F410135
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 330 | 189 | 329 | 219 |
Family's Representative Sequence
| Representative Sequence | 3300026116|Ga0207674_10398709|Ga0207674_103987092 |
| Length | 259 |
| Sequence | MLSVDKTIAGEPVATVNSRAMVYQGTRHSVSEWHILRAAAPNLLITGVPDAVEQYLAGLNRGSDAVLDDITRQNAQRGLPLVDAEVGALLRVLATAIGAARILEIGTAIGYSGIWLAGALPPHGTLLTMEVKPERARIARENFARSGLAERVSVIVGDAQRMLAKVSGPFDLIFQDGDKPQYLTQLDRLVDLLRPGGLLVTDNVLWDGEVVPGFLASPKRNDTDTRAIAEYNERINHHPQLMTVIVPLRDGVAISVKKP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738543017 | Bacillus sp. OV186 | Isolate | Unclassified |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 53 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 55 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 56 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 57 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 58 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 59 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 61 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 83 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 124 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 128 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 129 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 130 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 131 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 132 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 133 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 134 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 135 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 136 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 137 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 138 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 139 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 140 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 141 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 142 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 143 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 144 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 145 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 166 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 167 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 168 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 169 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 170 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 172 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 173 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 174 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 175 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.48 |
| Metatranscriptomes | 1.21 |
| Isolates | 0.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.76 |
| Rhizosphere | 93.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10094851 | 3300005290 | Bacteria | 2239 |
| 2 | Ga0065707_10309674 | 3300005295 | Bacteria | 987 |
| 3 | Ga0065707_10323254 | 3300005295 | Bacteria | 962 |
| 4 | Ga0070676_10006032 | 3300005328 | Bacteria | 6469 |
| 5 | Ga0070683_100032468 | 3300005329 | Bacteria | 4754 |
| 6 | Ga0070683_100185504 | 3300005329 | Bacteria | 1975 |
| 7 | Ga0070670_100118502 | 3300005331 | Bacteria | 2283 |
| 8 | Ga0068869_100824020 | 3300005334 | Bacteria | 799 |
| 9 | Ga0070666_10022615 | 3300005335 | Bacteria | 4085 |
| 10 | Ga0070666_10259056 | 3300005335 | Unclassified | 1233 |
| 11 | Ga0070682_100122207 | 3300005337 | Bacteria | 1750 |
| 12 | Ga0068868_100054349 | 3300005338 | Bacteria | 3155 |
| 13 | Ga0068868_100169146 | 3300005338 | Bacteria | 1809 |
| 14 | Ga0070689_100114146 | 3300005340 | Bacteria | 2152 |
| 15 | Ga0070668_100071196 | 3300005347 | Bacteria | 2708 |
| 16 | Ga0070669_100054530 | 3300005353 | Bacteria | 2928 |
| 17 | Ga0070669_100133480 | 3300005353 | Bacteria | 1907 |
| 18 | Ga0070675_100008173 | 3300005354 | Bacteria | 8110 |
| 19 | Ga0070671_100339722 | 3300005355 | Bacteria | 1281 |
| 20 | Ga0070674_100220929 | 3300005356 | Bacteria | 1474 |
| 21 | Ga0070674_100259586 | 3300005356 | Bacteria | 1368 |
| 22 | Ga0070673_100019988 | 3300005364 | Bacteria | 4821 |
| 23 | Ga0070673_100100589 | 3300005364 | Bacteria | 2380 |
| 24 | Ga0070688_100302240 | 3300005365 | Unclassified | 1157 |
| 25 | Ga0070703_10244783 | 3300005406 | Bacteria | 725 |
| 26 | Ga0070709_10008290 | 3300005434 | Bacteria | 5707 |
| 27 | Ga0070710_10148899 | 3300005437 | Unclassified | 1442 |
| 28 | Ga0070701_10263761 | 3300005438 | Bacteria | 1045 |
| 29 | Ga0070705_100119604 | 3300005440 | Bacteria | 1698 |
| 30 | Ga0070705_100817351 | 3300005440 | Bacteria | 743 |
| 31 | Ga0070700_100001951 | 3300005441 | Bacteria | 10464 |
| 32 | Ga0070700_100654418 | 3300005441 | Bacteria | 830 |
| 33 | Ga0070694_100028208 | 3300005444 | Bacteria | 3650 |
| 34 | Ga0070694_100189450 | 3300005444 | Bacteria | 1527 |
| 35 | Ga0070662_100036423 | 3300005457 | Bacteria | 3480 |
| 36 | Ga0070662_100077040 | 3300005457 | Bacteria | 2474 |
| 37 | Ga0070681_10005027 | 3300005458 | Bacteria | 12748 |
| 38 | Ga0068867_100139495 | 3300005459 | Bacteria | 1894 |
| 39 | Ga0068867_100182401 | 3300005459 | Bacteria | 1670 |
| 40 | Ga0068867_100214768 | 3300005459 | Unclassified | 1547 |
| 41 | Ga0070707_101220904 | 3300005468 | Bacteria | 718 |
| 42 | Ga0070698_100074937 | 3300005471 | Bacteria | 3389 |
| 43 | Ga0070698_100178079 | 3300005471 | Bacteria | 2065 |
| 44 | Ga0070699_100142014 | 3300005518 | Bacteria | 2121 |
| 45 | Ga0070699_100197138 | 3300005518 | Bacteria | 1790 |
| 46 | Ga0070699_100243245 | 3300005518 | Bacteria | 1607 |
| 47 | Ga0070684_100190456 | 3300005535 | Bacteria | 1866 |
| 48 | Ga0070697_100033666 | 3300005536 | Bacteria | 4128 |
| 49 | Ga0070697_100119190 | 3300005536 | Bacteria | 2206 |
| 50 | Ga0070686_100051702 | 3300005544 | Bacteria | 2617 |
| 51 | Ga0070695_100001702 | 3300005545 | Bacteria | 12373 |
| 52 | Ga0070695_100186440 | 3300005545 | Bacteria | 1473 |
| 53 | Ga0070695_100195799 | 3300005545 | Bacteria | 1441 |
