F410135

General Info

Members Datasets Scaffolds Average Seq Length
330 189 329 219

Family's Representative Sequence

Representative Sequence 3300026116|Ga0207674_10398709|Ga0207674_103987092
Length 259
Sequence MLSVDKTIAGEPVATVNSRAMVYQGTRHSVSEWHILRAAAPNLLITGVPDAVEQYLAGLNRGSDAVLDDITRQNAQRGLPLVDAEVGALLRVLATAIGAARILEIGTAIGYSGIWLAGALPPHGTLLTMEVKPERARIARENFARSGLAERVSVIVGDAQRMLAKVSGPFDLIFQDGDKPQYLTQLDRLVDLLRPGGLLVTDNVLWDGEVVPGFLASPKRNDTDTRAIAEYNERINHHPQLMTVIVPLRDGVAISVKKP

Samples

Sample ID Description Type Environment
1 2738543017 Bacillus sp. OV186 Isolate Unclassified
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
83 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
131 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
132 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
133 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
134 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
135 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
136 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
143 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
146 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
147 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
151 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
152 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
155 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
156 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
157 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
184 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
186 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
187 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
188 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.48
Metatranscriptomes 1.21
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.76
Rhizosphere 93.94
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10094851 3300005290 Bacteria 2239
2 Ga0065707_10309674 3300005295 Bacteria 987
3 Ga0065707_10323254 3300005295 Bacteria 962
4 Ga0070676_10006032 3300005328 Bacteria 6469
5 Ga0070683_100032468 3300005329 Bacteria 4754
6 Ga0070683_100185504 3300005329 Bacteria 1975
7 Ga0070670_100118502 3300005331 Bacteria 2283
8 Ga0068869_100824020 3300005334 Bacteria 799
9 Ga0070666_10022615 3300005335 Bacteria 4085
10 Ga0070666_10259056 3300005335 Unclassified 1233
11 Ga0070682_100122207 3300005337 Bacteria 1750
12 Ga0068868_100054349 3300005338 Bacteria 3155
13 Ga0068868_100169146 3300005338 Bacteria 1809
14 Ga0070689_100114146 3300005340 Bacteria 2152
15 Ga0070668_100071196 3300005347 Bacteria 2708
16 Ga0070669_100054530 3300005353 Bacteria 2928
17 Ga0070669_100133480 3300005353 Bacteria 1907
18 Ga0070675_100008173 3300005354 Bacteria 8110
19 Ga0070671_100339722 3300005355 Bacteria 1281
20 Ga0070674_100220929 3300005356 Bacteria 1474
21 Ga0070674_100259586 3300005356 Bacteria 1368
22 Ga0070673_100019988 3300005364 Bacteria 4821
23 Ga0070673_100100589 3300005364 Bacteria 2380
24 Ga0070688_100302240 3300005365 Unclassified 1157
25 Ga0070703_10244783 3300005406 Bacteria 725
26 Ga0070709_10008290 3300005434 Bacteria 5707
27 Ga0070710_10148899 3300005437 Unclassified 1442
28 Ga0070701_10263761 3300005438 Bacteria 1045
29 Ga0070705_100119604 3300005440 Bacteria 1698
30 Ga0070705_100817351 3300005440 Bacteria 743
31 Ga0070700_100001951 3300005441 Bacteria 10464
32 Ga0070700_100654418 3300005441 Bacteria 830
33 Ga0070694_100028208 3300005444 Bacteria 3650
34 Ga0070694_100189450 3300005444 Bacteria 1527
35 Ga0070662_100036423 3300005457 Bacteria 3480
36 Ga0070662_100077040 3300005457 Bacteria 2474
37 Ga0070681_10005027 3300005458 Bacteria 12748
38 Ga0068867_100139495 3300005459 Bacteria 1894
39 Ga0068867_100182401 3300005459 Bacteria 1670
40 Ga0068867_100214768 3300005459 Unclassified 1547
41 Ga0070707_101220904 3300005468 Bacteria 718
42 Ga0070698_100074937 3300005471 Bacteria 3389
43 Ga0070698_100178079 3300005471 Bacteria 2065
44 Ga0070699_100142014 3300005518 Bacteria 2121
45 Ga0070699_100197138 3300005518 Bacteria 1790
46 Ga0070699_100243245 3300005518 Bacteria 1607
47 Ga0070684_100190456 3300005535 Bacteria 1866
48 Ga0070697_100033666 3300005536 Bacteria 4128
49 Ga0070697_100119190 3300005536 Bacteria 2206
50 Ga0070686_100051702 3300005544 Bacteria 2617
51 Ga0070695_100001702 3300005545 Bacteria 12373
52 Ga0070695_100186440 3300005545 Bacteria 1473
53 Ga0070695_100195799 3300005545 Bacteria 1441
54 Ga0070665_100018557 3300005548 Bacteria 6971
55 Ga0070665_100023225 3300005548 Bacteria 6245
56 Ga0070665_100636297 3300005548 Unclassified 1080
57 Ga0070704_100013395 3300005549 Bacteria 5088
58 Ga0070704_100065016 3300005549 Bacteria 2624
59 Ga0070704_100237671 3300005549 Bacteria 1490
60 Ga0070704_100240365 3300005549 Bacteria 1482
61 Ga0070704_100347377 3300005549 Bacteria 1251
62 Ga0070704_100367433 3300005549 Unclassified 1219
63 Ga0068855_100291777 3300005563 Bacteria 1808
64 Ga0068855_100742819 3300005563 Bacteria 1047
65 Ga0068857_100193245 3300005577 Unclassified 1854
66 Ga0068857_101208920 3300005577 Bacteria 732
67 Ga0068854_100542518 3300005578 Bacteria 985
68 Ga0068856_100012722 3300005614 Bacteria 8148
69 Ga0070702_100016693 3300005615 Bacteria 3772
70 Ga0068859_100170268 3300005617 Bacteria 2259
71 Ga0068864_100006498 3300005618 Bacteria 9578
72 Ga0068866_10051070 3300005718 Bacteria 2103
73 Ga0068861_100018542 3300005719 Bacteria 4958
74 Ga0068861_100902327 3300005719 Unclassified 837
75 Ga0068851_10247695 3300005834 Bacteria 1010
76 Ga0068863_100047664 3300005841 Bacteria 4064
77 Ga0068863_100199793 3300005841 Bacteria 1923
78 Ga0068858_100001195 3300005842 Bacteria 26893
79 Ga0068858_100017067 3300005842 Bacteria 6814
80 Ga0068858_100039189 3300005842 Bacteria 4394
81 Ga0068858_100133957 3300005842 Bacteria 2324
82 Ga0068858_100389646 3300005842 Bacteria 1338
83 Ga0068860_100301163 3300005843 Bacteria 1570
84 Ga0068860_100359551 3300005843 Bacteria 1434
85 Ga0068860_100422504 3300005843 Bacteria 1322
