.9342 6 316
8ieu-assembly1.cif.gz_A crystal structure of the duf2891 family protein cj0554 from campylobacter jejuni in space group p41212 0.909 6 316
3kq4-assembly1.cif.gz_A structure of intrinsic factor-cobalamin bound to its receptor cubilin 0.5543 3 318
1k72-assembly1.cif.gz_A the x-ray crystal structure of cel9g complexed with cellotriose 0.5483 54 238
5fo8-assembly1.cif.gz_B crystal structure of human complement c3b in complex with mcp (ccp1-4) 0.5459 1 314
ID Description Score Start End Superfamily
af_Q2FXB4_7_413_1.50.10.20 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.5402 47 301 1.50.10.20
af_P76578_1172_1439_1.50.10.20 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.5358 55 314 1.50.10.20
af_I1MD97_105_629_1.50.10.10 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.5306 55 315 1.50.10.10
af_K7MNB0_1_198_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.5293 89 209 1.25.10.10
af_A4I925_89_213_1.20.1050.10 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.5199 111 199 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A258D7L4-F1-model_v4 DUF2891 domain-containing protein 0.9619 2 171
AF-A0A519Q4V9-F1-model_v4 DUF2891 family protein 0.9588 1 150
AF-A0A2E0DCU3-F1-model_v4 DUF2891 domain-containing protein 0.9536 2 176
AF-A0A2V6GE14-F1-model_v4 DUF2891 domain-containing protein 0.9519 5 176
AF-A0A519QER7-F1-model_v4 DUF2891 domain-containing protein 0.9516 1 233

Feature Viewer

pLDDT pTM Quality
87.29 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map