| 54 | Ga0070665_100018557 | 3300005548 | Bacteria | 6971 |
| 55 | Ga0070665_100023225 | 3300005548 | Bacteria | 6245 |
| 56 | Ga0070665_100636297 | 3300005548 | Unclassified | 1080 |
| 57 | Ga0070704_100013395 | 3300005549 | Bacteria | 5088 |
| 58 | Ga0070704_100065016 | 3300005549 | Bacteria | 2624 |
| 59 | Ga0070704_100237671 | 3300005549 | Bacteria | 1490 |
| 60 | Ga0070704_100240365 | 3300005549 | Bacteria | 1482 |
| 61 | Ga0070704_100347377 | 3300005549 | Bacteria | 1251 |
| 62 | Ga0070704_100367433 | 3300005549 | Unclassified | 1219 |
| 63 | Ga0068855_100291777 | 3300005563 | Bacteria | 1808 |
| 64 | Ga0068855_100742819 | 3300005563 | Bacteria | 1047 |
| 65 | Ga0068857_100193245 | 3300005577 | Unclassified | 1854 |
| 66 | Ga0068857_101208920 | 3300005577 | Bacteria | 732 |
| 67 | Ga0068854_100542518 | 3300005578 | Bacteria | 985 |
| 68 | Ga0068856_100012722 | 3300005614 | Bacteria | 8148 |
| 69 | Ga0070702_100016693 | 3300005615 | Bacteria | 3772 |
| 70 | Ga0068859_100170268 | 3300005617 | Bacteria | 2259 |
| 71 | Ga0068864_100006498 | 3300005618 | Bacteria | 9578 |
| 72 | Ga0068866_10051070 | 3300005718 | Bacteria | 2103 |
| 73 | Ga0068861_100018542 | 3300005719 | Bacteria | 4958 |
| 74 | Ga0068861_100902327 | 3300005719 | Unclassified | 837 |
| 75 | Ga0068851_10247695 | 3300005834 | Bacteria | 1010 |
| 76 | Ga0068863_100047664 | 3300005841 | Bacteria | 4064 |
| 77 | Ga0068863_100199793 | 3300005841 | Bacteria | 1923 |
| 78 | Ga0068858_100001195 | 3300005842 | Bacteria | 26893 |
| 79 | Ga0068858_100017067 | 3300005842 | Bacteria | 6814 |
| 80 | Ga0068858_100039189 | 3300005842 | Bacteria | 4394 |
| 81 | Ga0068858_100133957 | 3300005842 | Bacteria | 2324 |
| 82 | Ga0068858_100389646 | 3300005842 | Bacteria | 1338 |
| 83 | Ga0068860_100301163 | 3300005843 | Bacteria | 1570 |
| 84 | Ga0068860_100359551 | 3300005843 | Bacteria | 1434 |
| 85 | Ga0068860_100422504 | 3300005843 | Bacteria | 1322 |
| 86 | Ga0068860_101024829 | 3300005843 | Bacteria | 844 |
| 87 | Ga0068862_100051707 | 3300005844 | Bacteria | 3514 |
| 88 | Ga0068862_100686339 | 3300005844 | Unclassified | 991 |
| 89 | Ga0081455_10117576 | 3300005937 | Bacteria | 2101 |
| 90 | Ga0081455_10374302 | 3300005937 | Bacteria | 997 |
| 91 | Ga0097621_100001981 | 3300006237 | Bacteria | 13957 |
| 92 | Ga0097621_100026980 | 3300006237 | Bacteria | 4512 |
| 93 | Ga0097621_100157064 | 3300006237 | Unclassified | 1953 |
| 94 | Ga0097621_100336962 | 3300006237 | Bacteria | 1339 |
| 95 | Ga0068871_100106790 | 3300006358 | Bacteria | 2350 |
| 96 | Ga0075428_100379445 | 3300006844 | Bacteria | 1515 |
| 97 | Ga0075428_100383623 | 3300006844 | Bacteria | 1506 |
| 98 | Ga0075433_10356364 | 3300006852 | Bacteria | 1292 |
| 99 | Ga0075434_100124392 | 3300006871 | Bacteria | 2596 |
| 100 | Ga0068865_100015969 | 3300006881 | Bacteria | 4794 |
| 101 | Ga0068865_100141073 | 3300006881 | Bacteria | 1817 |
| 102 | Ga0068865_100269568 | 3300006881 | Bacteria | 1351 |
| 103 | Ga0097620_100170275 | 3300006931 | Bacteria | 2259 |
| 104 | Ga0075435_100002333 | 3300007076 | Bacteria | 12568 |
| 105 | Ga0075435_100002895 | 3300007076 | Bacteria | 11519 |
| 106 | Ga0105240_10082523 | 3300009093 | Bacteria | 3947 |
| 107 | Ga0105240_10140985 | 3300009093 | Bacteria | 2882 |
| 108 | Ga0111539_10000935 | 3300009094 | Bacteria | 38232 |
| 109 | Ga0111539_10008540 | 3300009094 | Bacteria | 13012 |
| 110 | Ga0111539_10455093 | 3300009094 | Bacteria | 1490 |
| 111 | Ga0105245_10015905 | 3300009098 | Bacteria | 6556 |
| 112 | Ga0105245_10089696 | 3300009098 | Bacteria | 2827 |
| 113 | Ga0105245_10423919 | 3300009098 | Unclassified | 1334 |
| 114 | Ga0105247_10002020 | 3300009101 | Bacteria | 14051 |
| 115 | Ga0105247_10147047 | 3300009101 | Bacteria | 1550 |
| 116 | Ga0114129_10007867 | 3300009147 | Bacteria | 15167 |
| 117 | Ga0114129_10013657 | 3300009147 | Bacteria | 11571 |
| 118 | Ga0114129_10117078 | 3300009147 | Bacteria | 3672 |
| 119 | Ga0114129_10189994 | 3300009147 | Bacteria | 2790 |
| 120 | Ga0114129_10349607 | 3300009147 | Bacteria | 1959 |
| 121 | Ga0114129_10885939 | 3300009147 | Bacteria | 1132 |
| 122 | Ga0105243_10006691 | 3300009148 | Bacteria | 8900 |
| 123 | Ga0105243_10028042 | 3300009148 | Bacteria | 4320 |
| 124 | Ga0105242_10001497 | 3300009176 | Bacteria | 18385 |
| 125 | Ga0105242_10010723 | 3300009176 | Bacteria | 7035 |
| 126 | Ga0105242_10155440 | 3300009176 | Bacteria | 1998 |
| 127 | Ga0105242_10263817 | 3300009176 | Bacteria | 1557 |
| 128 | Ga0105242_10666029 | 3300009176 | Unclassified | 1014 |
| 129 | Ga0105242_10844516 | 3300009176 | Unclassified | 911 |
| 130 | Ga0105248_10004967 | 3300009177 | Bacteria | 14695 |
| 131 | Ga0105248_10032316 | 3300009177 | Bacteria | 5850 |
| 132 | Ga0105248_10085025 | 3300009177 | Bacteria | 3560 |
| 133 | Ga0105248_10347109 | 3300009177 | Bacteria | 1671 |
| 134 | Ga0105238_10238899 | 3300009551 | Bacteria | 1794 |
| 135 | Ga0105238_10485749 | 3300009551 | Bacteria | 1235 |
| 136 | Ga0105249_10759647 | 3300009553 | Bacteria | 1032 |
| 137 | Ga0105239_10579638 | 3300010375 | Bacteria | 1279 |
| 138 | Ga0157374_10005500 | 3300013296 | Bacteria | 10642 |
| 139 | Ga0157374_10473334 | 3300013296 | Bacteria | 1255 |
| 140 | Ga0157374_11277879 | 3300013296 | Bacteria | 756 |
| 141 | Ga0163162_10194211 | 3300013306 | Unclassified | 2158 |
| 142 | Ga0157375_10252470 | 3300013308 | Bacteria | 1924 |
| 143 | Ga0163163_10021113 | 3300014325 | Bacteria | 6142 |
| 144 | Ga0163163_10638183 | 3300014325 | Bacteria | 1128 |
| 145 | Ga0163163_11359286 | 3300014325 | Bacteria | 772 |
| 146 | Ga0157379_10285364 | 3300014968 | Bacteria | 1503 |
| 147 | Ga0157376_10052476 | 3300014969 | Bacteria | 3391 |
| 148 | Ga0157376_10152202 | 3300014969 | Bacteria | 2087 |
| 149 | Ga0163161_10125570 | 3300017792 | Bacteria | 1932 |
| 150 | Ga0197907_11211912 | 3300020069 | Bacteria | 902 |
| 151 | Ga0206350_10454947 | 3300020080 | Bacteria | 1209 |
| 152 | Ga0206353_10024490 | 3300020082 | Bacteria | 1039 |
| 153 | Ga0213873_10019005 | 3300021358 | Unclassified | 1588 |