86 Ga0068860_101024829 3300005843 Bacteria 844
87 Ga0068862_100051707 3300005844 Bacteria 3514
88 Ga0068862_100686339 3300005844 Unclassified 991
89 Ga0081455_10117576 3300005937 Bacteria 2101
90 Ga0081455_10374302 3300005937 Bacteria 997
91 Ga0097621_100001981 3300006237 Bacteria 13957
92 Ga0097621_100026980 3300006237 Bacteria 4512
93 Ga0097621_100157064 3300006237 Unclassified 1953
94 Ga0097621_100336962 3300006237 Bacteria 1339
95 Ga0068871_100106790 3300006358 Bacteria 2350
96 Ga0075428_100379445 3300006844 Bacteria 1515
97 Ga0075428_100383623 3300006844 Bacteria 1506
98 Ga0075433_10356364 3300006852 Bacteria 1292
99 Ga0075434_100124392 3300006871 Bacteria 2596
100 Ga0068865_100015969 3300006881 Bacteria 4794
101 Ga0068865_100141073 3300006881 Bacteria 1817
102 Ga0068865_100269568 3300006881 Bacteria 1351
103 Ga0097620_100170275 3300006931 Bacteria 2259
104 Ga0075435_100002333 3300007076 Bacteria 12568
105 Ga0075435_100002895 3300007076 Bacteria 11519
106 Ga0105240_10082523 3300009093 Bacteria 3947
107 Ga0105240_10140985 3300009093 Bacteria 2882
108 Ga0111539_10000935 3300009094 Bacteria 38232
109 Ga0111539_10008540 3300009094 Bacteria 13012
110 Ga0111539_10455093 3300009094 Bacteria 1490
111 Ga0105245_10015905 3300009098 Bacteria 6556
112 Ga0105245_10089696 3300009098 Bacteria 2827
113 Ga0105245_10423919 3300009098 Unclassified 1334
114 Ga0105247_10002020 3300009101 Bacteria 14051
115 Ga0105247_10147047 3300009101 Bacteria 1550
116 Ga0114129_10007867 3300009147 Bacteria 15167
117 Ga0114129_10013657 3300009147 Bacteria 11571
118 Ga0114129_10117078 3300009147 Bacteria 3672
119 Ga0114129_10189994 3300009147 Bacteria 2790
120 Ga0114129_10349607 3300009147 Bacteria 1959
121 Ga0114129_10885939 3300009147 Bacteria 1132
122 Ga0105243_10006691 3300009148 Bacteria 8900
123 Ga0105243_10028042 3300009148 Bacteria 4320
124 Ga0105242_10001497 3300009176 Bacteria 18385
125 Ga0105242_10010723 3300009176 Bacteria 7035
126 Ga0105242_10155440 3300009176 Bacteria 1998
127 Ga0105242_10263817 3300009176 Bacteria 1557
128 Ga0105242_10666029 3300009176 Unclassified 1014
129 Ga0105242_10844516 3300009176 Unclassified 911
130 Ga0105248_10004967 3300009177 Bacteria 14695
131 Ga0105248_10032316 3300009177 Bacteria 5850
132 Ga0105248_10085025 3300009177 Bacteria 3560
133 Ga0105248_10347109 3300009177 Bacteria 1671
134 Ga0105238_10238899 3300009551 Bacteria 1794
135 Ga0105238_10485749 3300009551 Bacteria 1235
136 Ga0105249_10759647 3300009553 Bacteria 1032
137 Ga0105239_10579638 3300010375 Bacteria 1279
138 Ga0157374_10005500 3300013296 Bacteria 10642
139 Ga0157374_10473334 3300013296 Bacteria 1255
140 Ga0157374_11277879 3300013296 Bacteria 756
141 Ga0163162_10194211 3300013306 Unclassified 2158
142 Ga0157375_10252470 3300013308 Bacteria 1924
143 Ga0163163_10021113 3300014325 Bacteria 6142
144 Ga0163163_10638183 3300014325 Bacteria 1128
145 Ga0163163_11359286 3300014325 Bacteria 772
146 Ga0157379_10285364 3300014968 Bacteria 1503
147 Ga0157376_10052476 3300014969 Bacteria 3391
148 Ga0157376_10152202 3300014969 Bacteria 2087
149 Ga0163161_10125570 3300017792 Bacteria 1932
150 Ga0197907_11211912 3300020069 Bacteria 902
151 Ga0206350_10454947 3300020080 Bacteria 1209
152 Ga0206353_10024490 3300020082 Bacteria 1039
153 Ga0213873_10019005 3300021358 Unclassified 1588
154 Ga0224712_10050333 3300022467 Bacteria 1618
155 Ga0207692_10125469 3300025898 Unclassified 1443
156 Ga0207642_10126994 3300025899 Unclassified 1325
157 Ga0207710_10050873 3300025900 Unclassified 1860
158 Ga0207710_10095975 3300025900 Bacteria 1394
159 Ga0207680_10131563 3300025903 Bacteria 1650
160 Ga0207680_10332932 3300025903 Bacteria 1064
161 Ga0207699_10030395 3300025906 Unclassified 3022
162 Ga0207645_10005347 3300025907 Bacteria 9335
163 Ga0207645_10360318 3300025907 Bacteria 974
164 Ga0207654_10584914 3300025911 Unclassified 795
165 Ga0207707_10182425 3300025912 Unclassified 1832
166 Ga0207695_10094368 3300025913 Bacteria 2999
167 Ga0207660_10181277 3300025917 Bacteria 1636
168 Ga0207652_10061637 3300025921 Unclassified 3239
169 Ga0207681_10018066 3300025923 Bacteria 4438
170 Ga0207681_10178358 3300025923 Bacteria 1616
171 Ga0207694_10251393 3300025924 Bacteria 1446
172 Ga0207650_10087970 3300025925 Bacteria 2368
173 Ga0207650_10166488 3300025925 Bacteria 1749
174 Ga0207650_10551692 3300025925 Bacteria 966
175 Ga0207687_10009905 3300025927 Bacteria 6241
176 Ga0207700_10261374 3300025928 Bacteria 1482
177 Ga0207644_10306702 3300025931 Bacteria 1281
178 Ga0207706_10016243 3300025933 Bacteria 6725
179 Ga0207706_10336123 3300025933 Bacteria 1314
180 Ga0207686_10029858 3300025934 Bacteria 3221
181 Ga0207686_10061276 3300025934 Bacteria 2385
182 Ga0207686_10086370 3300025934 Bacteria 2060
183 Ga0207686_10284344 3300025934 Bacteria 1222
184 Ga0207686_10635729 3300025934 Bacteria 843
185 Ga0207669_10171872 3300025937 Unclassified 1543
186 Ga0207669_10301934 3300025937 Bacteria 1217
187 Ga0207704_10004730 3300025938 Bacteria 6248
188 Ga0207704_10273290 3300025938 Bacteria 1281
189 Ga0207704_10281146 3300025938 Bacteria 1265
190 Ga0207691_10217365 3300025940 Unclassified 1658
191 Ga0207691_10567035 3300025940 Unclassified 962
192 Ga0207711_10010415 3300025941 Bacteria 7720
193 Ga0207711_10181558 3300025941 Unclassified 1914
194 Ga0207711_10366320 3300025941 Bacteria 1336
195 Ga0207689_10531834 3300025942 Unclassified 986
196 Ga0207661_10359781 3300025944 Unclassified 1314
197 Ga0207661_10478204 3300025944 Bacteria 1137
198 Ga0207651_10077219 3300025960 Bacteria 2384
199 Ga0207712_10044402 3300025961 Bacteria 3072
200 Ga0207668_10053925 3300025972 Bacteria 2789
201 Ga0207668_10071244 3300025972 Bacteria 2482
202 Ga0207668_10308822 3300025972 Bacteria 1308
203 Ga0207668_11071834 3300025972 Bacteria 722
204 Ga0207640_10019514 3300025981 Bacteria 4007
205 Ga0207658_10333916 3300025986 Bacteria 1316
206 Ga0207677_10033620 3300026023 Bacteria 3311
207 Ga0207677_10097404 3300026023 Bacteria 2155