| 154 | Ga0224712_10050333 | 3300022467 | Bacteria | 1618 |
| 155 | Ga0207692_10125469 | 3300025898 | Unclassified | 1443 |
| 156 | Ga0207642_10126994 | 3300025899 | Unclassified | 1325 |
| 157 | Ga0207710_10050873 | 3300025900 | Unclassified | 1860 |
| 158 | Ga0207710_10095975 | 3300025900 | Bacteria | 1394 |
| 159 | Ga0207680_10131563 | 3300025903 | Bacteria | 1650 |
| 160 | Ga0207680_10332932 | 3300025903 | Bacteria | 1064 |
| 161 | Ga0207699_10030395 | 3300025906 | Unclassified | 3022 |
| 162 | Ga0207645_10005347 | 3300025907 | Bacteria | 9335 |
| 163 | Ga0207645_10360318 | 3300025907 | Bacteria | 974 |
| 164 | Ga0207654_10584914 | 3300025911 | Unclassified | 795 |
| 165 | Ga0207707_10182425 | 3300025912 | Unclassified | 1832 |
| 166 | Ga0207695_10094368 | 3300025913 | Bacteria | 2999 |
| 167 | Ga0207660_10181277 | 3300025917 | Bacteria | 1636 |
| 168 | Ga0207652_10061637 | 3300025921 | Unclassified | 3239 |
| 169 | Ga0207681_10018066 | 3300025923 | Bacteria | 4438 |
| 170 | Ga0207681_10178358 | 3300025923 | Bacteria | 1616 |
| 171 | Ga0207694_10251393 | 3300025924 | Bacteria | 1446 |
| 172 | Ga0207650_10087970 | 3300025925 | Bacteria | 2368 |
| 173 | Ga0207650_10166488 | 3300025925 | Bacteria | 1749 |
| 174 | Ga0207650_10551692 | 3300025925 | Bacteria | 966 |
| 175 | Ga0207687_10009905 | 3300025927 | Bacteria | 6241 |
| 176 | Ga0207700_10261374 | 3300025928 | Bacteria | 1482 |
| 177 | Ga0207644_10306702 | 3300025931 | Bacteria | 1281 |
| 178 | Ga0207706_10016243 | 3300025933 | Bacteria | 6725 |
| 179 | Ga0207706_10336123 | 3300025933 | Bacteria | 1314 |
| 180 | Ga0207686_10029858 | 3300025934 | Bacteria | 3221 |
| 181 | Ga0207686_10061276 | 3300025934 | Bacteria | 2385 |
| 182 | Ga0207686_10086370 | 3300025934 | Bacteria | 2060 |
| 183 | Ga0207686_10284344 | 3300025934 | Bacteria | 1222 |
| 184 | Ga0207686_10635729 | 3300025934 | Bacteria | 843 |
| 185 | Ga0207669_10171872 | 3300025937 | Unclassified | 1543 |
| 186 | Ga0207669_10301934 | 3300025937 | Bacteria | 1217 |
| 187 | Ga0207704_10004730 | 3300025938 | Bacteria | 6248 |
| 188 | Ga0207704_10273290 | 3300025938 | Bacteria | 1281 |
| 189 | Ga0207704_10281146 | 3300025938 | Bacteria | 1265 |
| 190 | Ga0207691_10217365 | 3300025940 | Unclassified | 1658 |
| 191 | Ga0207691_10567035 | 3300025940 | Unclassified | 962 |
| 192 | Ga0207711_10010415 | 3300025941 | Bacteria | 7720 |
| 193 | Ga0207711_10181558 | 3300025941 | Unclassified | 1914 |
| 194 | Ga0207711_10366320 | 3300025941 | Bacteria | 1336 |
| 195 | Ga0207689_10531834 | 3300025942 | Unclassified | 986 |
| 196 | Ga0207661_10359781 | 3300025944 | Unclassified | 1314 |
| 197 | Ga0207661_10478204 | 3300025944 | Bacteria | 1137 |
| 198 | Ga0207651_10077219 | 3300025960 | Bacteria | 2384 |
| 199 | Ga0207712_10044402 | 3300025961 | Bacteria | 3072 |
| 200 | Ga0207668_10053925 | 3300025972 | Bacteria | 2789 |
| 201 | Ga0207668_10071244 | 3300025972 | Bacteria | 2482 |
| 202 | Ga0207668_10308822 | 3300025972 | Bacteria | 1308 |
| 203 | Ga0207668_11071834 | 3300025972 | Bacteria | 722 |
| 204 | Ga0207640_10019514 | 3300025981 | Bacteria | 4007 |
| 205 | Ga0207658_10333916 | 3300025986 | Bacteria | 1316 |
| 206 | Ga0207677_10033620 | 3300026023 | Bacteria | 3311 |
| 207 | Ga0207677_10097404 | 3300026023 | Bacteria | 2155 |
| 208 | Ga0207677_10298850 | 3300026023 | Unclassified | 1329 |
| 209 | Ga0207703_10097906 | 3300026035 | Bacteria | 2480 |
| 210 | Ga0207703_10107221 | 3300026035 | Bacteria | 2378 |
| 211 | Ga0207703_10366665 | 3300026035 | Bacteria | 1329 |
| 212 | Ga0207703_10513686 | 3300026035 | Bacteria | 1126 |
| 213 | Ga0207639_10262798 | 3300026041 | Unclassified | 1510 |
| 214 | Ga0207708_10001028 | 3300026075 | Bacteria | 20878 |
| 215 | Ga0207708_10142201 | 3300026075 | Bacteria | 1883 |
| 216 | Ga0207641_10000305 | 3300026088 | Bacteria | 61185 |
| 217 | Ga0207641_10095485 | 3300026088 | Bacteria | 2610 |
| 218 | Ga0207641_10532593 | 3300026088 | Bacteria | 1144 |
| 219 | Ga0207648_10096299 | 3300026089 | Bacteria | 2590 |
| 220 | Ga0207648_10199875 | 3300026089 | Bacteria | 1773 |
| 221 | Ga0207648_10441313 | 3300026089 | Unclassified | 1184 |
| 222 | Ga0207648_10787460 | 3300026089 | Unclassified | 885 |
| 223 | Ga0207648_10851253 | 3300026089 | Bacteria | 850 |
| 224 | Ga0207674_10219352 | 3300026116 | Unclassified | 1850 |
| 225 | Ga0207674_10398709 | 3300026116 | Bacteria | 1330 |
| 226 | Ga0207675_100011386 | 3300026118 | Bacteria | 8325 |
| 227 | Ga0207675_100181525 | 3300026118 | Bacteria | 2015 |
| 228 | Ga0207675_100994141 | 3300026118 | Unclassified | 857 |
| 229 | Ga0207675_101233577 | 3300026118 | Bacteria | 768 |
| 230 | Ga0207683_10085574 | 3300026121 | Bacteria | 2802 |
| 231 | Ga0207428_10005438 | 3300027907 | Bacteria | 11878 |
| 232 | Ga0207428_10032249 | 3300027907 | Bacteria | 4311 |
| 233 | Ga0268266_10016288 | 3300028379 | Bacteria | 6355 |
| 234 | Ga0268265_10036294 | 3300028380 | Bacteria | 3609 |
| 235 | Ga0268265_10063859 | 3300028380 | Bacteria | 2834 |
| 236 | Ga0268265_10856793 | 3300028380 | Unclassified | 889 |
| 237 | Ga0268265_10965150 | 3300028380 | Bacteria | 840 |
| 238 | Ga0268264_10088941 | 3300028381 | Bacteria | 2659 |
| 239 | Ga0268264_10094529 | 3300028381 | Bacteria | 2584 |
| 240 | Ga0268264_10199463 | 3300028381 | Bacteria | 1830 |
| 241 | Ga0268264_10906155 | 3300028381 | Bacteria | 885 |
| 242 | Ga0265332_10085280 | 3300031238 | Bacteria | 1338 |
| 243 | Ga0307413_10175509 | 3300031824 | Bacteria | 1522 |
| 244 | Ga0307416_100758104 | 3300032002 | Unclassified | 1064 |
| 245 | Ga0373926_0065460 | 3300035083 | Unclassified | 1329 |
| 246 | Ga0373949_0072588 | 3300035090 | Bacteria | 904 |
| 247 | Ga0373945_0020076 | 3300035116 | Bacteria | 2284 |
| 248 | Ga0373954_0107071 | 3300035118 | Bacteria | 1351 |
| 249 | Ga0373943_0001265 | 3300035170 | Bacteria | 11318 |
| 250 | Ga0373946_0000555 | 3300035171 | Bacteria | 12327 |
| 251 | Ga0373955_0020699 | 3300035172 | Bacteria | 3311 |
| 252 | Ga0373955_0123927 | 3300035172 | Bacteria | 1504 |
| 253 | Ga0373955_0412024 | 3300035172 | Unclassified | 822 |
| 254 | Ga0373931_0407253 | 3300035691 | Bacteria | 862 |
| 255 | Ga0373935_0005913 | 3300035692 | Bacteria | 7251 |
| 256 | Ga0373927_0034823 | 3300035695 | Bacteria | 3275 |
| 257 | Ga0373927_0445839 | 3300035695 | Unclassified | 855 |
| 258 | Ga0373937_0686653 | 3300036401 | Bacteria | 970 |
| 259 | Ga0373925_0000774 | 3300037068 | Bacteria | 29390 |
| 260 | Ga0466966_0195211 | 3300044684 | Bacteria | 1226 |
| 261 | Ga0453684_1290499 | 3300044712 | Unclassified | 762 |
| 262 | Ga0451576_0295135 | 3300045051 | Bacteria | 1695 |
| 263 | Ga0451576_0585851 | 3300045051 | Unclassified | 1172 |
| 264 | Ga0495592_0060529 | 3300046454 | Bacteria | 2785 |
| 265 | Ga0495653_0280387 | 3300046463 | Bacteria | 1094 |
| 266 | Ga0495608_0081441 | 3300046511 | Bacteria | 2103 |
| 267 | Ga0495628_0349219 | 3300046516 | Bacteria | 1088 |
| 268 | Ga0495630_0001845 | 3300046517 | Bacteria | 14790 |
| 269 | Ga0495586_0047807 | 3300046535 | Bacteria | 2311 |
| 270 | Ga0495621_0197798 | 3300046539 | Unclassified | 808 |
| 271 | Ga0495645_0020630 | 3300046543 | Bacteria | 4758 |
| 272 | Ga0495645_0465443 | 3300046543 | Bacteria | 795 |
| 273 | Ga0495667_0354449 | 3300046559 | Unclassified | 927 |
| 274 | Ga0495659_0146697 | 3300046664 | Bacteria | 945 |
| 275 | Ga0495657_0120142 | 3300046675 | Bacteria | 1656 |
| 276 | Ga0495599_0158568 | 3300046678 | Bacteria | 1399 |
| 277 | Ga0495647_0058399 | 3300046681 | Bacteria | 1516 |
| 278 | Ga0495658_0089146 | 3300046683 | Bacteria | 1824 |
| 279 | Ga0495613_0000507 | 3300046689 | Bacteria | 32852 |
| 280 | Ga0495600_0426617 | 3300046809 | Bacteria | 822 |
| 281 | Ga0495674_0071627 | 3300047319 | Bacteria | 2991 |
| 282 | Ga0495684_0000188 | 3300047471 | Bacteria | 47553 |
| 283 | Ga0495684_0622149 | 3300047471 | Bacteria | 726 |
| 284 | Ga0496100_0000448 | 3300048903 | Bacteria | 19914 |
| 285 | Ga0496101_0002514 | 3300048904 | Bacteria | 11257 |
| 286 | Ga0496102_0060758 | 3300048905 | Bacteria | 3457 |
| 287 | Ga0496104_0031992 | 3300048907 | Bacteria | 4895 |
| 288 | Ga0496104_0241341 | 3300048907 | Bacteria | 1719 |
| 289 | Ga0496105_0067097 | 3300048908 | Bacteria | 2962 |
| 290 | Ga0496106_0050432 | 3300048909 | Bacteria | 3137 |
| 291 | Ga0496107_0019653 | 3300048910 | Bacteria | 4766 |
| 292 | Ga0496107_0166783 | 3300048910 | Unclassified | 1633 |
| 293 | Ga0496108_0006500 | 3300048911 | Bacteria | 9482 |
| 294 | Ga0496112_0015766 | 3300048915 | Bacteria | 7060 |
| 295 | Ga0496112_0646786 | 3300048915 | Bacteria | 987 |
| 296 | Ga0496112_0720724 | 3300048915 | Viruses | 925 |
| 297 | Ga0496113_0074457 | 3300048916 | Bacteria | 2589 |
| 298 | Ga0496114_0003658 | 3300048917 | Bacteria | 11830 |
| 299 | Ga0496114_0037122 | 3300048917 | Bacteria | 4030 |
| 300 | Ga0496114_0090296 | 3300048917 | Bacteria | 2600 |
| 301 | Ga0496114_0169819 | 3300048917 | Bacteria | 1900 |
| 302 | Ga0496115_0279086 | 3300048918 | Unclassified | 1372 |
| 303 | Ga0501034_0010792 | 3300049571 | Bacteria | 9491 |
| 304 | Ga0501047_0005626 | 3300049581 | Bacteria | 11805 |
| 305 | Ga0501070_0523468 | 3300049586 | Bacteria | 951 |
| 306 | Ga0501073_0431609 | 3300049589 | Bacteria | 910 |
| 307 | Ga0501044_0002807 | 3300049823 | Bacteria | 19856 |
| 308 | nmdc:mga05p37_128988_c1 | 3300050507 | Bacteria | 3104 |
| 309 | nmdc:mga05p37_14746_c1 | 3300050507 | Bacteria | 9387 |
| 310 | nmdc:mga05p37_210080_c1 | 3300050507 | Bacteria | 1467 |
| 311 | nmdc:mga05p37_26826_c1 | 3300050507 | Bacteria | 7008 |
| 312 | nmdc:mga05p37_510556_c1 | 3300050507 | Bacteria | 1377 |
| 313 | nmdc:mga05p37_7460_c1 | 3300050507 | Bacteria | 12894 |
| 314 | nmdc:mga05p37_95774_c1 | 3300050507 | Bacteria | 3657 |
| 315 | nmdc:mga08y16_147131_c1 | 3300050511 | Bacteria | 2449 |
| 316 | nmdc:mga08y16_7610_c1 | 3300050511 | Bacteria | 11336 |
| 317 | nmdc:mga0n895_298033_c1 | 3300050512 | Bacteria | 1635 |
| 318 | nmdc:mga0rr50_159189_c1 | 3300050513 | Bacteria | 1831 |
| 319 | nmdc:mga0rr50_77501_c1 | 3300050513 | Bacteria | 2555 |
| 320 | nmdc:mga08x19_146440_c1 | 3300050514 | Bacteria | 1597 |
| 321 | nmdc:mga0a205_118986_c1 | 3300050515 | Bacteria | 2540 |
| 322 | nmdc:mga0a205_144117_c1 | 3300050515 | Bacteria | 2282 |
| 323 | nmdc:mga0a205_209839_c1 | 3300050515 | Bacteria | 1836 |
| 324 | nmdc:mga0a205_3450_c1 | 3300050515 | Bacteria | 14113 |
| 325 | Ga0495601_0004328 | 3300053077 | Bacteria | 8203 |
| 326 | Ga0495595_0022747 | 3300053084 | Bacteria | 2754 |
| 327 | Ga0495619_0058652 | 3300053085 | Bacteria | 2556 |
| 328 | Ga0495619_0187352 | 3300053085 | Unclassified | 1432 |
| 329 | Ga0501082_0160734 | 3300060353 | Bacteria | 1952 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044712 | Ga0453684_1290499 | Ga0453684_1290499_39_683 | 195 |
| 2 | 3300046809 | Ga0495600_0426617 | Ga0495600_0426617_58_735 | 199 |
| 3 | 3300025907 | Ga0207645_10360318 | Ga0207645_103603181 | 205 |
| 4 | 3300032002 | Ga0307416_100758104 | Ga0307416_1007581041 | 206 |
| 5 | iso_pu_bacteria | 2738543017 | 2739269281 | 206 |
| 6 | 3300005444 | Ga0070694_100189450 | Ga0070694_1001894502 | 208 |
| 7 | 3300005545 | Ga0070695_100001702 | Ga0070695_10000170212 | 208 |
| 8 | 3300005549 | Ga0070704_100013395 | Ga0070704_1000133956 | 208 |
| 9 | 3300009147 | Ga0114129_10013657 | Ga0114129_100136572 | 208 |
| 10 | 3300050507 | nmdc:mga05p37_95774_c1 | nmdc:mga05p37_95774_c1_1816_2460 | 208 |
| 11 | 3300050515 | nmdc:mga0a205_118986_c1 | nmdc:mga0a205_118986_c1_487_1131 | 208 |
| 12 | 3300045051 | Ga0451576_0585851 | Ga0451576_0585851_368_1009 | 209 |
| 13 | 3300005295 | Ga0065707_10309674 | Ga0065707_103096742 | 210 |
| 14 | 3300005295 | Ga0065707_10323254 | Ga0065707_103232541 | 210 |
| 15 | 3300005328 | Ga0070676_10006032 | Ga0070676_100060322 | 210 |
| 16 | 3300005329 | Ga0070683_100032468 | Ga0070683_1000324684 | 210 |
| 17 | 3300005329 | Ga0070683_100185504 | Ga0070683_1001855042 | 210 |
| 18 | 3300005331 | Ga0070670_100118502 | Ga0070670_1001185022 | 210 |
| 19 | 3300005334 | Ga0068869_100824020 | Ga0068869_1008240201 | 210 |
| 20 | 3300005335 | Ga0070666_10022615 | Ga0070666_100226153 | 210 |