208 Ga0207677_10298850 3300026023 Unclassified 1329
209 Ga0207703_10097906 3300026035 Bacteria 2480
210 Ga0207703_10107221 3300026035 Bacteria 2378
211 Ga0207703_10366665 3300026035 Bacteria 1329
212 Ga0207703_10513686 3300026035 Bacteria 1126
213 Ga0207639_10262798 3300026041 Unclassified 1510
214 Ga0207708_10001028 3300026075 Bacteria 20878
215 Ga0207708_10142201 3300026075 Bacteria 1883
216 Ga0207641_10000305 3300026088 Bacteria 61185
217 Ga0207641_10095485 3300026088 Bacteria 2610
218 Ga0207641_10532593 3300026088 Bacteria 1144
219 Ga0207648_10096299 3300026089 Bacteria 2590
220 Ga0207648_10199875 3300026089 Bacteria 1773
221 Ga0207648_10441313 3300026089 Unclassified 1184
222 Ga0207648_10787460 3300026089 Unclassified 885
223 Ga0207648_10851253 3300026089 Bacteria 850
224 Ga0207674_10219352 3300026116 Unclassified 1850
225 Ga0207674_10398709 3300026116 Bacteria 1330
226 Ga0207675_100011386 3300026118 Bacteria 8325
227 Ga0207675_100181525 3300026118 Bacteria 2015
228 Ga0207675_100994141 3300026118 Unclassified 857
229 Ga0207675_101233577 3300026118 Bacteria 768
230 Ga0207683_10085574 3300026121 Bacteria 2802
231 Ga0207428_10005438 3300027907 Bacteria 11878
232 Ga0207428_10032249 3300027907 Bacteria 4311
233 Ga0268266_10016288 3300028379 Bacteria 6355
234 Ga0268265_10036294 3300028380 Bacteria 3609
235 Ga0268265_10063859 3300028380 Bacteria 2834
236 Ga0268265_10856793 3300028380 Unclassified 889
237 Ga0268265_10965150 3300028380 Bacteria 840
238 Ga0268264_10088941 3300028381 Bacteria 2659
239 Ga0268264_10094529 3300028381 Bacteria 2584
240 Ga0268264_10199463 3300028381 Bacteria 1830
241 Ga0268264_10906155 3300028381 Bacteria 885
242 Ga0265332_10085280 3300031238 Bacteria 1338
243 Ga0307413_10175509 3300031824 Bacteria 1522
244 Ga0307416_100758104 3300032002 Unclassified 1064
245 Ga0373926_0065460 3300035083 Unclassified 1329
246 Ga0373949_0072588 3300035090 Bacteria 904
247 Ga0373945_0020076 3300035116 Bacteria 2284
248 Ga0373954_0107071 3300035118 Bacteria 1351
249 Ga0373943_0001265 3300035170 Bacteria 11318
250 Ga0373946_0000555 3300035171 Bacteria 12327
251 Ga0373955_0020699 3300035172 Bacteria 3311
252 Ga0373955_0123927 3300035172 Bacteria 1504
253 Ga0373955_0412024 3300035172 Unclassified 822
254 Ga0373931_0407253 3300035691 Bacteria 862
255 Ga0373935_0005913 3300035692 Bacteria 7251
256 Ga0373927_0034823 3300035695 Bacteria 3275
257 Ga0373927_0445839 3300035695 Unclassified 855
258 Ga0373937_0686653 3300036401 Bacteria 970
259 Ga0373925_0000774 3300037068 Bacteria 29390
260 Ga0466966_0195211 3300044684 Bacteria 1226
261 Ga0453684_1290499 3300044712 Unclassified 762
262 Ga0451576_0295135 3300045051 Bacteria 1695
263 Ga0451576_0585851 3300045051 Unclassified 1172
264 Ga0495592_0060529 3300046454 Bacteria 2785
265 Ga0495653_0280387 3300046463 Bacteria 1094
266 Ga0495608_0081441 3300046511 Bacteria 2103
267 Ga0495628_0349219 3300046516 Bacteria 1088
268 Ga0495630_0001845 3300046517 Bacteria 14790
269 Ga0495586_0047807 3300046535 Bacteria 2311
270 Ga0495621_0197798 3300046539 Unclassified 808
271 Ga0495645_0020630 3300046543 Bacteria 4758
272 Ga0495645_0465443 3300046543 Bacteria 795
273 Ga0495667_0354449 3300046559 Unclassified 927
274 Ga0495659_0146697 3300046664 Bacteria 945
275 Ga0495657_0120142 3300046675 Bacteria 1656
276 Ga0495599_0158568 3300046678 Bacteria 1399
277 Ga0495647_0058399 3300046681 Bacteria 1516
278 Ga0495658_0089146 3300046683 Bacteria 1824
279 Ga0495613_0000507 3300046689 Bacteria 32852
280 Ga0495600_0426617 3300046809 Bacteria 822
281 Ga0495674_0071627 3300047319 Bacteria 2991
282 Ga0495684_0000188 3300047471 Bacteria 47553
283 Ga0495684_0622149 3300047471 Bacteria 726
284 Ga0496100_0000448 3300048903 Bacteria 19914
285 Ga0496101_0002514 3300048904 Bacteria 11257
286 Ga0496102_0060758 3300048905 Bacteria 3457
287 Ga0496104_0031992 3300048907 Bacteria 4895
288 Ga0496104_0241341 3300048907 Bacteria 1719
289 Ga0496105_0067097 3300048908 Bacteria 2962
290 Ga0496106_0050432 3300048909 Bacteria 3137
291 Ga0496107_0019653 3300048910 Bacteria 4766
292 Ga0496107_0166783 3300048910 Unclassified 1633
293 Ga0496108_0006500 3300048911 Bacteria 9482
294 Ga0496112_0015766 3300048915 Bacteria 7060
295 Ga0496112_0646786 3300048915 Bacteria 987
296 Ga0496112_0720724 3300048915 Viruses 925
297 Ga0496113_0074457 3300048916 Bacteria 2589
298 Ga0496114_0003658 3300048917 Bacteria 11830
299 Ga0496114_0037122 3300048917 Bacteria 4030
300 Ga0496114_0090296 3300048917 Bacteria 2600
301 Ga0496114_0169819 3300048917 Bacteria 1900
302 Ga0496115_0279086 3300048918 Unclassified 1372
303 Ga0501034_0010792 3300049571 Bacteria 9491
304 Ga0501047_0005626 3300049581 Bacteria 11805
305 Ga0501070_0523468 3300049586 Bacteria 951
306 Ga0501073_0431609 3300049589 Bacteria 910
307 Ga0501044_0002807 3300049823 Bacteria 19856
308 nmdc:mga05p37_128988_c1 3300050507 Bacteria 3104
309 nmdc:mga05p37_14746_c1 3300050507 Bacteria 9387
310 nmdc:mga05p37_210080_c1 3300050507 Bacteria 1467
311 nmdc:mga05p37_26826_c1 3300050507 Bacteria 7008
312 nmdc:mga05p37_510556_c1 3300050507 Bacteria 1377
313 nmdc:mga05p37_7460_c1 3300050507 Bacteria 12894
314 nmdc:mga05p37_95774_c1 3300050507 Bacteria 3657
315 nmdc:mga08y16_147131_c1 3300050511 Bacteria 2449
316 nmdc:mga08y16_7610_c1 3300050511 Bacteria 11336
317 nmdc:mga0n895_298033_c1 3300050512 Bacteria 1635
318 nmdc:mga0rr50_159189_c1 3300050513 Bacteria 1831
319 nmdc:mga0rr50_77501_c1 3300050513 Bacteria 2555
320 nmdc:mga08x19_146440_c1 3300050514 Bacteria 1597
321 nmdc:mga0a205_118986_c1 3300050515 Bacteria 2540
322 nmdc:mga0a205_144117_c1 3300050515 Bacteria 2282
323 nmdc:mga0a205_209839_c1 3300050515 Bacteria 1836
324 nmdc:mga0a205_3450_c1 3300050515 Bacteria 14113
325 Ga0495601_0004328 3300053077 Bacteria 8203
326 Ga0495595_0022747 3300053084 Bacteria 2754
327 Ga0495619_0058652 3300053085 Bacteria 2556
328 Ga0495619_0187352 3300053085 Unclassified 1432
329 Ga0501082_0160734 3300060353 Bacteria 1952

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_1290499 Ga0453684_1290499_39_683 195
2 3300046809 Ga0495600_0426617 Ga0495600_0426617_58_735 199
3 3300025907 Ga0207645_10360318 Ga0207645_103603181 205
4 3300032002 Ga0307416_100758104 Ga0307416_1007581041 206
5 iso_pu_bacteria 2738543017 2739269281 206
6 3300005444 Ga0070694_100189450 Ga0070694_1001894502 208
7 3300005545 Ga0070695_100001702 Ga0070695_10000170212 208
8 3300005549 Ga0070704_100013395 Ga0070704_1000133956 208
9 3300009147 Ga0114129_10013657 Ga0114129_100136572 208
10 3300050507 nmdc:mga05p37_95774_c1 nmdc:mga05p37_95774_c1_1816_2460 208
11 3300050515 nmdc:mga0a205_118986_c1 nmdc:mga0a205_118986_c1_487_1131 208
12 3300045051 Ga0451576_0585851 Ga0451576_0585851_368_1009 209
13 3300005295 Ga0065707_10309674 Ga0065707_103096742 210
14 3300005295 Ga0065707_10323254 Ga0065707_103232541 210
15 3300005328 Ga0070676_10006032 Ga0070676_100060322 210
16 3300005329 Ga0070683_100032468 Ga0070683_1000324684 210
17 3300005329 Ga0070683_100185504 Ga0070683_1001855042 210
18 3300005331 Ga0070670_100118502 Ga0070670_1001185022 210
19 3300005334 Ga0068869_100824020 Ga0068869_1008240201 210
20 3300005335 Ga0070666_10022615 Ga0070666_100226153 210
21 3300005335 Ga0070666_10259056 Ga0070666_102590563 210
22 3300005337 Ga0070682_100122207 Ga0070682_1001222072 210
23 3300005338 Ga0068868_100054349 Ga0068868_1000543493 210
24 3300005338 Ga0068868_100169146 Ga0068868_1001691463 210
25 3300005340 Ga0070689_100114146 Ga0070689_1001141462 210
26 3300005347 Ga0070668_100071196 Ga0070668_1000711962 210
27 3300005353 Ga0070669_100054530 Ga0070669_1000545302 210
28 3300005353 Ga0070669_100133480 Ga0070669_1001334802 210
29 3300005354 Ga0070675_100008173 Ga0070675_1000081738 210
30 3300005355 Ga0070671_100339722 Ga0070671_1003397222 210
31 3300005356 Ga0070674_100220929 Ga0070674_1002209292 210
32 3300005356 Ga0070674_100259586 Ga0070674_1002595862 210
33 3300005364 Ga0070673_100019988 Ga0070673_1000199883 210
34 3300005364 Ga0070673_100100589 Ga0070673_1001005892 210
35 3300005365 Ga0070688_100302240 Ga0070688_1003022402 210
36 3300005406 Ga0070703_10244783 Ga0070703_102447831 210
37 3300005434 Ga0070709_10008290 Ga0070709_100082904 210
38 3300005437 Ga0070710_10148899 Ga0070710_101488992 210
39 3300005438 Ga0070701_10263761 Ga0070701_102637612 210
40 3300005440 Ga0070705_100119604 Ga0070705_1001196043 210
41 3300005440 Ga0070705_100817351 Ga0070705_1008173511 210
42 3300005441 Ga0070700_100001951 Ga0070700_1000019517 210
43 3300005441 Ga0070700_100654418 Ga0070700_1006544181 210
44 3300005444 Ga0070694_100028208 Ga0070694_1000282084 210
45 3300005457 Ga0070662_100036423 Ga0070662_1000364232 210
46 3300005457 Ga0070662_100077040 Ga0070662_1000770401 210
47 3300005459 Ga0068867_100139495 Ga0068867_1001394951 210
48 3300005459 Ga0068867_100182401 Ga0068867_1001824013 210
49 3300005459 Ga0068867_100214768 Ga0068867_1002147682 210
50 3300005468 Ga0070707_101220904 Ga0070707_1012209041 210
51 3300005471 Ga0070698_100074937 Ga0070698_1000749372 210
52 3300005471 Ga0070698_100178079 Ga0070698_1001780793 210
53 3300005518 Ga0070699_100142014 Ga0070699_1001420142 210
54 3300005518 Ga0070699_100197138 Ga0070699_1001971382 210
55 3300005518 Ga0070699_100243245 Ga0070699_1002432452 210
56 3300005535 Ga0070684_100190456 Ga0070684_1001904562 210
57 3300005536 Ga0070697_100033666 Ga0070697_1000336664 210
58 3300005536 Ga0070697_100119190 Ga0070697_1001191901 210
59 3300005544 Ga0070686_100051702 Ga0070686_1000517023 210
60 3300005545 Ga0070695_100186440 Ga0070695_1001864402 210
61 3300005545 Ga0070695_100195799 Ga0070695_1001957991 210
62 3300005548 Ga0070665_100018557 Ga0070665_1000185577 210
63 3300005548 Ga0070665_100023225 Ga0070665_1000232255 210
64 3300005548 Ga0070665_100636297 Ga0070665_1006362972 210
65 3300005549 Ga0070704_100065016 Ga0070704_1000650162 210
66 3300005549 Ga0070704_100237671 Ga0070704_1002376712 210
67 3300005549 Ga0070704_100240365 Ga0070704_1002403652 210
68 3300005549 Ga0070704_100347377 Ga0070704_1003473771 210
69 3300005549 Ga0070704_100367433 Ga0070704_1003674333 210
70 3300005563 Ga0068855_100291777 Ga0068855_1002917772 210
71 3300005563 Ga0068855_100742819 Ga0068855_1007428192 210
72 3300005577 Ga0068857_101208920 Ga0068857_1012089201 210
73 3300005578 Ga0068854_100542518 Ga0068854_1005425181 210
74 3300005614 Ga0068856_100012722 Ga0068856_1000127225 210
75 3300005615 Ga0070702_100016693 Ga0070702_1000166935 210
76 3300005617 Ga0068859_100170268 Ga0068859_1001702682 210
77 3300005618 Ga0068864_100006498 Ga0068864_1000064988 210
78 3300005718 Ga0068866_10051070 Ga0068866_100510702 210
79 3300005719 Ga0068861_100018542 Ga0068861_1000185422 210
80 3300005719 Ga0068861_100902327 Ga0068861_1009023272 210
81 3300005834 Ga0068851_10247695 Ga0068851_102476952 210
82 3300005841 Ga0068863_100047664 Ga0068863_1000476643 210
83 3300005841 Ga0068863_100199793 Ga0068863_1001997932 210
84 3300005842 Ga0068858_100001195 Ga0068858_1000011953 210