| 21 | 3300005335 | Ga0070666_10259056 | Ga0070666_102590563 | 210 |
| 22 | 3300005337 | Ga0070682_100122207 | Ga0070682_1001222072 | 210 |
| 23 | 3300005338 | Ga0068868_100054349 | Ga0068868_1000543493 | 210 |
| 24 | 3300005338 | Ga0068868_100169146 | Ga0068868_1001691463 | 210 |
| 25 | 3300005340 | Ga0070689_100114146 | Ga0070689_1001141462 | 210 |
| 26 | 3300005347 | Ga0070668_100071196 | Ga0070668_1000711962 | 210 |
| 27 | 3300005353 | Ga0070669_100054530 | Ga0070669_1000545302 | 210 |
| 28 | 3300005353 | Ga0070669_100133480 | Ga0070669_1001334802 | 210 |
| 29 | 3300005354 | Ga0070675_100008173 | Ga0070675_1000081738 | 210 |
| 30 | 3300005355 | Ga0070671_100339722 | Ga0070671_1003397222 | 210 |
| 31 | 3300005356 | Ga0070674_100220929 | Ga0070674_1002209292 | 210 |
| 32 | 3300005356 | Ga0070674_100259586 | Ga0070674_1002595862 | 210 |
| 33 | 3300005364 | Ga0070673_100019988 | Ga0070673_1000199883 | 210 |
| 34 | 3300005364 | Ga0070673_100100589 | Ga0070673_1001005892 | 210 |
| 35 | 3300005365 | Ga0070688_100302240 | Ga0070688_1003022402 | 210 |
| 36 | 3300005406 | Ga0070703_10244783 | Ga0070703_102447831 | 210 |
| 37 | 3300005434 | Ga0070709_10008290 | Ga0070709_100082904 | 210 |
| 38 | 3300005437 | Ga0070710_10148899 | Ga0070710_101488992 | 210 |
| 39 | 3300005438 | Ga0070701_10263761 | Ga0070701_102637612 | 210 |
| 40 | 3300005440 | Ga0070705_100119604 | Ga0070705_1001196043 | 210 |
| 41 | 3300005440 | Ga0070705_100817351 | Ga0070705_1008173511 | 210 |
| 42 | 3300005441 | Ga0070700_100001951 | Ga0070700_1000019517 | 210 |
| 43 | 3300005441 | Ga0070700_100654418 | Ga0070700_1006544181 | 210 |
| 44 | 3300005444 | Ga0070694_100028208 | Ga0070694_1000282084 | 210 |
| 45 | 3300005457 | Ga0070662_100036423 | Ga0070662_1000364232 | 210 |
| 46 | 3300005457 | Ga0070662_100077040 | Ga0070662_1000770401 | 210 |
| 47 | 3300005459 | Ga0068867_100139495 | Ga0068867_1001394951 | 210 |
| 48 | 3300005459 | Ga0068867_100182401 | Ga0068867_1001824013 | 210 |
| 49 | 3300005459 | Ga0068867_100214768 | Ga0068867_1002147682 | 210 |
| 50 | 3300005468 | Ga0070707_101220904 | Ga0070707_1012209041 | 210 |
| 51 | 3300005471 | Ga0070698_100074937 | Ga0070698_1000749372 | 210 |
| 52 | 3300005471 | Ga0070698_100178079 | Ga0070698_1001780793 | 210 |
| 53 | 3300005518 | Ga0070699_100142014 | Ga0070699_1001420142 | 210 |
| 54 | 3300005518 | Ga0070699_100197138 | Ga0070699_1001971382 | 210 |
| 55 | 3300005518 | Ga0070699_100243245 | Ga0070699_1002432452 | 210 |
| 56 | 3300005535 | Ga0070684_100190456 | Ga0070684_1001904562 | 210 |
| 57 | 3300005536 | Ga0070697_100033666 | Ga0070697_1000336664 | 210 |
| 58 | 3300005536 | Ga0070697_100119190 | Ga0070697_1001191901 | 210 |
| 59 | 3300005544 | Ga0070686_100051702 | Ga0070686_1000517023 | 210 |
| 60 | 3300005545 | Ga0070695_100186440 | Ga0070695_1001864402 | 210 |
| 61 | 3300005545 | Ga0070695_100195799 | Ga0070695_1001957991 | 210 |
| 62 | 3300005548 | Ga0070665_100018557 | Ga0070665_1000185577 | 210 |
| 63 | 3300005548 | Ga0070665_100023225 | Ga0070665_1000232255 | 210 |
| 64 | 3300005548 | Ga0070665_100636297 | Ga0070665_1006362972 | 210 |
| 65 | 3300005549 | Ga0070704_100065016 | Ga0070704_1000650162 | 210 |
| 66 | 3300005549 | Ga0070704_100237671 | Ga0070704_1002376712 | 210 |
| 67 | 3300005549 | Ga0070704_100240365 | Ga0070704_1002403652 | 210 |
| 68 | 3300005549 | Ga0070704_100347377 | Ga0070704_1003473771 | 210 |
| 69 | 3300005549 | Ga0070704_100367433 | Ga0070704_1003674333 | 210 |
| 70 | 3300005563 | Ga0068855_100291777 | Ga0068855_1002917772 | 210 |
| 71 | 3300005563 | Ga0068855_100742819 | Ga0068855_1007428192 | 210 |
| 72 | 3300005577 | Ga0068857_101208920 | Ga0068857_1012089201 | 210 |
| 73 | 3300005578 | Ga0068854_100542518 | Ga0068854_1005425181 | 210 |
| 74 | 3300005614 | Ga0068856_100012722 | Ga0068856_1000127225 | 210 |
| 75 | 3300005615 | Ga0070702_100016693 | Ga0070702_1000166935 | 210 |
| 76 | 3300005617 | Ga0068859_100170268 | Ga0068859_1001702682 | 210 |
| 77 | 3300005618 | Ga0068864_100006498 | Ga0068864_1000064988 | 210 |
| 78 | 3300005718 | Ga0068866_10051070 | Ga0068866_100510702 | 210 |
| 79 | 3300005719 | Ga0068861_100018542 | Ga0068861_1000185422 | 210 |
| 80 | 3300005719 | Ga0068861_100902327 | Ga0068861_1009023272 | 210 |
| 81 | 3300005834 | Ga0068851_10247695 | Ga0068851_102476952 | 210 |
| 82 | 3300005841 | Ga0068863_100047664 | Ga0068863_1000476643 | 210 |
| 83 | 3300005841 | Ga0068863_100199793 | Ga0068863_1001997932 | 210 |
| 84 | 3300005842 | Ga0068858_100001195 | Ga0068858_1000011953 | 210 |
| 85 | 3300005842 | Ga0068858_100017067 | Ga0068858_1000170676 | 210 |
| 86 | 3300005842 | Ga0068858_100039189 | Ga0068858_1000391895 | 210 |
| 87 | 3300005842 | Ga0068858_100133957 | Ga0068858_1001339573 | 210 |
| 88 | 3300005842 | Ga0068858_100389646 | Ga0068858_1003896461 | 210 |
| 89 | 3300005843 | Ga0068860_100301163 | Ga0068860_1003011632 | 210 |
| 90 | 3300005843 | Ga0068860_100359551 | Ga0068860_1003595513 | 210 |
| 91 | 3300005843 | Ga0068860_100422504 | Ga0068860_1004225042 | 210 |
| 92 | 3300005843 | Ga0068860_101024829 | Ga0068860_1010248291 | 210 |
| 93 | 3300005844 | Ga0068862_100051707 | Ga0068862_1000517074 | 210 |
| 94 | 3300005844 | Ga0068862_100686339 | Ga0068862_1006863392 | 210 |
| 95 | 3300005937 | Ga0081455_10117576 | Ga0081455_101175762 | 210 |
| 96 | 3300005937 | Ga0081455_10374302 | Ga0081455_103743021 | 210 |
| 97 | 3300006237 | Ga0097621_100001981 | Ga0097621_1000019815 | 210 |
| 98 | 3300006237 | Ga0097621_100026980 | Ga0097621_1000269802 | 210 |
| 99 | 3300006237 | Ga0097621_100157064 | Ga0097621_1001570642 | 210 |
| 100 | 3300006237 | Ga0097621_100336962 | Ga0097621_1003369623 | 210 |
| 101 | 3300006844 | Ga0075428_100379445 | Ga0075428_1003794452 | 210 |
| 102 | 3300006844 | Ga0075428_100383623 | Ga0075428_1003836232 | 210 |
| 103 | 3300006852 | Ga0075433_10356364 | Ga0075433_103563642 | 210 |
| 104 | 3300006871 | Ga0075434_100124392 | Ga0075434_1001243923 | 210 |
| 105 | 3300006881 | Ga0068865_100015969 | Ga0068865_1000159695 | 210 |