85 3300005842 Ga0068858_100017067 Ga0068858_1000170676 210
86 3300005842 Ga0068858_100039189 Ga0068858_1000391895 210
87 3300005842 Ga0068858_100133957 Ga0068858_1001339573 210
88 3300005842 Ga0068858_100389646 Ga0068858_1003896461 210
89 3300005843 Ga0068860_100301163 Ga0068860_1003011632 210
90 3300005843 Ga0068860_100359551 Ga0068860_1003595513 210
91 3300005843 Ga0068860_100422504 Ga0068860_1004225042 210
92 3300005843 Ga0068860_101024829 Ga0068860_1010248291 210
93 3300005844 Ga0068862_100051707 Ga0068862_1000517074 210
94 3300005844 Ga0068862_100686339 Ga0068862_1006863392 210
95 3300005937 Ga0081455_10117576 Ga0081455_101175762 210
96 3300005937 Ga0081455_10374302 Ga0081455_103743021 210
97 3300006237 Ga0097621_100001981 Ga0097621_1000019815 210
98 3300006237 Ga0097621_100026980 Ga0097621_1000269802 210
99 3300006237 Ga0097621_100157064 Ga0097621_1001570642 210
100 3300006237 Ga0097621_100336962 Ga0097621_1003369623 210
101 3300006844 Ga0075428_100379445 Ga0075428_1003794452 210
102 3300006844 Ga0075428_100383623 Ga0075428_1003836232 210
103 3300006852 Ga0075433_10356364 Ga0075433_103563642 210
104 3300006871 Ga0075434_100124392 Ga0075434_1001243923 210
105 3300006881 Ga0068865_100015969 Ga0068865_1000159695 210
106 3300006881 Ga0068865_100141073 Ga0068865_1001410731 210
107 3300006881 Ga0068865_100269568 Ga0068865_1002695682 210
108 3300006931 Ga0097620_100170275 Ga0097620_1001702752 210
109 3300007076 Ga0075435_100002333 Ga0075435_1000023332 210
110 3300007076 Ga0075435_100002895 Ga0075435_1000028955 210
111 3300009093 Ga0105240_10082523 Ga0105240_100825232 210
112 3300009093 Ga0105240_10140985 Ga0105240_101409851 210
113 3300009094 Ga0111539_10000935 Ga0111539_1000093522 210
114 3300009094 Ga0111539_10008540 Ga0111539_100085405 210
115 3300009094 Ga0111539_10455093 Ga0111539_104550932 210
116 3300009098 Ga0105245_10089696 Ga0105245_100896962 210
117 3300009098 Ga0105245_10423919 Ga0105245_104239192 210
118 3300009101 Ga0105247_10002020 Ga0105247_100020208 210
119 3300009101 Ga0105247_10147047 Ga0105247_101470473 210
120 3300009147 Ga0114129_10007867 Ga0114129_100078676 210
121 3300009147 Ga0114129_10117078 Ga0114129_101170783 210
122 3300009147 Ga0114129_10189994 Ga0114129_101899943 210
123 3300009147 Ga0114129_10349607 Ga0114129_103496072 210
124 3300009147 Ga0114129_10885939 Ga0114129_108859391 210
125 3300009148 Ga0105243_10006691 Ga0105243_100066915 210
126 3300009148 Ga0105243_10028042 Ga0105243_100280422 210
127 3300009176 Ga0105242_10001497 Ga0105242_100014978 210
128 3300009176 Ga0105242_10010723 Ga0105242_100107232 210
129 3300009176 Ga0105242_10155440 Ga0105242_101554402 210
130 3300009176 Ga0105242_10666029 Ga0105242_106660291 210
131 3300009176 Ga0105242_10844516 Ga0105242_108445162 210
132 3300009177 Ga0105248_10004967 Ga0105248_1000496713 210
133 3300009177 Ga0105248_10032316 Ga0105248_100323164 210
134 3300009177 Ga0105248_10347109 Ga0105248_103471092 210
135 3300009551 Ga0105238_10485749 Ga0105238_104857492 210
136 3300009553 Ga0105249_10759647 Ga0105249_107596471 210
137 3300013296 Ga0157374_10005500 Ga0157374_1000550012 210
138 3300013296 Ga0157374_11277879 Ga0157374_112778791 210
139 3300013306 Ga0163162_10194211 Ga0163162_101942113 210
140 3300013308 Ga0157375_10252470 Ga0157375_102524701 210
141 3300014325 Ga0163163_10021113 Ga0163163_100211132 210
142 3300014325 Ga0163163_10638183 Ga0163163_106381832 210
143 3300014325 Ga0163163_11359286 Ga0163163_113592861 210
144 3300014968 Ga0157379_10285364 Ga0157379_102853642 210
145 3300014969 Ga0157376_10052476 Ga0157376_100524764 210
146 3300014969 Ga0157376_10152202 Ga0157376_101522022 210
147 3300017792 Ga0163161_10125570 Ga0163161_101255702 210
148 3300020069 Ga0197907_11211912 Ga0197907_112119121 210
149 3300020080 Ga0206350_10454947 Ga0206350_104549471 210
150 3300020082 Ga0206353_10024490 Ga0206353_100244902 210
151 3300022467 Ga0224712_10050333 Ga0224712_100503332 210
152 3300025898 Ga0207692_10125469 Ga0207692_101254692 210
153 3300025899 Ga0207642_10126994 Ga0207642_101269943 210
154 3300025900 Ga0207710_10050873 Ga0207710_100508732 210
155 3300025900 Ga0207710_10095975 Ga0207710_100959753 210
156 3300025903 Ga0207680_10131563 Ga0207680_101315632 210
157 3300025903 Ga0207680_10332932 Ga0207680_103329322 210
158 3300025906 Ga0207699_10030395 Ga0207699_100303951 210
159 3300025907 Ga0207645_10005347 Ga0207645_100053476 210
160 3300025911 Ga0207654_10584914 Ga0207654_105849141 210
161 3300025913 Ga0207695_10094368 Ga0207695_100943681 210
162 3300025917 Ga0207660_10181277 Ga0207660_101812773 210
163 3300025923 Ga0207681_10018066 Ga0207681_100180661 210
164 3300025923 Ga0207681_10178358 Ga0207681_101783582 210
165 3300025924 Ga0207694_10251393 Ga0207694_102513932 210
166 3300025925 Ga0207650_10087970 Ga0207650_100879703 210
167 3300025925 Ga0207650_10166488 Ga0207650_101664882 210
168 3300025925 Ga0207650_10551692 Ga0207650_105516923 210
169 3300025927 Ga0207687_10009905 Ga0207687_100099054 210
170 3300025928 Ga0207700_10261374 Ga0207700_102613742 210
171 3300025931 Ga0207644_10306702 Ga0207644_103067021 210
172 3300025933 Ga0207706_10016243 Ga0207706_100162433 210
173 3300025933 Ga0207706_10336123 Ga0207706_103361232 210
174 3300025934 Ga0207686_10029858 Ga0207686_100298583 210
175 3300025934 Ga0207686_10061276 Ga0207686_100612761 210
176 3300025934 Ga0207686_10086370 Ga0207686_100863702 210
177 3300025934 Ga0207686_10284344 Ga0207686_102843442 210
178 3300025934 Ga0207686_10635729 Ga0207686_106357292 210
179 3300025937 Ga0207669_10171872 Ga0207669_101718722 210
180 3300025937 Ga0207669_10301934 Ga0207669_103019342 210
181 3300025938 Ga0207704_10004730 Ga0207704_100047304 210
182 3300025938 Ga0207704_10273290 Ga0207704_102732901 210
183 3300025938 Ga0207704_10281146 Ga0207704_102811462 210
184 3300025940 Ga0207691_10217365 Ga0207691_102173652 210
185 3300025940 Ga0207691_10567035 Ga0207691_105670351 210
186 3300025941 Ga0207711_10010415 Ga0207711_100104154 210
187 3300025941 Ga0207711_10366320 Ga0207711_103663201 210
188 3300025942 Ga0207689_10531834 Ga0207689_105318341 210
189 3300025944 Ga0207661_10359781 Ga0207661_103597812 210
190 3300025944 Ga0207661_10478204 Ga0207661_104782042 210
191 3300025960 Ga0207651_10077219 Ga0207651_100772192 210
192 3300025961 Ga0207712_10044402 Ga0207712_100444022 210
193 3300025972 Ga0207668_10053925 Ga0207668_100539253 210
194 3300025972 Ga0207668_10071244 Ga0207668_100712442 210
195 3300025972 Ga0207668_10308822 Ga0207668_103088222 210
196 3300025972 Ga0207668_11071834 Ga0207668_110718341 210
197 3300025981 Ga0207640_10019514 Ga0207640_100195141 210
198 3300025986 Ga0207658_10333916 Ga0207658_103339163 210
199 3300026023 Ga0207677_10033620 Ga0207677_100336203 210
200 3300026023 Ga0207677_10097404 Ga0207677_100974043 210
201 3300026023 Ga0207677_10298850 Ga0207677_102988502 210
202 3300026035 Ga0207703_10097906 Ga0207703_100979061 210
203 3300026035 Ga0207703_10107221 Ga0207703_101072212 210
204 3300026035 Ga0207703_10366665 Ga0207703_103666651 210
205 3300026035 Ga0207703_10513686 Ga0207703_105136861 210
206 3300026041 Ga0207639_10262798 Ga0207639_102627983 210
207 3300026075 Ga0207708_10001028 Ga0207708_100010285 210
208 3300026075 Ga0207708_10142201 Ga0207708_101422013 210
209 3300026088 Ga0207641_10000305 Ga0207641_1000030551 210
210 3300026088 Ga0207641_10095485 Ga0207641_100954852 210
211 3300026088 Ga0207641_10532593 Ga0207641_105325931 210
212 3300026089 Ga0207648_10096299 Ga0207648_100962992 210
213 3300026089 Ga0207648_10199875 Ga0207648_101998753 210
214 3300026089 Ga0207648_10441313 Ga0207648_104413132 210
215 3300026089 Ga0207648_10787460 Ga0207648_107874601 210
216 3300026089 Ga0207648_10851253 Ga0207648_108512531 210
217 3300026118 Ga0207675_100011386 Ga0207675_1000113864 210
218 3300026118 Ga0207675_100181525 Ga0207675_1001815253 210
219 3300026118 Ga0207675_100994141 Ga0207675_1009941411 210
220 3300026118 Ga0207675_101233577 Ga0207675_1012335771 210
221 3300027907 Ga0207428_10005438 Ga0207428_100054381 210
222 3300027907 Ga0207428_10032249 Ga0207428_100322494 210
223 3300028379 Ga0268266_10016288 Ga0268266_100162885 210
224 3300028380 Ga0268265_10036294 Ga0268265_100362943 210
225 3300028380 Ga0268265_10063859 Ga0268265_100638593 210
226 3300028380 Ga0268265_10856793 Ga0268265_108567932 210
227 3300028380 Ga0268265_10965150 Ga0268265_109651501 210
228 3300028381 Ga0268264_10088941 Ga0268264_100889412 210
229 3300028381 Ga0268264_10094529 Ga0268264_100945292 210
230 3300028381 Ga0268264_10199463 Ga0268264_101994632 210
231 3300028381 Ga0268264_10906155 Ga0268264_109061552 210
232 3300031824 Ga0307413_10175509 Ga0307413_101755092 210
233 3300035090 Ga0373949_0072588 Ga0373949_0072588_175_825 210
234 3300035172 Ga0373955_0412024 Ga0373955_0412024_139_792 210
235 3300035691 Ga0373931_0407253 Ga0373931_0407253_157_807 210
236 3300036401 Ga0373937_0686653 Ga0373937_0686653_167_817 210
237 3300045051 Ga0451576_0295135 Ga0451576_0295135_1017_1667 210
238 3300046463 Ga0495653_0280387 Ga0495653_0280387_204_851 210
239 3300046516 Ga0495628_0349219 Ga0495628_0349219_348_1004 210
240 3300046539 Ga0495621_0197798 Ga0495621_0197798_46_705 210
241 3300046543 Ga0495645_0465443 Ga0495645_0465443_115_765 210
242 3300046559 Ga0495667_0354449 Ga0495667_0354449_211_864 210
243 3300046664 Ga0495659_0146697 Ga0495659_0146697_261_920 210
244 3300046681 Ga0495647_0058399 Ga0495647_0058399_798_1448 210
245 3300046683 Ga0495658_0089146 Ga0495658_0089146_539_1192 210
246 3300047319 Ga0495674_0071627 Ga0495674_0071627_225_875 210
247 3300047471 Ga0495684_0622149 Ga0495684_0622149_22_672 210
248 3300048907 Ga0496104_0241341 Ga0496104_0241341_137_790 210
249 3300048908 Ga0496105_0067097 Ga0496105_0067097_513_1160 210
250 3300048910 Ga0496107_0166783 Ga0496107_0166783_962_1615 210
251 3300048911 Ga0496108_0006500 Ga0496108_0006500_6073_6726 210
252 3300048915 Ga0496112_0015766 Ga0496112_0015766_3636_4289 210
253 3300048915 Ga0496112_0646786 Ga0496112_0646786_88_735 210