| 106 | 3300006881 | Ga0068865_100141073 | Ga0068865_1001410731 | 210 |
| 107 | 3300006881 | Ga0068865_100269568 | Ga0068865_1002695682 | 210 |
| 108 | 3300006931 | Ga0097620_100170275 | Ga0097620_1001702752 | 210 |
| 109 | 3300007076 | Ga0075435_100002333 | Ga0075435_1000023332 | 210 |
| 110 | 3300007076 | Ga0075435_100002895 | Ga0075435_1000028955 | 210 |
| 111 | 3300009093 | Ga0105240_10082523 | Ga0105240_100825232 | 210 |
| 112 | 3300009093 | Ga0105240_10140985 | Ga0105240_101409851 | 210 |
| 113 | 3300009094 | Ga0111539_10000935 | Ga0111539_1000093522 | 210 |
| 114 | 3300009094 | Ga0111539_10008540 | Ga0111539_100085405 | 210 |
| 115 | 3300009094 | Ga0111539_10455093 | Ga0111539_104550932 | 210 |
| 116 | 3300009098 | Ga0105245_10089696 | Ga0105245_100896962 | 210 |
| 117 | 3300009098 | Ga0105245_10423919 | Ga0105245_104239192 | 210 |
| 118 | 3300009101 | Ga0105247_10002020 | Ga0105247_100020208 | 210 |
| 119 | 3300009101 | Ga0105247_10147047 | Ga0105247_101470473 | 210 |
| 120 | 3300009147 | Ga0114129_10007867 | Ga0114129_100078676 | 210 |
| 121 | 3300009147 | Ga0114129_10117078 | Ga0114129_101170783 | 210 |
| 122 | 3300009147 | Ga0114129_10189994 | Ga0114129_101899943 | 210 |
| 123 | 3300009147 | Ga0114129_10349607 | Ga0114129_103496072 | 210 |
| 124 | 3300009147 | Ga0114129_10885939 | Ga0114129_108859391 | 210 |
| 125 | 3300009148 | Ga0105243_10006691 | Ga0105243_100066915 | 210 |
| 126 | 3300009148 | Ga0105243_10028042 | Ga0105243_100280422 | 210 |
| 127 | 3300009176 | Ga0105242_10001497 | Ga0105242_100014978 | 210 |
| 128 | 3300009176 | Ga0105242_10010723 | Ga0105242_100107232 | 210 |
| 129 | 3300009176 | Ga0105242_10155440 | Ga0105242_101554402 | 210 |
| 130 | 3300009176 | Ga0105242_10666029 | Ga0105242_106660291 | 210 |
| 131 | 3300009176 | Ga0105242_10844516 | Ga0105242_108445162 | 210 |
| 132 | 3300009177 | Ga0105248_10004967 | Ga0105248_1000496713 | 210 |
| 133 | 3300009177 | Ga0105248_10032316 | Ga0105248_100323164 | 210 |
| 134 | 3300009177 | Ga0105248_10347109 | Ga0105248_103471092 | 210 |
| 135 | 3300009551 | Ga0105238_10485749 | Ga0105238_104857492 | 210 |
| 136 | 3300009553 | Ga0105249_10759647 | Ga0105249_107596471 | 210 |
| 137 | 3300013296 | Ga0157374_10005500 | Ga0157374_1000550012 | 210 |
| 138 | 3300013296 | Ga0157374_11277879 | Ga0157374_112778791 | 210 |
| 139 | 3300013306 | Ga0163162_10194211 | Ga0163162_101942113 | 210 |
| 140 | 3300013308 | Ga0157375_10252470 | Ga0157375_102524701 | 210 |
| 141 | 3300014325 | Ga0163163_10021113 | Ga0163163_100211132 | 210 |
| 142 | 3300014325 | Ga0163163_10638183 | Ga0163163_106381832 | 210 |
| 143 | 3300014325 | Ga0163163_11359286 | Ga0163163_113592861 | 210 |
| 144 | 3300014968 | Ga0157379_10285364 | Ga0157379_102853642 | 210 |
| 145 | 3300014969 | Ga0157376_10052476 | Ga0157376_100524764 | 210 |
| 146 | 3300014969 | Ga0157376_10152202 | Ga0157376_101522022 | 210 |
| 147 | 3300017792 | Ga0163161_10125570 | Ga0163161_101255702 | 210 |
| 148 | 3300020069 | Ga0197907_11211912 | Ga0197907_112119121 | 210 |
| 149 | 3300020080 | Ga0206350_10454947 | Ga0206350_104549471 | 210 |
| 150 | 3300020082 | Ga0206353_10024490 | Ga0206353_100244902 | 210 |
| 151 | 3300022467 | Ga0224712_10050333 | Ga0224712_100503332 | 210 |
| 152 | 3300025898 | Ga0207692_10125469 | Ga0207692_101254692 | 210 |
| 153 | 3300025899 | Ga0207642_10126994 | Ga0207642_101269943 | 210 |
| 154 | 3300025900 | Ga0207710_10050873 | Ga0207710_100508732 | 210 |
| 155 | 3300025900 | Ga0207710_10095975 | Ga0207710_100959753 | 210 |
| 156 | 3300025903 | Ga0207680_10131563 | Ga0207680_101315632 | 210 |
| 157 | 3300025903 | Ga0207680_10332932 | Ga0207680_103329322 | 210 |
| 158 | 3300025906 | Ga0207699_10030395 | Ga0207699_100303951 | 210 |
| 159 | 3300025907 | Ga0207645_10005347 | Ga0207645_100053476 | 210 |
| 160 | 3300025911 | Ga0207654_10584914 | Ga0207654_105849141 | 210 |
| 161 | 3300025913 | Ga0207695_10094368 | Ga0207695_100943681 | 210 |
| 162 | 3300025917 | Ga0207660_10181277 | Ga0207660_101812773 | 210 |
| 163 | 3300025923 | Ga0207681_10018066 | Ga0207681_100180661 | 210 |
| 164 | 3300025923 | Ga0207681_10178358 | Ga0207681_101783582 | 210 |
| 165 | 3300025924 | Ga0207694_10251393 | Ga0207694_102513932 | 210 |
| 166 | 3300025925 | Ga0207650_10087970 | Ga0207650_100879703 | 210 |
| 167 | 3300025925 | Ga0207650_10166488 | Ga0207650_101664882 | 210 |
| 168 | 3300025925 | Ga0207650_10551692 | Ga0207650_105516923 | 210 |
| 169 | 3300025927 | Ga0207687_10009905 | Ga0207687_100099054 | 210 |
| 170 | 3300025928 | Ga0207700_10261374 | Ga0207700_102613742 | 210 |
| 171 | 3300025931 | Ga0207644_10306702 | Ga0207644_103067021 | 210 |
| 172 | 3300025933 | Ga0207706_10016243 | Ga0207706_100162433 | 210 |
| 173 | 3300025933 | Ga0207706_10336123 | Ga0207706_103361232 | 210 |
| 174 | 3300025934 | Ga0207686_10029858 | Ga0207686_100298583 | 210 |
| 175 | 3300025934 | Ga0207686_10061276 | Ga0207686_100612761 | 210 |
| 176 | 3300025934 | Ga0207686_10086370 | Ga0207686_100863702 | 210 |
| 177 | 3300025934 | Ga0207686_10284344 | Ga0207686_102843442 | 210 |
| 178 | 3300025934 | Ga0207686_10635729 | Ga0207686_106357292 | 210 |
| 179 | 3300025937 | Ga0207669_10171872 | Ga0207669_101718722 | 210 |
| 180 | 3300025937 | Ga0207669_10301934 | Ga0207669_103019342 | 210 |
| 181 | 3300025938 | Ga0207704_10004730 | Ga0207704_100047304 | 210 |
| 182 | 3300025938 | Ga0207704_10273290 | Ga0207704_102732901 | 210 |
| 183 | 3300025938 | Ga0207704_10281146 | Ga0207704_102811462 | 210 |
| 184 | 3300025940 | Ga0207691_10217365 | Ga0207691_102173652 | 210 |
| 185 | 3300025940 | Ga0207691_10567035 | Ga0207691_105670351 | 210 |
| 186 | 3300025941 | Ga0207711_10010415 | Ga0207711_100104154 | 210 |
| 187 | 3300025941 | Ga0207711_10366320 | Ga0207711_103663201 | 210 |
| 188 | 3300025942 | Ga0207689_10531834 | Ga0207689_105318341 | 210 |
| 189 | 3300025944 | Ga0207661_10359781 | Ga0207661_103597812 | 210 |
| 190 | 3300025944 | Ga0207661_10478204 | Ga0207661_104782042 | 210 |
| 191 | 3300025960 | Ga0207651_10077219 | Ga0207651_100772192 | 210 |
| 192 | 3300025961 | Ga0207712_10044402 | Ga0207712_100444022 | 210 |