254 3300048915 Ga0496112_0720724 Ga0496112_0720724_230_889 210
255 3300048916 Ga0496113_0074457 Ga0496113_0074457_199_852 210
256 3300048917 Ga0496114_0037122 Ga0496114_0037122_1549_2208 210
257 3300048917 Ga0496114_0090296 Ga0496114_0090296_776_1426 210
258 3300048917 Ga0496114_0169819 Ga0496114_0169819_287_949 210
259 3300048918 Ga0496115_0279086 Ga0496115_0279086_396_1055 210
260 3300049571 Ga0501034_0010792 Ga0501034_0010792_6246_6899 210
261 3300049581 Ga0501047_0005626 Ga0501047_0005626_1260_1913 210
262 3300049586 Ga0501070_0523468 Ga0501070_0523468_35_688 210
263 3300049589 Ga0501073_0431609 Ga0501073_0431609_219_878 210
264 3300049823 Ga0501044_0002807 Ga0501044_0002807_14794_15447 210
265 3300050507 nmdc:mga05p37_128988_c1 nmdc:mga05p37_128988_c1_1429_2079 210
266 3300050507 nmdc:mga05p37_14746_c1 nmdc:mga05p37_14746_c1_3074_3811 210
267 3300050507 nmdc:mga05p37_210080_c1 nmdc:mga05p37_210080_c1_30_680 210
268 3300050507 nmdc:mga05p37_26826_c1 nmdc:mga05p37_26826_c1_1899_2636 210
269 3300050507 nmdc:mga05p37_510556_c1 nmdc:mga05p37_510556_c1_62_715 210
270 3300050507 nmdc:mga05p37_7460_c1 nmdc:mga05p37_7460_c1_3693_4355 210
271 3300050511 nmdc:mga08y16_147131_c1 nmdc:mga08y16_147131_c1_474_1124 210
272 3300050511 nmdc:mga08y16_7610_c1 nmdc:mga08y16_7610_c1_5491_6150 210
273 3300050512 nmdc:mga0n895_298033_c1 nmdc:mga0n895_298033_c1_318_968 210
274 3300050513 nmdc:mga0rr50_159189_c1 nmdc:mga0rr50_159189_c1_417_1064 210
275 3300050513 nmdc:mga0rr50_77501_c1 nmdc:mga0rr50_77501_c1_153_803 210
276 3300050514 nmdc:mga08x19_146440_c1 nmdc:mga08x19_146440_c1_563_1216 210
277 3300050515 nmdc:mga0a205_144117_c1 nmdc:mga0a205_144117_c1_303_953 210
278 3300050515 nmdc:mga0a205_209839_c1 nmdc:mga0a205_209839_c1_1090_1752 210
279 3300050515 nmdc:mga0a205_3450_c1 nmdc:mga0a205_3450_c1_7765_8415 210
280 3300053085 Ga0495619_0058652 Ga0495619_0058652_1835_2485 210
281 3300053085 Ga0495619_0187352 Ga0495619_0187352_763_1416 210
282 3300060353 Ga0501082_0160734 Ga0501082_0160734_771_1427 210
283 3300005458 Ga0070681_10005027 Ga0070681_1000502711 212
284 3300005577 Ga0068857_100193245 Ga0068857_1001932451 212
285 3300025912 Ga0207707_10182425 Ga0207707_101824253 212
286 3300025921 Ga0207652_10061637 Ga0207652_100616371 212
287 3300026116 Ga0207674_10219352 Ga0207674_102193521 212
288 3300031238 Ga0265332_10085280 Ga0265332_100852802 213
289 3300006358 Ga0068871_100106790 Ga0068871_1001067902 214
290 3300009177 Ga0105248_10085025 Ga0105248_100850252 214
291 3300009551 Ga0105238_10238899 Ga0105238_102388992 214
292 3300010375 Ga0105239_10579638 Ga0105239_105796383 214
293 3300025941 Ga0207711_10181558 Ga0207711_101815582 214
294 3300026121 Ga0207683_10085574 Ga0207683_100855742 214
295 3300035116 Ga0373945_0020076 Ga0373945_0020076_10_675 216
296 3300046454 Ga0495592_0060529 Ga0495592_0060529_1922_2587 216
297 3300009098 Ga0105245_10015905 Ga0105245_100159055 217
298 3300009176 Ga0105242_10263817 Ga0105242_102638172 217
299 3300048903 Ga0496100_0000448 Ga0496100_0000448_7687_8355 217
300 3300048904 Ga0496101_0002514 Ga0496101_0002514_9189_9857 217
301 3300048905 Ga0496102_0060758 Ga0496102_0060758_746_1414 217
302 3300048907 Ga0496104_0031992 Ga0496104_0031992_3882_4550 217
303 3300048909 Ga0496106_0050432 Ga0496106_0050432_1312_1980 217
304 3300048910 Ga0496107_0019653 Ga0496107_0019653_265_933 217
305 3300048917 Ga0496114_0003658 Ga0496114_0003658_1028_1696 217
306 3300044684 Ga0466966_0195211 Ga0466966_0195211_122_778 218
307 3300035083 Ga0373926_0065460 Ga0373926_0065460_315_998 222
308 3300035170 Ga0373943_0001265 Ga0373943_0001265_7867_8550 222
309 3300035171 Ga0373946_0000555 Ga0373946_0000555_9952_10635 222
310 3300035172 Ga0373955_0020699 Ga0373955_0020699_1843_2526 222
311 3300035172 Ga0373955_0123927 Ga0373955_0123927_641_1324 222
312 3300035692 Ga0373935_0005913 Ga0373935_0005913_1721_2404 222
313 3300035695 Ga0373927_0034823 Ga0373927_0034823_1941_2624 222
314 3300037068 Ga0373925_0000774 Ga0373925_0000774_25850_26533 222
315 3300046511 Ga0495608_0081441 Ga0495608_0081441_1395_2078 222
316 3300046517 Ga0495630_0001845 Ga0495630_0001845_4013_4696 222
317 3300046535 Ga0495586_0047807 Ga0495586_0047807_292_975 222
318 3300046543 Ga0495645_0020630 Ga0495645_0020630_1942_2625 222
319 3300046675 Ga0495657_0120142 Ga0495657_0120142_501_1184 222
320 3300046678 Ga0495599_0158568 Ga0495599_0158568_191_874 222
321 3300046689 Ga0495613_0000507 Ga0495613_0000507_25264_25947 222
322 3300047471 Ga0495684_0000188 Ga0495684_0000188_7024_7707 222
323 3300053077 Ga0495601_0004328 Ga0495601_0004328_803_1486 222
324 3300053084 Ga0495595_0022747 Ga0495595_0022747_1265_1948 222
325 3300035695 Ga0373927_0445839 Ga0373927_0445839_51_737 223
326 3300035118 Ga0373954_0107071 Ga0373954_0107071_12_758 228
327 3300013296 Ga0157374_10473334 Ga0157374_104733341 229
328 3300021358 Ga0213873_10019005 Ga0213873_100190052 236
329 3300026116 Ga0207674_10398709 Ga0207674_103987092 240
330 3300005290 Ga0065712_10094851 Ga0065712_100948512 248

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13578

Methyltransf_24

Methyltransferase domain

103

204

0.91

PF13649

Methyltransf_25

Methyltransferase domain

102

197

0.91

PF01596

Methyltransf_3

O-methyltransferase

61

258

0.87

PF08704

GCD14

tRNA methyltransferase complex GCD14 subunit

79

199

0.86

PF13847

Methyltransf_31

Methyltransferase domain

98

234

0.85

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

69

203

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c3p-assembly1.cif.gz_B crystal structure of a methyltransferase (np_951602.1) from geobacter sulfurreducens at 1.90 a resolution 0.944 43 248
5lhm-assembly1.cif.gz_A crystal structure of safc from myxococcus xanthus apo-form 0.9363 46 248
3c3p-assembly2.cif.gz_C-2 crystal structure of a methyltransferase (np_951602.1) from geobacter sulfurreducens at 1.90 a resolution 0.9354 41 247
5zw4-assembly1.cif.gz_A crystal structure of trna bound trmr 0.9331 46 248
5zw3-assembly1.cif.gz_B crystal structure of trmr from b. subtilis 0.9311 46 248
ID Description Score Start End Superfamily
5lhmA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9363 46 248 3.40.50.150
af_A0A0R0IR39_2_192_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9353 77 246 3.40.50.150
3c3pB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9347 43 248 3.40.50.150
af_F4IAT4_68_291_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9296 81 247 3.40.50.150
5x7fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9288 45 248 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2V8L8J5-F1-model_v4 Methyltransferase 0.9886 76 247 GO:0008171
GO:0008757
GO:0032259
AF-A0A7X6I983-F1-model_v4 O-methyltransferase 0.9852 41 248 GO:0008171
GO:0008757
GO:0032259
AF-A0A2V8P8W2-F1-model_v4 O-methyltransferase 0.9841 158 247 GO:0008171
GO:0008757
GO:0032259
AF-A0A3N5J047-F1-model_v4 O-methyltransferase 0.9835 46 248 GO:0008171
GO:0008757
GO:0032259
AF-A0A2H5WW56-F1-model_v4 O-methyltransferase (EC 2.1.1.-) 0.9778 42 248 GO:0008171
GO:0032259

Feature Viewer

pLDDT pTM Quality
84.08 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map