| 193 | 3300025972 | Ga0207668_10053925 | Ga0207668_100539253 | 210 |
| 194 | 3300025972 | Ga0207668_10071244 | Ga0207668_100712442 | 210 |
| 195 | 3300025972 | Ga0207668_10308822 | Ga0207668_103088222 | 210 |
| 196 | 3300025972 | Ga0207668_11071834 | Ga0207668_110718341 | 210 |
| 197 | 3300025981 | Ga0207640_10019514 | Ga0207640_100195141 | 210 |
| 198 | 3300025986 | Ga0207658_10333916 | Ga0207658_103339163 | 210 |
| 199 | 3300026023 | Ga0207677_10033620 | Ga0207677_100336203 | 210 |
| 200 | 3300026023 | Ga0207677_10097404 | Ga0207677_100974043 | 210 |
| 201 | 3300026023 | Ga0207677_10298850 | Ga0207677_102988502 | 210 |
| 202 | 3300026035 | Ga0207703_10097906 | Ga0207703_100979061 | 210 |
| 203 | 3300026035 | Ga0207703_10107221 | Ga0207703_101072212 | 210 |
| 204 | 3300026035 | Ga0207703_10366665 | Ga0207703_103666651 | 210 |
| 205 | 3300026035 | Ga0207703_10513686 | Ga0207703_105136861 | 210 |
| 206 | 3300026041 | Ga0207639_10262798 | Ga0207639_102627983 | 210 |
| 207 | 3300026075 | Ga0207708_10001028 | Ga0207708_100010285 | 210 |
| 208 | 3300026075 | Ga0207708_10142201 | Ga0207708_101422013 | 210 |
| 209 | 3300026088 | Ga0207641_10000305 | Ga0207641_1000030551 | 210 |
| 210 | 3300026088 | Ga0207641_10095485 | Ga0207641_100954852 | 210 |
| 211 | 3300026088 | Ga0207641_10532593 | Ga0207641_105325931 | 210 |
| 212 | 3300026089 | Ga0207648_10096299 | Ga0207648_100962992 | 210 |
| 213 | 3300026089 | Ga0207648_10199875 | Ga0207648_101998753 | 210 |
| 214 | 3300026089 | Ga0207648_10441313 | Ga0207648_104413132 | 210 |
| 215 | 3300026089 | Ga0207648_10787460 | Ga0207648_107874601 | 210 |
| 216 | 3300026089 | Ga0207648_10851253 | Ga0207648_108512531 | 210 |
| 217 | 3300026118 | Ga0207675_100011386 | Ga0207675_1000113864 | 210 |
| 218 | 3300026118 | Ga0207675_100181525 | Ga0207675_1001815253 | 210 |
| 219 | 3300026118 | Ga0207675_100994141 | Ga0207675_1009941411 | 210 |
| 220 | 3300026118 | Ga0207675_101233577 | Ga0207675_1012335771 | 210 |
| 221 | 3300027907 | Ga0207428_10005438 | Ga0207428_100054381 | 210 |
| 222 | 3300027907 | Ga0207428_10032249 | Ga0207428_100322494 | 210 |
| 223 | 3300028379 | Ga0268266_10016288 | Ga0268266_100162885 | 210 |
| 224 | 3300028380 | Ga0268265_10036294 | Ga0268265_100362943 | 210 |
| 225 | 3300028380 | Ga0268265_10063859 | Ga0268265_100638593 | 210 |
| 226 | 3300028380 | Ga0268265_10856793 | Ga0268265_108567932 | 210 |
| 227 | 3300028380 | Ga0268265_10965150 | Ga0268265_109651501 | 210 |
| 228 | 3300028381 | Ga0268264_10088941 | Ga0268264_100889412 | 210 |
| 229 | 3300028381 | Ga0268264_10094529 | Ga0268264_100945292 | 210 |
| 230 | 3300028381 | Ga0268264_10199463 | Ga0268264_101994632 | 210 |
| 231 | 3300028381 | Ga0268264_10906155 | Ga0268264_109061552 | 210 |
| 232 | 3300031824 | Ga0307413_10175509 | Ga0307413_101755092 | 210 |
| 233 | 3300035090 | Ga0373949_0072588 | Ga0373949_0072588_175_825 | 210 |
| 234 | 3300035172 | Ga0373955_0412024 | Ga0373955_0412024_139_792 | 210 |
| 235 | 3300035691 | Ga0373931_0407253 | Ga0373931_0407253_157_807 | 210 |
| 236 | 3300036401 | Ga0373937_0686653 | Ga0373937_0686653_167_817 | 210 |
| 237 | 3300045051 | Ga0451576_0295135 | Ga0451576_0295135_1017_1667 | 210 |
| 238 | 3300046463 | Ga0495653_0280387 | Ga0495653_0280387_204_851 | 210 |
| 239 | 3300046516 | Ga0495628_0349219 | Ga0495628_0349219_348_1004 | 210 |
| 240 | 3300046539 | Ga0495621_0197798 | Ga0495621_0197798_46_705 | 210 |
| 241 | 3300046543 | Ga0495645_0465443 | Ga0495645_0465443_115_765 | 210 |
| 242 | 3300046559 | Ga0495667_0354449 | Ga0495667_0354449_211_864 | 210 |
| 243 | 3300046664 | Ga0495659_0146697 | Ga0495659_0146697_261_920 | 210 |
| 244 | 3300046681 | Ga0495647_0058399 | Ga0495647_0058399_798_1448 | 210 |
| 245 | 3300046683 | Ga0495658_0089146 | Ga0495658_0089146_539_1192 | 210 |
| 246 | 3300047319 | Ga0495674_0071627 | Ga0495674_0071627_225_875 | 210 |
| 247 | 3300047471 | Ga0495684_0622149 | Ga0495684_0622149_22_672 | 210 |
| 248 | 3300048907 | Ga0496104_0241341 | Ga0496104_0241341_137_790 | 210 |
| 249 | 3300048908 | Ga0496105_0067097 | Ga0496105_0067097_513_1160 | 210 |
| 250 | 3300048910 | Ga0496107_0166783 | Ga0496107_0166783_962_1615 | 210 |
| 251 | 3300048911 | Ga0496108_0006500 | Ga0496108_0006500_6073_6726 | 210 |
| 252 | 3300048915 | Ga0496112_0015766 | Ga0496112_0015766_3636_4289 | 210 |
| 253 | 3300048915 | Ga0496112_0646786 | Ga0496112_0646786_88_735 | 210 |
| 254 | 3300048915 | Ga0496112_0720724 | Ga0496112_0720724_230_889 | 210 |
| 255 | 3300048916 | Ga0496113_0074457 | Ga0496113_0074457_199_852 | 210 |
| 256 | 3300048917 | Ga0496114_0037122 | Ga0496114_0037122_1549_2208 | 210 |
| 257 | 3300048917 | Ga0496114_0090296 | Ga0496114_0090296_776_1426 | 210 |
| 258 | 3300048917 | Ga0496114_0169819 | Ga0496114_0169819_287_949 | 210 |
| 259 | 3300048918 | Ga0496115_0279086 | Ga0496115_0279086_396_1055 | 210 |
| 260 | 3300049571 | Ga0501034_0010792 | Ga0501034_0010792_6246_6899 | 210 |
| 261 | 3300049581 | Ga0501047_0005626 | Ga0501047_0005626_1260_1913 | 210 |
| 262 | 3300049586 | Ga0501070_0523468 | Ga0501070_0523468_35_688 | 210 |
| 263 | 3300049589 | Ga0501073_0431609 | Ga0501073_0431609_219_878 | 210 |
| 264 | 3300049823 | Ga0501044_0002807 | Ga0501044_0002807_14794_15447 | 210 |
| 265 | 3300050507 | nmdc:mga05p37_128988_c1 | nmdc:mga05p37_128988_c1_1429_2079 | 210 |
| 266 | 3300050507 | nmdc:mga05p37_14746_c1 | nmdc:mga05p37_14746_c1_3074_3811 | 210 |
| 267 | 3300050507 | nmdc:mga05p37_210080_c1 | nmdc:mga05p37_210080_c1_30_680 | 210 |
| 268 | 3300050507 | nmdc:mga05p37_26826_c1 | nmdc:mga05p37_26826_c1_1899_2636 | 210 |
| 269 | 3300050507 | nmdc:mga05p37_510556_c1 | nmdc:mga05p37_510556_c1_62_715 | 210 |
| 270 | 3300050507 | nmdc:mga05p37_7460_c1 | nmdc:mga05p37_7460_c1_3693_4355 | 210 |
| 271 | 3300050511 | nmdc:mga08y16_147131_c1 | nmdc:mga08y16_147131_c1_474_1124 | 210 |
| 272 | 3300050511 | nmdc:mga08y16_7610_c1 | nmdc:mga08y16_7610_c1_5491_6150 | 210 |
| 273 | 3300050512 | nmdc:mga0n895_298033_c1 | nmdc:mga0n895_298033_c1_318_968 | 210 |
| 274 | 3300050513 | nmdc:mga0rr50_159189_c1 | nmdc:mga0rr50_159189_c1_417_1064 | 210 |
| 275 | 3300050513 | nmdc:mga0rr50_77501_c1 | nmdc:mga0rr50_77501_c1_153_803 | 210 |
| 276 | 3300050514 | nmdc:mga08x19_146440_c1 | nmdc:mga08x19_146440_c1_563_1216 | 210 |
| 277 | 3300050515 | nmdc:mga0a205_144117_c1 | nmdc:mga0a205_144117_c1_303_953 | 210 |
| 278 | 3300050515 | nmdc:mga0a205_209839_c1 | nmdc:mga0a205_209839_c1_1090_1752 | 210 |
| 279 | 3300050515 | nmdc:mga0a205_3450_c1 | nmdc:mga0a205_3450_c1_7765_8415 | 210 |
| 280 | 3300053085 | Ga0495619_0058652 | Ga0495619_0058652_1835_2485 | 210 |
| 281 | 3300053085 | Ga0495619_0187352 | Ga0495619_0187352_763_1416 | 210 |
| 282 | 3300060353 | Ga0501082_0160734 | Ga0501082_0160734_771_1427 | 210 |
| 283 | 3300005458 | Ga0070681_10005027 | Ga0070681_1000502711 | 212 |
| 284 | 3300005577 | Ga0068857_100193245 | Ga0068857_1001932451 | 212 |
| 285 | 3300025912 | Ga0207707_10182425 | Ga0207707_101824253 | 212 |
| 286 | 3300025921 | Ga0207652_10061637 | Ga0207652_100616371 | 212 |
| 287 | 3300026116 | Ga0207674_10219352 | Ga0207674_102193521 | 212 |
| 288 | 3300031238 | Ga0265332_10085280 | Ga0265332_100852802 | 213 |
| 289 | 3300006358 | Ga0068871_100106790 | Ga0068871_1001067902 | 214 |
| 290 | 3300009177 | Ga0105248_10085025 | Ga0105248_100850252 | 214 |
| 291 | 3300009551 | Ga0105238_10238899 | Ga0105238_102388992 | 214 |
| 292 | 3300010375 | Ga0105239_10579638 | Ga0105239_105796383 | 214 |
| 293 | 3300025941 | Ga0207711_10181558 | Ga0207711_101815582 | 214 |
| 294 | 3300026121 | Ga0207683_10085574 | Ga0207683_100855742 | 214 |
| 295 | 3300035116 | Ga0373945_0020076 | Ga0373945_0020076_10_675 | 216 |
| 296 | 3300046454 | Ga0495592_0060529 | Ga0495592_0060529_1922_2587 | 216 |
| 297 | 3300009098 | Ga0105245_10015905 | Ga0105245_100159055 | 217 |
| 298 | 3300009176 | Ga0105242_10263817 | Ga0105242_102638172 | 217 |
| 299 | 3300048903 | Ga0496100_0000448 | Ga0496100_0000448_7687_8355 | 217 |
| 300 | 3300048904 | Ga0496101_0002514 | Ga0496101_0002514_9189_9857 | 217 |
| 301 | 3300048905 | Ga0496102_0060758 | Ga0496102_0060758_746_1414 | 217 |
| 302 | 3300048907 | Ga0496104_0031992 | Ga0496104_0031992_3882_4550 | 217 |
| 303 | 3300048909 | Ga0496106_0050432 | Ga0496106_0050432_1312_1980 | 217 |
| 304 | 3300048910 | Ga0496107_0019653 | Ga0496107_0019653_265_933 | 217 |
| 305 | 3300048917 | Ga0496114_0003658 | Ga0496114_0003658_1028_1696 | 217 |
| 306 | 3300044684 | Ga0466966_0195211 | Ga0466966_0195211_122_778 | 218 |
| 307 | 3300035083 | Ga0373926_0065460 | Ga0373926_0065460_315_998 | 222 |
| 308 | 3300035170 | Ga0373943_0001265 | Ga0373943_0001265_7867_8550 | 222 |
| 309 | 3300035171 | Ga0373946_0000555 | Ga0373946_0000555_9952_10635 | 222 |
| 310 | 3300035172 | Ga0373955_0020699 | Ga0373955_0020699_1843_2526 | 222 |
| 311 | 3300035172 | Ga0373955_0123927 | Ga0373955_0123927_641_1324 | 222 |
| 312 | 3300035692 | Ga0373935_0005913 | Ga0373935_0005913_1721_2404 | 222 |
| 313 | 3300035695 | Ga0373927_0034823 | Ga0373927_0034823_1941_2624 | 222 |
| 314 | 3300037068 | Ga0373925_0000774 | Ga0373925_0000774_25850_26533 | 222 |
| 315 | 3300046511 | Ga0495608_0081441 | Ga0495608_0081441_1395_2078 | 222 |
| 316 | 3300046517 | Ga0495630_0001845 | Ga0495630_0001845_4013_4696 | 222 |
| 317 | 3300046535 | Ga0495586_0047807 | Ga0495586_0047807_292_975 | 222 |
| 318 | 3300046543 | Ga0495645_0020630 | Ga0495645_0020630_1942_2625 | 222 |
| 319 | 3300046675 | Ga0495657_0120142 | Ga0495657_0120142_501_1184 | 222 |
| 320 | 3300046678 | Ga0495599_0158568 | Ga0495599_0158568_191_874 | 222 |
| 321 | 3300046689 | Ga0495613_0000507 | Ga0495613_0000507_25264_25947 | 222 |
| 322 | 3300047471 | Ga0495684_0000188 | Ga0495684_0000188_7024_7707 | 222 |
| 323 | 3300053077 | Ga0495601_0004328 | Ga0495601_0004328_803_1486 | 222 |
| 324 | 3300053084 | Ga0495595_0022747 | Ga0495595_0022747_1265_1948 | 222 |
| 325 | 3300035695 | Ga0373927_0445839 | Ga0373927_0445839_51_737 | 223 |
| 326 | 3300035118 | Ga0373954_0107071 | Ga0373954_0107071_12_758 | 228 |
| 327 | 3300013296 | Ga0157374_10473334 | Ga0157374_104733341 | 229 |
| 328 | 3300021358 | Ga0213873_10019005 | Ga0213873_100190052 | 236 |
| 329 | 3300026116 | Ga0207674_10398709 | Ga0207674_103987092 | 240 |
| 330 | 3300005290 | Ga0065712_10094851 | Ga0065712_100948512 | 248 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3c3p-assembly1.cif.gz_B | crystal structure of a methyltransferase (np_951602.1) from geobacter sulfurreducens at 1.90 a resolution | 0.944 | 43 | 248 |
| 5lhm-assembly1.cif.gz_A | crystal structure of safc from myxococcus xanthus apo-form | 0.9363 | 46 | 248 |
| 3c3p-assembly2.cif.gz_C-2 | crystal structure of a methyltransferase (np_951602.1) from geobacter sulfurreducens at 1.90 a resolution | 0.9354 | 41 | 247 |
| 5zw4-assembly1.cif.gz_A | crystal structure of trna bound trmr | 0.9331 | 46 | 248 |
| 5zw3-assembly1.cif.gz_B | crystal structure of trmr from b. subtilis | 0.9311 | 46 | 248 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5lhmA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9363 | 46 | 248 | 3.40.50.150 |
| af_A0A0R0IR39_2_192_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9353 | 77 | 246 | 3.40.50.150 |
| 3c3pB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9347 | 43 | 248 | 3.40.50.150 |
| af_F4IAT4_68_291_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9296 | 81 | 247 | 3.40.50.150 |
| 5x7fA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9288 | 45 | 248 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8L8J5-F1-model_v4 | Methyltransferase | 0.9886 | 76 | 247 |
GO:0008171
GO:0008757 GO:0032259 |
| AF-A0A7X6I983-F1-model_v4 | O-methyltransferase | 0.9852 | 41 | 248 |
GO:0008171
GO:0008757 GO:0032259 |
| AF-A0A2V8P8W2-F1-model_v4 | O-methyltransferase | 0.9841 | 158 | 247 |
GO:0008171
GO:0008757 GO:0032259 |
| AF-A0A3N5J047-F1-model_v4 | O-methyltransferase | 0.9835 | 46 | 248 |
GO:0008171
GO:0008757 GO:0032259 |
| AF-A0A2H5WW56-F1-model_v4 | O-methyltransferase (EC 2.1.1.-) | 0.9778 | 42 | 248 |
GO:0008171
GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar